1K0SA

Solution structure of the chemotaxis protein chew from the thermophilic organism thermotoga maritima
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
151
structure length
151
Chain Sequence
b'MKTLADALKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITVKEGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEW
publication title The solution structure and interactions of CheW from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 16
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2001-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0sA01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 1k0sA02
2I0NA 2YSQA 2A36A 2JW4A 3JV3A 1B3QA 1K1ZA 1ZLMA 2O9SA 3PVQA 3VRYA 4ORZA 1JU5C 1KSWA 1I07A 3EHRA 3I5RA 1NEBA 4OMOA 1KFZA 1ZSGA 2LQWA 2DVJA 4J9BA 1V1CA 1MV3A 3SHWA 3RBBB 1YP5A 4Z8AA 4E6RA 2K2MA 3EGUA 2SEMA 1AD5A 2L2PA 2EGAA 4RTTA 1ABQA 1GCQA 1XOVA 2BZYA 2KNBB 1K4US 1WDXA 2ABLA 2DL4A 3VS0A 3M0RA 2EW3A 1M3AA 2D8HA 2ENMA 2KRSA 4J9GA 1OEBA 3H41A 2DJQA 1YN8A 1UJYA 1WXUA 3LH5A 1GBRA 2H8HA 4HVUA 1ARKA 2ECZA 2DRKA 2OAWA 2B86A 2PTKA 4LE9A 3ZL7C 1PHTA 2DBKA 3REAB 3FJ5A 1VYUA 2OJ2A 2KXCA 1X27A 4AFSC 2J05A 5GJVB 1NM7A 2XMFA 2L0AA 1GCQC 1UHCA 1QKXA 1M27C 2LCSA 3M0PA 2GTJA 1VYTA 2KEAA 4J9FA 2K7AA 2KRNA 3O5ZA 4JPBW 2KXDA 4HVVA 2JS0A 3UATA 4LN2A 4KRTA 2NUZA 1GRIA 2KE9A 2CUDA 4J9CA 2IIMA 2CH4W 1SRLA 4R0KA 3THKA 1SHFA 3EG2A 2YUNA 3VS5A 1GFCA 3EG0A 2LX7A 1BU1A 2RNAA 3NMZC 1Y0MA 1UGVA 1AEYA 2GQIA 4RTUA 1BB9A 3PE0A 4AG1C 4GLMA 4FSSA 2F2VA 4LUDA 5HCKA 3NHNA 2VWFA 3TSWA 1IO6A 1AZGB 2A37A 2CDTA 3GBQA 4RTXA 1GL5A 3CQTA 1B07A 2FG0A 1OPKA 2AK5A 2LZ6B 4IIOA 2X3XD 3A98A 2DYBA 1K0XA 2DL7A 4Y92A 1GBQA 3M0SA 2AZVA 2MCNA 3ULRB 2DA9A 2SRCA 1JQQA 4OMPA 1W1FA 2EVRA 3C0CA 2LJ1A 1YNZA 2PZ1A 1JO8A 4F14A 4OMLA 2HEQA 4HVWA 2M51A 4RTZA 1K9AA 4LNPA 2ED0A 2GNCA 1WXTA 1A0NB 1Y57A 2FO0A 1NLOC 1SEMA 1X6GA 2MOXA 2RPNA 1WYXA 2O9VA 2CSIA 1OOTA 1J3TA 4OMMA 1SRMA 1ZUUA 4Z88A 1QKWA 4CC3A 2J6KA 1YWOA 3IQLA 2EGCA 1AWXA 4RTYA 1AZEA 1G83A 2DF6A 4X1VA 1UJ0A 2DRMA 4OMQA 1RLPC 2RN8A 3R6NA 2EBPA 5FW9A 2KRMA 3M0TA 2EPDA 2DNUA 4HXJA 4F16A 2GGRA 1WIEA 1GFDA 2RF0A 1X43A 2FPFA 3I9QA 1PWTA 1I1JA 3M0QA 3QWYA 4RUGA 2KYMA 3KFVA 2YUOA 5FWCA 1E6HA 1T3SA 2FPEA 1TUCA 1ZBJA 4J9EA 4OMNA 2E5KA 1I0CA 2JMCA 1KIKA 2DMOA 3VS7A 2RQTA 2DL3A 3NGPA 2ROLA 1SPKA 2O2OA 1N5ZA 1PRMC 4HCKA 1BBZA 1E6GA 1VA7A 3H0HA 1M3CA 2BZ8A 1AOJA 1WFWA 1QWFA 2JM9A 1QWEA 4EIKA 2P4RA 1K0SA 1SHGA 2DL5A 2V1QA 4J9DA 1NYGA 2C0IA 2LJ3A 2D1XA 5L23A 3H0FA 2CREA 3EG1A 2JMAA 2ESWA 1H92A 1HD3A 1TUDA 2J6FA 4ZNXA 2JT4A 1FYNA 2F2XA 1X6BA 1NG2A 1PRLC 1HSQA 1KJWA 2AKKA 2HSPA 4RTVA 1AWOA 1H3HA 4J9IA 2C0OA 4CC4B 1AWJA 1U5SA 1JXOA 2DBMA 2F2WA 2FRWA 1MUZA 3PVLA 1H8KA 3VS3A 2DL8A 2K3BA 1WI7A 2JS2A 4JZ4A 2D0NA 2W0ZA 4M4ZA 2EYXA 1VYVA 4D8KA 1WX6A 4DEXA 3EHQA 2FRYA 3EG3A 1JXMA 1BK2A 2EYZA 2HCKA 4J9HA 4D8DA 2M0YA 5IHKA 2LNHB 1G2BA 5IXBA 2LQNA 2EYYA 1NLPC 4JJCA 2J06A 2X3WD 5I22A 2FEIA 1T3LA 4QT7A 2EQIA 1UHFA 2YDLA 2LJ0A 1QCFA 2YUPA 1WA7A 2RMOA 1YCSB 2DE0X 2NWMA 1UECA 1ZUKA 1YWPA 2JTEA 2VVKA 1T0JA 2A28A 1WXBA 2A08A 2EKHA 2KBTA 1AVZC 2DX1A 2RQWA 1M30A 4AG2C 3RNJA 1OPLA 4A63B 4Z89A 3QWXX 1RLQC 2KYBA 1FMKA 1ABOA 2LP5A 4JJBA 1AWWA 2KROA 4AFZC 2C0TA 2DM1A 2EYWA 1K76A 2JM8A 2YUQA 1W70A 3UA6A 1NYFA 1TG0A 1QLYA 1X2KA 2RQVA 4WCIA 2G6FX 3M0UA 2JXBA 2O88A 2GBQA 2AZSA 4F17A 3VS1A 1UE9A 2OI3A 2W10A 3REBB 1OV3A 2J6OA 5FWBA 1HJDA 1Z9ZA 1W6XA 1WLPB 2PNIA 5IXFA 1CSKA 1UTIA 1ZUYA 2CSQA 3UF4A 2L3SA 1UG1A 1PKSA 4JJDA 1UDLA 5IHNA 4DEYA 1PKTA 5ECAA 2BZXA 3VS6A 2BTTA 4LUEA 1PNJA 2MIOA 3TVTA 4K11A 1NEGA 3VS2A 1SSHA 2KT1A 1M3BA 4CC2A 1CKAA 2KR3A 1UUEA 3U23A 1EFNA 3VRZA 2FPDA 2KT8A 1U3OA 1GCPA 1E7OA 1U06A 2K79A 2RQRA 2L3QA 4JZ3A 5I11A 2CUBA 2D8JA 5EC7A 1T0HA 1X69A 2GTOA 2KGTA 2V1RA 5IH2A 2ROTA 2AKLA 2CH4A 2RQUA 2EGEA 1X2QA 2CT3A 2K9GA 5IHIA 4CC7A 1S1NA 1RI9A 3I35A 3SEMA 1CKBA 2LMJA 2L3PA 2CT4A 5GJWB 1LCKA 1JEGA 3I5SA 2J7IA 2HDAA 2HBWA 3TSZA 1RUWA 1Z9QA 4RTWA 2ED1A 4IIMA 4AFUC 2DLPA 2DILA 3NPFA 2QDLA 4ESRA 2O31A 3H0IA 1MV0B 2YT6A 1UFFA 4AFQC 1ZX6A 3UA7A 3VS4A 2VKNA 1M8MA 2K6DA 4GBQA
chains in the Genus database with same CATH superfamily
2I0NA 2RSOA 2JUFA 4XIGS 2A36A 2XKOC 1UGQB 3GF5A 4IFDG 3OYKA 2YRDA 2O9SA 1JE4A 5JEAG 1Q86C 4ORZA 3PUXA 1K73C 4JVZA 3GTQH 2LS01 1JU5C 2B39A 4PMCA 1IHWA 3PO2H 2FMMA 4Y7NH 3EGXB 2FHTA 4EQPA 2ZTDA 4PMBA 3VYRA 1NEBA 4C3JB 1S5FD 4IOAA 4OMOA 1KFZA 4A53A 3I4NB 1ZSGA 2RO0A 4Y52H 4AH6A 2E6NA 2YYZA 1XQHA 4JI3Q 1KRTA 3CC7Q 2DVJA 3J7ZC 2ZM6Q 4ZRZA 3M4OB 1GXIE 2X51A 4RWSC 4A3DG 3I3CA 5AFWA 1E0BA 3DM1A 2CP6A 2K2MA 3EGUA 2FMCA 3ZEHA 4C8QC 2L5TA 5GAN2 5C5LA 4XQJA 1MNEA 4ZTJA 1ABQA 1TXQA 4BXXH 3VYTA 4A3CH 1QCOA 1STEA 2BZYA 4XU2A 5FJ8G 4OB2B 3RD4A 3H9NA 1EY9A 3VS0A 2DL4A 2YV5A 3D6CA 2EW3A 5CKFA 1BBUA 1M3AA 4F87A 3DXJC 1XMQQ 4K5VA 2D8HA 2ENMA 2KRSA 5KYNA 1S3OA 5IP9G 4J9GA 1OEBA 1MI2A 4ZUJA 2I0QA 1A63A 4X3SA 5IT9L 1NE8A 2DK3A 1HNZQ 3QWNA 3SGIA 4H0LC 4O1NA 1BNZA 1QCNA 2YLBA 4PJLA 1QG7A 4ZKBB 1Q8IA 3RN2A 3NPPA 2X4JA 5LMNQ 4JJNK 3ZL7C 1AE3A 4YY3Q 1BXTA 2HHHQ 2BDNA 1Q82U 1VYUA 1ILQA 4GZYC 3K7AH 3V7CA 2F0IA 5EG2A 1U4RA 4R1JA 1RTNA 2A69D 2J05A 3GTQB 4DBQA 2XMFA 2L0AA 2EQUA 1VS0A 4PZ8A 3PO2B 3SVMA 4OONA 4Y7NB 1GCQC 3ME9A 1I4QA 1MKHA 2CGHA 3MWYW 5JOBA 1WCMG 1LOJA 1TIID 3M4YA 4PLIA 1ZXTA 1JRIA 2JK8A 4PJOC 2R6GA 2V8KA 1VYTA 2KEAA 4J9FA 1Y07A 1TS3A 4OWTB 3VKIA 3O5ZA 4JPBW 2NUCA 2O01E 2KXDA 2WAQE 2E41A 4JLGA 2ID0A 1STGA 4M7AG 1E2VA 2FZKB 4BBSH 3G7ZA 2JOYA 3OW2A 3KLWA 1XTDA 2KOLA 1EZ8A 3FMCA 4M7AC 5GAMf 1JOKA 2CUDA 2VUBA 5KYUB 1AEXA 4DV5Q 5EJWA 1R9TH 4O42A 4GLVB 5D65A 2YTXA 4NW2A 1PSFA 4M7DG 3W3AA 1I94Q 3UE0A 3THKA 1SHFA 1XNRQ 4XTVA 2KHJA 5CKHA 4BUGA 2L0CA 3LWEA 3R93A 2ZM6L 4M7DC 3MC0B 1NE3A 2RNAA 3NMZC 1Y14B 1A0IA 4BS9A 4GKJQ 4R9WA 3JC66 4B3SQ 1WD0A 3H0GG 3CCSA 4IUVA 3HP9A 4KULA 4YTLA 2Z6KC 4IJHA 2LTOA 2M9UA 2UUAQ 2WSCE 2G9DA 3A56A 4J8OA 3GTLH 5C4JH 2VASA 4LF6Q 2A5HA 2F2VA 5EKLA 3NHNA 5CBEE 4U673 4KH1B 5FLXL 1VQ8T 1VQMQ 2EYPA 1XMQL 1O9SA 1WHKA 1JJ2A 5DEHA 3K7AB 4QVDA 1RAHB 1CI3M 2EQKA 4M75G 1R0CB 1SYDA 3CQTA 2DETA 1HNZL 1B07A 2VW9A 1YJNA 1QVGS 4JS5A 2D0PA 3ULPA 2XWBB 4IIOA 4JI8L 2HQHA 1R77A 2DYBA 4KH0B 2KDSA 4M75C 3X25B 2EY6A 1SFOH 1K8GA 5A35A 2ZPBB 2MCNA 1UGPB 1SE8A 4QQGA 3H91A 1D0ZA 2H1EA 4F04B 2E75C 3JCMf 3C0CA 1SYCA 3QR8A 5LMNL 1A3UA 3V96A 2KCMA 3CD6T 3AFQA 1D1AA 3MFYA 4YY3L 4OGQC 4XTZA 2K1BA 2HHHL 4OMLA 2HEQA 3JB9H 4N9TA 2B2VC 4HVWA 4C92E 4HJ9A 2M51A 3T9NA 4B3TQ 4X6AH 4VUBA 4LNPA 3EH1A 3OPOA 4BBSB 3FVQA 4PZ7A 1SLJA 1WXTA 1TT2A 3MCAB 4UY8C 4A3EH 1IBLQ 1Y57A 2L12A 5CKBA 1F2ZA 3BE3A 3MXPA 2DTOA 2MOXA 5EBCA 1R9TB 1WYXA 4ME5A 1OOTA 2EJGA 1LTBD 3STBD 3H6ZA 1SRMA 4Z88A 4BI3A 4X3UA 2Q2TA 3CCLQ 1BBWA 3TRZA 1OYXA 1YWOA 3IQLA 4FCYA 1Z9FA 2B63G 5TSSA 1F9QA 5GAN3 5LL6S 5LJ3d 3MFGA 3NBHB 4JK1C 5CR2A 4X1VA 1VQKT 4DV1Q 4O6JA 3E19A 3PCOB 1PCXA 1D1CA 2NVXH 3CXCA 1CQVA 2EBPA 3CCVA 3DKMA 3DHQA 1I5LA 3M0TA 2ATCB 3QSUA 5C4JB 3GTLB 4G4KA 3G48A 1ACMB 4DV5L 1KC8R 1PVOA 1WIEA 4QVZA 2NN6H 1DZ1A 3M7GA 3FRPB 1Q46A 4RUGA 4C92F 3GLXA 1IHVA 2J7ZA 3EFOA 1I94L 3L2QA 1O7ZA 2K4KA 1XNRL 2IHEA 1U5KA 1TUCA 2ZXOA 1ZBJA 3G6ET 2QASA 4CDFC 5NUCA 1W2BP 1BCPF 1VCIA 2N55A 4OMNA 4GKJL 3KLSX 1KIKA 1KNEA 2PYKA 4B3SL 4IUQA 1ZYRC 5M5WH 1SFOB 4R55A 2DL3A 1B34A 2D6FA 4LF6L 1SPKA 1Q8KA 4GLAC 4K5WA 3MPUB 2CP2A 2MO0A 3JCMb 2XDBA 1S4ZA 3TDQA 3CPWA 2JYOA 5IOCA 2B2UC 3H0HA 2KI7A 2BDOA 2QGQA 2R57A 5K36H 3IRBA 1CKOA 3A5UA 3SE0A 1N27A 3QOJA 4JYAQ 1QWEA 2JTFA 4A3EB 3QKJA 2MO1A 1MGQA 2ZXRA 3K8AA 1K0SA 3MXGA 5EGTA 5M3FG 3P8DA 2LJ3A 4A4IA 3UDCA 1VQ4A 1VQ9A 2OT2A 1FJGQ 1Y1VH 1UEAB 3PO2G 1AP0A 1S72A 3H0FA 3E0JA 5C3EG 4RGOS 2COZA 3S2DH 2ESWA 3HOXG 4DK3C 4B3TL 1G8XA 2NVXB 1B34B 3QG1A 2JT4A 1FYNA 2AIRB 3GP8A 5IGGA 4KHZA 4DAVA 1X6BA 5JJIA 3PF5A 1IBLL 4ZGDB 1J5EL 2PVOB 2LT4A 4B9XA 1PRLC 3LGLA 4JOIC 4L59A 1YIJA 4A54A 3BDUA 1EZ6A 1RKNA 1SYEA 1NSNS 4NL2A 2F0SA 3IFDA 3BY7A 3CMAT 4DBFA 1J6QA 3RUXA 3IFTA 4HT9A 3BDLA 2ASBA 4M1UB 4BI8B 3TS0A 1AWJA 2EJ9A 2HIVA 4R4CA 5H1SE 4ODGA 2OQ0A 3ZYYX 3ICEA 4C8QE 2AUKA 5KIXA 3J7AV 1JXOA 5FKAC 4JI1Q 3I90A 3NQIA 1YITA 3MAQA 2V4DA 1CZWA 5C4HA 5M5WB 2JS2A 4DBHA 1GKHA 2F5KA 3BYYB 4LUOA 4GNXC 1AZPA 1MJCA 3HZXA 1VQPT 2PCFB 1WGSA 1WX6A 5KNCA 1TUGB 1NBEB 2GF7A 5GANe 2XRSD 3EHQA 4GS3A 1RJTA 4KKSA 4APVA 2HD3A 5GMKl 1M5Q1 2VZAA 4TSSA 1BK2A 2HCKA 4FW1A 1JWMD 5LHY1 1L0YB 1H9KA 1MGSA 4L5GA 2QEJC 3U58A 4LF8Q 3L2WA 1QE6A 1STHA 3J7A5 4PJJA 3WWVA 2LQNA 2EYYA 3NEMA 5GAMd 3J80c 2NVTH 5LJ5j 4JJCA 3EVQA 3Q8DA 2J06A 1ESFA 2JXMB 5I22A 4DA2A 3F8TA 1SYFA 5M5XH 3SWNA 1VQLT 5IT9c 3U4ZA 3F1ZA 4C8QF 4PG3A 1QCFA 1HTPA 3CPFA 1Y1VB 4YIJA 1YCSB 2DERA 5E1FA 1EYDA 4ILWA 5KNDA 3M4GA 4N9PA 3S2DB 1WZOA 1YWPA 2JTEA 2VVKA 3MTSA 4DR3Q 5LJ5h 4ULLA 4MTNA 2PQAB 2NLUA 3WVDB 4NB3A 1RAFB 4ZUIA 3RDVA 2HKNA 2EVBA 1M30A 1PH2A 3RKXA 4BBSG 1OPLA 5GAN8 3QWXX 3FDRA 4PJMA 4C92A 2L89A 3CCET 2KYBA 1K83H 1LTLA 1VOMA 2C5CA 2MJ8A 4XQNA 5E4WC 5GQOA 1SRUA 2M16A 3V8LA 3PTAA 4RGTA 1WTXA 1UGSB 4AFZC 5GAN6 4M7AE 1ZEQX 2ZAEA 4IOCA 3SWNB 4XTWA 2JSOA 4FYYB 1B3AA 4J6HA 4QQBX 2VB3X 1QUQA 4DUYQ 1RAGB 1BR9A 4R4IA 4AT1B 4LAAA 2JM8A 4PFZA 1OXSC 3JCMd 2L9HA 1W70A 3AU7A 4K5XA 2CZ6B 1TG0A 1SSFA 4LF4Q 4M7DE 1OXUA 1Y1WG 3TP8A 4V190 5EPJA 4WCIA 3M0UA 5A2QE 2KECA 2O5JC 1WHJA 3S2HH 2JZ2A 1RI0A 1D1IA 3OYMA 1Q95G 3A5ZB 4KKUA 4DOVA 1PH7A 3CW2C 3KK7A 4JI1L 1K8AR 2NVTB 2RHZA 1PLFA 3CCRQ 1VQ6Q 4C0GA 5M5XB 1W6XA 2MK5A 3E1SA 1PTOH 2TMPA 3HGBA 2AUJD 4BDZA 3PIO3 2R93G 1UE1A 4FSXA 3UPUA 1SF9A 3G7LA 3QXEB 4FL6A 1W2BS 1KRSA 5E4XA 4M7AF 1KDCA 5DM7R 1B9MA 4ZN3A 2L3SA 2HT1A 3OYLA 5L37A 3T1YL 3CAMA 4IJLA 3J7YW 1D3BA 4LF8L 5BN3A 5DNFA 1JB0E 1QP2A 1UDLA 2PVGB 4M75E 1D5XC 5IHNA 2P0KA 1O7IA 1X55A 4X9DA 4XU1A 2N49A 1DOMA 2HKQB 1Z6HA 5FLXc 2BZXA 4O5VA 1OULA 1PRTF 4M7DF 3JB9G 4LUEA 3I55Q 2MIOA 2F0PA 4BBRH 3TVTA 4KJOA 2MNAA 2NVQH 3HOUH 1ZSZC 2HZYA 4A4FA 1C8CA 3OBWA 1KQSP 2KK4A 2N78A 1NR2A 2L15A 1HZCA 4DK1A 4CC2A 3D4RA 1CKAA 1FVIA 4R4OA 1AHJB 5IGEA 2DZ9A 3HSBA 1K83B 3U23A 1KABA 1EFNA 1KC8U 2EYOA 2X6LA 3A8IE 3KF6B 4YHHL 3PIOA 1PYSB 3DB3A 1YJWQ 2F5TX 1V1PA 1GCPA 4V0BA 2AT1B 3NQTA 4YCVA 3OS5A 2H3EB 3A74A 4DR3L 4KHPQ 1XJWB 5I2YA 1IHZA 2E5QA 4N0AA 3QDFA 4S3SA 1EOTA 1RCVD 1SBBB 1VQBA 1E1OA 4J8QA 4N8FA 2K5FA 4JBMA 1KXLA 4LFBQ 4LDUA 5EC7A 2D2CC 3TZDA 2MQHA 3DLMA 1L1OC 4DN4M 4NXMQ 4OXPA 1D3BB 5GAOl 4M75F 3D31A 2DO3A 1EWHA 4E6IA 4G7HC 5M5YH 2EGEA 3L2VA 3S2HB 3NTKA 4LWCA 1OI1A 1RAEB 2CP3A 3SEMA 1VQ8A 3I35A 3OYFA 1C0MA 3KLRA 4NDXA 1WTOA 1CKBA 2L3PA 5GJWB 3E0EA 5DLQE 3K7UC 2HBWA 1WQWA 4DUYL 1TTHB 5C0XJ 2CZ7B 4DV7Q 1G6ZA 1H9MA 2LCLA 3LH0A 1PTOB 2RQXA 3KUPA 3X28B 2NYSA 3NBIA 1ZQ1A 4LF4L 1G2TA 3NP8A 2K75A 4U68A 2FZGB 4C8QA 5ELBA 1EY7A 3H0IA 3Q1JA 3FKIH 3A55A 3L42A 2LKVA 1PH5A 4AFQC 2VXFA 3CD6A 1ZX6A 5T1IA 1F77A 4GOPA 1X01A 1K8AC 4A3BG 2NB0A 4BBRB 3SD4A 2F0KA 1XTCD 2QA4Q 3JV3A 4PJOD 1EEFD 1SROA 2WB1E 3HOUB 2NVQB 1K1ZA 1ZLMA 5EPKA 2VYTA 2H4OA 1YCYA 1YVCA 3PNWC 3A7LA 1I07A 2QEXT 4X65L 3U9OA 3QZ9B 2KCTA 1GUTA 1YNJD 4A3GG 1M2VB 1ZBXA 4MZ9A 3K0YA 3J80i 2LQWA 5GANg 2ENBA 3TP6A 1VQKA 3QJ6A 1EU4A 4EMKC 2FVUA 1RADB 3MP6A 2FZCB 1ASYA 9ATCB 2FYKA 3RBBB 5GROA 2KQ3A 4QIWE 1TWBA 2IJ0A 2V1CC 3GOXA 3KBXA 1WJJA 4EVOA 1B50A 1WYDA 3OYEA 1U0LA 4GLXA 2SEMA 4YWMA 3BG3A 2L2PA 4OGEA 2IX0A 3A8JE 4N4HA 5M5YB 1NUCA 2VQFL 3DWPA 2XSCA 4PMWA 1GCQA 4GOPB 4X64Q 2F0NA 2K3YA 4HKEA 4MZTA 3KXTA 1K4US 2UUCQ 1G3SA 1ZA2B 4UC4A 1WDXA 3ZBDA 5C3XA 3M0RA 4KHPL 4PJOA 3CEYA 3G6EA 4IFDJ 4RCBA 5GAMe 3ZJYC 3CC7T 4LFBL 4KBMB 4RKBA 1PHJA 3S1NH 3OMCA 2DJQA 2RA4A 3PMIA 2JA9A 4OGCA 1NZ9A 1UJYA 1WXUA 3LH5A 3OSSC 3CC4Q 2PW5A 5C4XG 1GBRA 1MHWC 1SE4A 4HAEA 2I5MX 2B2YC 3I72A 5I4DA 3O8VA 3W1BA 4C3IH 2DRKA 3FKIB 2EYLA 4OWXB 2B86A 3VYGA 2PTKA 4LE9A 4DXFA 1IREB 3HOWH 4Q0FA 2DBKA 3REAB 3FIFA 3FJ5A 4HCCA 1YNXA 5I6YA 3OYAA 2OCEA 4DV7L 3RN5A 2OJ2A 3L1AA 4K6LA 2JA6G 1A6XA 1IYVA 4AFSC 4DV0Q 4L5TA 1BCPC 4WF2A 1KLGD 1L2FA 1SJHD 3FRNA 3S9WA 2RJEA 1P8LA 3S3MA 2Z6KA 3MEUA 3AQQA 2VNUD 2NVYH 5KEEA 3HOYG 4PJOB 4IPHA 3H15A 1BCOA 3V7RA 4DU9A 2Y4YA 3EA6A 4J6YA 4M77G 2GTJA 2C9OA 3F2UA 4C5IA 1ONLA 3UDXA 3V05A 2K7AA 2KRNA 3S17H 3RIRA 5ELOA 5CV6A 5CGKA 2BUDA 1OXTA 5EBDA 4L6TB 4LN2A 1A3VA 3JCMe 1GUOA 1PFNA 3CBOA 1GRIA 3BU2A 2R92H 2QK0A 1GUWA 2RI5A 3A8KE 3CMAA 5IT9E 4L8JA 3K58A 3H3VH 1QB5D 2I46A 1SRLA 1IKLA 1KQSS 2LX7A 2CP5A 1HCZA 1SDFA 1QVGP 2KHIA 3S1NB 2MPXC 2ZJPA 2B2VA 1UGVA 4PFPA 2WP8J 4F7UE 4WJWA 5FU7C 1MIUA 2QAZA 4IPCA 4K2KA 5IYDH 1WTWA 4XU0A 3VU3C 2A68C 1VQPA 3R3OA 5CC4A 3VDYA 3SXHA 1VQ7Q 4GLMA 4C3IB 4LUDA 2VWFA 1V9PA 1IO6A 1ZYRD 4HSVA 4X3KA 3SEBA 3HOWB 2O4XA 1AZGB 1CKMA 5CK9A 2RHSB 2DN8A 3ITPA 3K81C 3VA5A 3HG9A 4QQDA 3CRKC 3I8ZA 1JWUD 4DR6L 1M8AA 3MKDA 1JCKB 1F9PA 2AWNA 4HIDA 4IO9A 3CCJQ 2K4YA 1XMOQ 1K8OA 4HR7B 2IWHA 3BYTB 3ND8A 1M2OA 2EYFA 4D6WA 1TS2A 3S6WA 5CR3A 4J5YA 2LZ6B 1FX7A 3A98A 4EQOA 2ZJQA 1VQLA 2DL7A 1K0XA 5IYBH 1TOVA 3KF8A 2NVYB 1YJ9Q 1GBQA 1KTKA 1TWAH 3HOZG 1AH9A 1PD1A 1IB8A 3MHXA 5KCHA 3ULRB 4NL3A 1G3WA 3MXNB 1JQQA 2CQAA 5HK3A 3SK5A 3WDNA 3G71Q 2LJ1A 2PZ1A 3OYCA 1GOZA 1II3A 4F7UF 1OXXK 2EXDA 3S17B 1VQMT 3E3XA 4LDYA 4ZLTF 1OZ2A 2RD1A 1LT6D 1K9AA 2COWA 5IYCH 4DV0L 5GMKi 3NE5B 1TU0B 1A62A 3QO2A 3T13A 2GNCA 4XTYA 3IAYA 4YCWA 2FO0A 1EFID 2ZXPA 3U50C 3D0FA 5ELEA 2R92B 3CMEQ 2E2JH 1OO9B 2O4XB 4UDUC 1T9HA 3HOUG 2CSIA 2LQ8A 2CHBD 4OMMA 3CCEA 1ZUUA 3B6YA 1QKWA 3MEAA 1QWYA 2EPBA 3PFSA 2Q8RE 2VV5A 1AWXA 1AZEA 1EQVA 2EWNA 2B2UA 3I73A 4MNOA 4OMQA 3G4SQ 4N4IA 1RLPC 3KF8B 4AYBG 3J80L 3M54A 3R6NA 2F0VA 3X24B 4QMGA 5FLXE 1U4PA 2LFNA 3GTOH 2KRMA 2GFAA 1VDZA 1ESRA 2A7YA 4MN3A 4JG2A 1IRXA 2DNUA 4HXJA 4F16A 2K6AA 2Q2UA 2GGRA 3M5AA 4WJ4A 3URGA 1Q1BA 1TWFH 1PWTA 3M0QA 2EZVA 4JI8Q 3HFZB 3EFXD 2DD5A 4A4GA 1IL8A 1STBA 2YUOA 1IBKQ 1C7YA 4M78G 1K3RA 4P5NA 3CCLT 4KY6A 4UP9A 1T3SA 4NS5A 1EWCA 2MGSA 2F0TA 2F0LA 4J9EA 1BOSA 1A8VA 4FT2A 2OTLQ 3S1RH 4M78C 1I0CA 1RD9D 1X3FA 1LO5D 3GNFB 4C5HA 1RIPA 2DMOA 3OQ5A 3TREA 2YLCA 5GMKm 2DGYA 2ZPGB 4E47A 1TWAB 3PGZA 5J1ZA 2Z6BA 1YFNA 4XQQA 3S24A 4HCEA 4H13C 2DJGC 1K0RA 4JOIA 4KK7A 2QF7A 4A3IH 2O2OA 4XK8E 1WHLA 4AIMA 4JW0A 3C2PA 5KYYA 4X9CA 1PRMC 2P4TA 4OB3B 1BBZA 1VA7A 1PV4A 1Y8NB 1ILPA 3O13A 3WVEB 2CW0C 3M4QA 2CZ0B 3FKIG 1AOJA 1XMOL 5GANd 4LMQD 1XNIA 3GTPH 2X35A 1WFWA 3GQBA 1A2UA 3HKZE 3PMFA 1A2TA 4EIKA 1TVXA 1RHPA 2A6EC 5GAMg 1MBYA 2E2JB 3OOCA 3QYHB 1VQEA 3J81i 2VS1A 2DL5A 2V1QA 1GD7A 4GNXA 1N8RR 2E5LQ 1LTTD 3P75A 3CP0A 4FF4A 3GD7A 4ID6A 2D1XA 1UNSA 1G3TA 2F0QA 4WFN3 4RMOA 4JC0A 3WOFA 1SKUB 2JA7H 3EG1A 2OXPA 3GTKH 1Y71A 1C0AA 2JMAA 2K5IA 3NFCA 4PV1C 1TUDA 3X20B 1K28A 2K32A 1D7QA 3EFRA 3X3NA 2F2XA 3GTOB 3D8GA 1XXGA 2JJQA 4POFA 1PRTC 1NG2A 4RTVA 3A0JA 1JICA 1QVFP 4FXDA 5LJ5f 2CCZA 4ME7A 1TWFB 3I4MG 1VQNQ 2UXDL 1Z47A 2NUTA 1HZ9A 2MYSA 3RERA 3UDFA 1VQAA 3UDIA 3OSOA 1KDBA 1C4QA 4QB4A 2Q8IB 3PGGA 1B70B 1EYAA 4HJ5A 3HEJA 3S1RB 1U5SA 1N36L 5GMKj 2A0FB 1TY2A 3PQIA 3Q22A 1H8KA 3VS3A 1U1SA 2CKKA 3RLNA 2K50A 2DL8A 2K3BA 1NCVA 3S14H 1G6PA 4C0ZA 4C5GA 2DXCA 2D0NA 4M4ZA 4A3IB 3T1HQ 1VYVA 4Q5WA 3I56Q 3JCMg 3FEOA 1IBKL 2HCIA 2FRYA 3EG3A 1I3QH 5CYUA 4K6DA 1IW7D 2EYZA 4J9HA 3A8GB 2HSEB 2RDFA 4D8DA 2M0YA 3RMHA 5IHKA 4F7UA 4KLKA 5GMKh 3MVVA 1WJRA 1BQQT 4RCOA 1NPRA 4JI5Q 5IXBA 2MI6A 2V26A 5KGUA 3GTPB 4BY1G 3JB9I 4XYOA 4L6V5 3OW7A 4EX5A 3JCMV 1J9OA 1HQRD 1Y8OB 3CXCS 1M90U 2X3WD 4DF7A 4DR7Q 3HRUA 1WHHA 4HJ8A 1SNOA 1DJ7B 4A93G 1DOLA 2EAYA 2OTJQ 2CS7A 2R7ZH 5KYIA 2Y0SB 4OIJA 1LLRD 4CJ2C 5C44H 2QEXA 1IGQA 2LJ0A 1HRJA 2KQWA 1WA7A 1J5EQ 1LTID 3HRSA 3PT9A 1CQFA 5GAOr 3CCMQ 4QY7A 4C1NK 3GTKB 3URYA 1ZUKA 2LX9A 2DNCA 2MUYA 1CA6A 2JA7B 5G3LF 1AW7A 1VQGA 1LVKA 1T0JA 3ULJA 5DM63 4R8IA 1EY0A 1PA6A 2EKHA 4DQ2A 4HIMA 1IKMA 1AVZC 2DX1A 4ZGJB 1F2LA 1RTOA 3CHBD 4C3JG 2RB6A 1ENFA 3QZ5B 2JP1A 3I4NG 5D6XA 1N8RC 1M1KU 3I4OA 2E5LL 4Z89A 4AQYQ 2ICEC 1Z7TA 5LJ3j 2NN6I 4M77E 2R92G 2XIWA 1FMKA 1MSGA 2L55A 1EIHA 1QVCA 5CV5A 1RDPD 2HBPA 2E76C 2BH2A 1VQOQ 1VQ5Q 1NMGA 4OEMB 4XU3A 3K6OA 3CC7A 5GAOm 3S14B 3TS2A 1MNDA 4GY5A 1CSPA 2A74C 3PSIA 4OP0A 4P71A 3SDZA 5FROA 2XK0A 2RI2A 3J81j 5JVG3 5DLOA 4JI4Q 5FRNA 5LJ3h 5KCOA 1ZSZA 1D5ZC 2KUMA 3BS1A 2E74C 2RQVA 5JAVA 4J7IA 4JLIA 1I3QB 4FP5D 4OHJA 5FU6C 2JXBA 1EEID 1F9RA 3F2DA 2GBQA 2BE5C 2AZSA 1IBMQ 2E12A 2HL5C 1P16A 1B1ZA 2BOSA 3IL8A 3VS1A 3S16H 4EPCA 2F52A 1Y7XA 3AMUA 2RHXA 5EPLA 3REBB 1OV3A 2J6OA 4BACA 5FWBA 2FHDA 2AQ1B 5BR8L 4M77F 3M4PA 4WRDA 4KD3A 2R7ZB 4LD9K 5C44B 3T1HL 1Y96A 1YHQQ 1GHJA 1UTIA 3MA2B 5KE3A 1FL0A 1L1OA 1HA5A 4QF4A 3JAML 1F2MA 2F4IA 1TS5A 1UE5A 3H09A 3EFOB 1UG1A 4K8JA 4IUUA 1QJOA 1JT8A 1RAIB 3FPPA 1PKSA 5FLMH 1BI0A 1VQCA 4JI5L 2WIIB 4DEYA 3RKYA 2HQEA 2PZWA 5CIUA 1E2WA 3V2TA 2DIQA 2EYHA 3K80C 4DR7L 1NNXA 5IGCA 3CCRT 1VQ6T 5IYCG 3K5NA 1NEGA 1SSHA 2KT1A 2OWOA 2RH2A 3RR5A 3VA7A 4JI0Q 4OIKA 1M4ZA 5CQYA 2KR3A 4BE1A 3CC2Q 1BKBA 1WTVA 1UUEA 4A4EA 4A3LH 2X4YA 4MDWA 2FPDA 2KT8A 3A8MB 3VRZA 1JJCB 1W4SA 3GPLA 3J81L 4C0DB 1U3OA 2CFMA 2HNIA 3BJUA 4K0KQ 4FW2A 5CV7A 2E70A 4H44C 4GKKL 1UE7A 1U06A 5JJZA 2ALYB 4BXXG 4JZ3A 1OTCA 5D6YA 1KD1U 1L1OB 2D8JA 1V1QA 3I55T 2B2WC 3E9HA 4YCUA 2GTOA 2KGTA 4HCZA 2YU9H 1D1BA 2OEOA 1EQTA 3EQLC 1Q81R 5E7NA 4AQYL 4RKUE 1UB4A 2BA0A 5D3IB 2CH4A 4DR5Q 3L2RA 5DY9A 2C35B 2XI9A 2X69A 1X2QA 4LW1A 4II1A 5IHIA 5CKEA 1KC8C 4CC7A 1BO0A 1N9WA 1RI9A 1YJWT 2K05A 2RK1A 4AYBE 3S16B 2BIVA 1WHMA 2HAXA 3Q24A 3JB9J 1QVFS 1V76A 1LCKA 1FYCA 4R4QA 1JEGA 1D8LA 1O80A 3I5SA 3T1YQ 2VUMH 2HDAA 3TSZA 6AT1B 5C6SA 2QQAA 4JUVA 4EMKA 1EU3A 1RUWA 2E2IH 4RTWA 2ED1A 4PJNA 1BI1A 4C92D 1UWVA 1L0WA 4JI4L 2LCCA 4AFUC 2B8GA 3M55A 5FO9B 4HJAA 1TXYA 2Z4HA 2NZHA 2IPOB 1B7TA 2A8VA 2HDMA 1BBXC 4OB0B 2DJZA 3VUZA 4M78E 3NK9A 2VQEQ 1LJOA 2QDLA 1N8RU 4ESRA 1BCPD 3C94A 2WAQB 4J1MA 1IBML 3FB9A 2Z8LA 4KMUC 5GAMj 4FXKC 3VS4A 2K57A 2VKNA 5C0MA 1M8MA 1VQMA 2SNSA 4X3TA 4C5EA 4DOWA 5CV8A 2AHOB 4YHHQ 3RR6A 2WSFE 2YSQA 4DV2L 2K52A 3MEFA 2JW4A 4KN7C 3L2ZA 1B3QA 3PVQA 1YNNC 4E2FB 1G2SA 3T4AC 1KSWA 1SMYD 1X75C 2A69C 4DAYA 5D7UA 1N9SA 3I5RA 3LYIA 2D5DA 1VIFA 3N6RA 1YI2Q 1XPUA 4JBWA 4K8IA 5C0XH 1JOQA 2K5WA 1H9SA 3UDGA 2JA7G 1WQ7A 2HUGA 2ZZDA 4C3HH 1MV3A 3SHWA 2AMCB 4M78F 1YP5A 4DGZA 3W2DA 1NMFA 2WSEE 2QA4T 2YU9B 4JRIA 1QOHA 4A3KH 1UGRB 2JTMA 1N9RA 3EJIA 4JI0L 4PLLA 1FNVA 5KNBA 2SEBD 3EH2A 4J6WA 2DZCA 1ICWA 1XOVA 2Q2IA 1WD1A 2KNBB 4RG8A 3CCLA 1WOCA 1Q7YU 4K0KL 2ABLA 5HY6A 3C46A 4WTOB 3KJPA 2RDHA 2UUBL 5GAOp 2VUMB 4AMCA 4L5QA 1HNXQ 1F1BB 1I8FA 3D4WA 2E2IB 4OB1B 2CWAA 3VUBA 2VGMA 1VQFA 2GN5A 4JBJA 2IY5B 1Q81C 1HTLD 5CQXA 2F1LA 3D7SB 4HVUA 1ARKA 3VR3A 4DR5L 2KEDA 3M58A 2NUPA 4DV3Q 4C92B 2OAWA 1WPYA 1PH4A 3ASKA 4FU6A 3PF4A 4G7OC 3OBYA 2RCNA 1PHTA 1TKWB 4X65Q 3H6MA 5FRMA 5ELNA 4B08A 4RG1A 3I2ZA 1BCPB 3PUYA 3EG9A 1JR0D 3TP5A 1OX9A 3GTMH 1QUQB 4KY5A 4UP7A 3MZ5A 4ALPA 3KFUA 1NM7A 2IHFA 3FLGA 4LDVA 4KGXB 3CC4T 2OAUA 1WTPA 3ZFJA 2B2TC 1VMCA 2A6HC 1QZHA 2VQEL 4JI7L 1SNCA 4L5RC 3LGJA 4IFDH 4RFBA 5EQ0A 1JMCA 4A3EG 3E5SA 2EIFA 1G8ZD 1TY0A 2MMPA 2CVRA 4C3HB 2NTSA 2PVDB 2J0TD 3Q6SA 1GJXA 4BE2A 1D5MC 3OYYA 1LYLA 1DD2A 2Y4XA 4IZ8A 5EKKA 4C8QD 1D2BA 4OVAA 4JS4A 3RMQA 4A3KB 5GAOq 4DA4A 1X56A 4KRTA 3NXWA 2NUZA 3TEHB 1VIEA 2KHSA 3IKJA 1NPPA 3OWEB 1WJQA 2EQMA 3CRLC 1G3YA 4FM4B 4I65A 4A3DH 3CCQQ 4HCBA 2XTIA 2XGTA 5I9OA 4GLKA 4E7ZA 3STBC 4PQXA 3EG2A 2YUNA 4FIBA 1PXUA 1KAWA 3BZCA 1GFCA 3EG0A 2VB6A 1EIGA 1M1FA 1KIXA 2NN6G 3HTRA 1Y0MA 1W2BA 3WXMB 2GQIA 4C56C 1FXXA 5FJ8H 3TMEA 4RTUA 2Z0WA 2A73B 4MIUA 4KTAA 4QUFA 2Q8TA 4KN4C 3OMGA 5IAYA 1Q12A 5IP9H 2QQSA 4CGYB 4FSSA 2E1HA 1A15A 5HCKA 1SE2A 4ANJA 1I4K1 2ZJRA 1V1PB 1ZHIA 3CCUQ 3PUZA 1Q90A 3I91A 1HNXL 2A37A 2CDTA 3GBQA 1M4VA 1LT4D 4KI0A 3GTMB 2QYZA 4WJ3M 2B29A 1PZJD 2F4VQ 2FG0A 3HP3A 5AJ3L 2A19A 2X3XD 1TWGH 2M02A 2CW0D 2P0QA 4GN4B 2AZVA 5K36G 1KHIA 2N3SA 2K3XA 4WORA 1VQ7T 2EJMA 4DV3L 2M2LA 2DA9A 2SRCA 4OMPA 1HZAA 1W1FA 4CKCA 2EVRA 2ZT9C 4BB7A 5EAYA 1U9RA 3JCMW 4F14A 3MHBA 4XTXA 1LTRD 3HOVH 3NWTA 4ATOA 4HTHA 1WCMH 4RTZA 3CCJT 3OIPA 2JA5H 2RKSA 1Y1VG 3A8HB 4M7AD 1A0NB 1HUNA 2XD0A 3H8ZA 3J7AF 2QGGA 4X34A 1NLOC 2F1MA 3Q0AA 1X6GA 1FNWA 1KHCA 2RPNA 2O9VA 1YJ9T 4C8QB 3GTJH 1J3TA 1Q81U 1HZBA 3QYGB 1AN8A 4A3DB 2JVVA 4XTCS 2F0FA 1PRTD 2HD0A 4M7DD 2F0WA 4RTYA 3G71T 3JAMc 3AYHB 1BDOA 3MP1A 2K33A 1KL9A 4KUIA 3DLLA 5EKIA 1UJ0A 4FYVB 2RN8A 1BYMA 2X9HA 2YWWA 2H3JA 4FNFA 1DONA 2DXBA 2K7VA 3OW2P 4QVCA 1J8IA 4RH6A 4OX9Q 4DR6Q 1KQ2A 2K5DA 5JEAJ 3CMET 3K57A 3K5MA 3NELA 3I9QA 1X43A 1D6EC 1LUZA 2Y90A 1M1GA 4KKTA 3QWYA 2EYJA 3LX0A 1LT5D 4BA1I 3H0GH 5CVIA 1E6HA 1HQMC 5HURA 4ZKCB 3PUWA 4A3JH 3H94A 3UT1A 2FPEA 4J83A 5GAN5 2LT1A 4M7AA 5GAOn 4DPGA 1IYUA 4H02A 3J81c 5LJ5e 1R8OB 3G4ST 1GUNA 1UEBA 4M75D 1KDAA 1BF4A 2Q2HA 5LMUQ 1EX4A 1CKNA 3VS7A 2RQTA 5GAN4 1FD7D 1TWGB 3BVGA 1B44D 4L5SA 3P7JA 2E3HA 3NGPA 4HMIA 4M7DA 2EYQA 2ROLA 4A76A 3I7FA 4K14A 5ELFA 1N5ZA 1D1KA 2D0OA 4KY7A 3D4DA 4MDXA 2L11A 1BIAA 4HCSA 3CU7A 5T1GA 5HGQA 1M9SA 3KOJA 3QIAA 1JJ2P 3HOVB 4QL5A 3TQ7P 2KCNA 1M3CA 2BZ8A 1WCMB 4QQ6A 2IW3A 1BI2A 5IWAQ 5FK9C 1XYIA 1QWFA 2OTLT 2G5DA 2F4VL 2JA5B 1OXVA 3A8OB 3OYNA 1RABB 3CCRA 1VQ6A 1XX8A 3EBEA 1YZ6A 1D0XA 1I4XA 1B7YB 4FF1A 1ET9A 2P4RA 3ND9A 1M90R 1SG5A 1SHGA 1VF5C 2P5ZX 2WFWA 4J9DA 3FEWX 4M77C 3GTJB 3RUZA 2VGNA 3OIQA 1MMNA 2C0IA 4M7AB 3J80E 3OA6A 4E7IA 2K01A 1BIBA 1VUBA 1DYQA 1GUSA 1SYBA 2H5XA 2DXTA 3K0XA 2IPKD 3H3VI 3OWFA 4NMZA 2YHTA 4M75A 3S1MH 2CREA 2VXEA 2PI2E 1JJGA 1TS4A 4O0AA 3VJPA 1B2TA 2EJFC 2NZOA 1LABA 4I7ZC 4ZNXA 3ONAB 4M7DB 1PH6A 1QNKA 4DR1L 3P1HA 2X4WA 2CYZB 1PC0A 3I55A 1X3EA 4RMFA 3CCSQ 2E2DC 4C3HG 2B63H 3KLSA 5KH6A 4DR2Q 1R4PB 1KJWA 2I2LA 3GNGA 2HSPA 1IYJB 2DY7A 5E3FA 1FMWA 4LK1C 3R2TA 1STYA 2G9HD 4A3KG 4LFAL 1M1KR 2HDLA 2YTVA 3H0GB 3QB3A 4A3JB 1LT3D 4CC4B 4RA8A 1YJWA 1MMGA 2XRQD 2PZUA 1H95A 2RA2A 4BY6C 1DCZA 1VQDA 5K5PA 1XJVA 1K3BC 2DBMA 2F2WA 3CXCP 2FRWA 4L63B 4P74A 1MUZA 3PVLA 3MJXA 3LNNA 2RK2A 2BE5D 1YJNQ 2BA1A 3PMTA 1WI7A 4OX9L 1VQHA 2DPPB 1XWEA 4JZ4A 8AT1B 4KUDK 1SNQA 3A7AB 3RLFA 5CMDA 4M75B 4XTUA 4F8MA 1DXMA 4DEXA 4MMKA 1VQNT 3X3MA 1MD2D 1HXYD 1C6VX 3OYBA 2QILA 2LNHB 5LJ3f 1G2BA 1IGUA 2ZPIB 2KSSA 1SN8A 5A0DA 1PTOC 3D3RA 2EOTA 5LMUL 4OO1H 3OTOL 1JBMA 4JBKA 1HK9A 1I6HH 4LF5Q 4N8X1 4HSPA 2QTVA 4K2LA 3KYHC 4RGNA 1EIFA 2DY8A 2E6ZA 1KQSA 1PYBA 1PZKD 3I56T 1I6VC 1I4HA 2R5MA 3DEPA 2RMOA 3CPWP 1OZ3A 1U8RA 1JE5A 4BBRG 4KD4A 4TVAB 1HR0Q 3S1MB 1TU2B 3GV6A 5A0GA 3OYJA 3BDOA 2CP0A 2IX1A 2UXDQ 5IWAL 3NENA 1HYOA 1SEBD 5M3FH 4J15A 1SAPA 1WXBA 4A4KA 4PL6A 3NTHA 2PMZB 3CCVQ 2B63B 2QA4A 3INZA 1OQKA 4P72A 1N36Q 1M90C 5C3EH 4G7ZC 2D0QB 2OTJT 4P73A 4A63B 3QJYA 4P2CB 3HOXH 1PH3A 1PFBA 2EXZA 3UE1A 1PG5B 1HJPA 2FJ2A 3G6JB 4KV6A 2XDPA 3TN2A 2E10A 4Y91A 4FYXB 3NSWA 5GAGC 4OWWB 2I5HA 3T51B 1JC7A 2C06A 4C8QG 2LP5A 1AWWA 3CCMT 2EQJA 3A1PA 2KROA 4BE0A 2WACA 3T56B 2DIGA 1OX8A 5FOBB 4A3FH 2E4HA 1AFPA 4TKOB 1SE3A 2DM1A 2RI3A 1SNMA 4BWGB 1SYGA 2QXFA 4UHVA 5C5MA 2SOBA 4DR2L 1S5DD 1W6JA 2IL8A 1KD1R 2YUQA 3GDEA 1NYFA 5FU6B 4V2SA 1I50H 2DXUA 1QLYA 4GOPC 4DK0A 1M1KC 1DGSA 2QKIC 4CKEA 2JEBI 3JAMi 4HIOA 1WFQA 1HH2P 1L0XB 2RHQB 2RM4A 3OW2S 3JCMc 3PUVA 3M7NA 3BVZA 4F17A 2WB1B 4OL7A 4MTKA 2P0PA 1VQOT 1VQ5T 3JB9F 4NPSA 5CO7A 4EQNA 3F2CA 2HL3A 2MF2A 4Y28E 2OI3A 2DFUA 2W10A 1PH1A 3AEVA 1I6HB 1Z9ZA 4JRPA 2WKCA 2B2WA 2KMTA 2PNIA 5IXFA 3CC4A 5IGBA 2LY7A 1CSKA 3W1GA 2E65A 2CZ1B 5KYUA 1ZUYA 1VQ4Q 1VQ9Q 1XPRA 1EUJA 4JI7Q 2UXBL 1AE2A 5GANj 1S72Q 2XWJB 2PZTA 1YNND 4QIWB 3BW1A 4JJDA 4ZQ3A 5M3FB 1RACB 2PUOB 4M8AA 4E7LA 4LF7Q 1PKTA 5ECAA 4CBVA 4TVRA 2DVEA 4PJOG 1ENAA 1G291 2E3IA 3RNUA 3HOVG 3VR4A 5C3EB 3SB2A 4LF5L 3RZOH 5LJ5g 4K11A 2JA5G 1JJ2S 3L7ZC 3HOXB 1M3BA 5KYXA 1YIJQ 5FO7B 1YHQT 1GXDC 5GANh 2FXQA 3HRTA 1JWSD 3HS0C 3EFSA 4MMLA 5KYYB 1PD0A 1HR0L 2K03A 3CBMA 1DM0B 1I5OB 4A3FB 1FMVA 3MP8A 3DMUA 3ULLA 1YNJC 2R3ZA 1KK7A 1E7OA 4DAMA 1YITQ 2CQOA 4X62Q 2RQRA 2L3QA 2HCCA 1Q3LA 2CUBA 1B53A 1GVPA 2R61A 4NXNQ 3SR1A 5C4ZA 2F3VA 3TBIB 2XIDA 3A54A 3C1FA 1T0HA 2LC4A 3KUFA 2LXKA 5IH2A 1I50B 2F0DA 4RGMA 4BA2I 4GNXB 2PI2A 1N33Q 5AYFA 4FT4A 2LMCB 5BR8Q 1UAPA 1X3GA 2X4XA 3CC2T 4JI3L 5J26A 3JCMX 4NKLA 2YRCA 5HGTA 1XPOA 3EIVA 2MHVA 1M8VA 3HL8A 3FJPA 2GFUA 3E9FA 1Q7YR 3JAME 4A3JG 4HIKA 5GAHC 2J7IA 2E8GA 1Y1WH 5KYXB 2HMAA 3S3OA 3GV3A 1I4RA 3SK4A 4C3IG 1Z9QA 1Q86U 1K73U 1QVPA 1KD1C 2LXJA 1NR4A 2B8FA 1WNLA 3GTGH 3HOWG 3VYSA 4B9WA 3LWHA 2QQRA 1E7ZA 3NHHA 1VQ7A 4EGVA 2NUTB 2DILA 5GAN7 1BUVT 2F0EA 4TQUS 4DV4Q 2LNVA 3NPFA 2MPMA 4DFAA 3LWIA 2O31A 3SK8A 3CF5A 1UE6A 2G3RA 1TS9A 2R93H 4DXGA 3NBHA 2K6DA 1IXDA 3CBPA 4GBQA 1I4GA 2DYIA 3RKWA 2A6HD 3LW5E 3OS0A 1V8QA 2RCFA 3OYIA 4GN3B 4DAPA 4ZYSA 3CCJA 3M9BA 1HR0W 3J81E 2DD4A 3RZOB 4ELZC 3JB9D 4LXCA 1GHKA 5JJKA 1PH8A 3VRYA 4XT1B 3MEHA 2K14A 4GKKQ 2JN0A 3P8HA 4KGVB 1VMPA 2R7DA 2FFKB 4QGUA 1YJ9A 2FB7A 3I4LA 3GP7A 3F70A 1YHAA 5ELCA 2PU9B 3EHRA 1E24A 5JPNC 3S1QH 4QW2A 2OX7A 4QUCA 3G71A 2IVWA 2KENA 4F7UB 4LF7L 2K5HA 5KE2A 4ELYC 4F88A 3M59A 4EDUA 2KBNA 4XYQA 1D0YA 2ZGWA 1JB7A 2UXCQ 4J9BA 1V1CA 3MEWA 1QVGA 1PYWD 1O78A 3CPWS 4Z8AA 1T5XD 4E6RA 1G91A 1AZQA 4YWLA 3MO8A 1AD5A 1LV9A 3CMEA 2EGAA 3EN2A 3H3VC 1VQIA 4RTTA 2EYMA 1EOVA 1LNXA 2UU9Q 2B2TA 1EFWA 3C1EA 1YI2T 2K5NA 4FDBA 5IYDG 1DOKA 4YWKA 4A3MH 1Y1WB 1Q1EA 4X62L 1H9JA 2CWPA 2VQFQ 2KA7A 4NXNL 4RHRA 3G4SA 3RMSA 3H41A 2ZPEB 2SDFA 4C1NI 1B9NA 4OELB 1YN8A 1BCMA 3OS2A 4DK6C 1X3PA 3I70A 3GTGB 1R4QB 2DKGA 1SJED 2XN9C 4ZN1A 3W5OA 5I9PA 3QPHA 4NP5A 2PUKB 4JI2Q 1SNPA 1N33L 4XAXB 2H8HA 4DV2Q 5I2XA 1WJSA 2ECZA 3RZDH 3KBGA 2DAQA 3P8BB 1X65A 2EY1A 2K28A 4PNYA 3QUIA 4F7XA 4H7BA 3QO3A 2R93B 2XHCA 5IP7H 1PMRA 2L4NA 3SK6A 1Q7YC 5IYBG 5LMNW 3V8KA 2UUAL 1EQQA 2ATWA 5IGFA 4LF9Q 1JB3A 2OTLA 1X6OA 1CTMA 2WB1G 2WV6D 2KXCA 1X27A 2N8NA 4RKLA 2PNRC 1GM5A 3M3YH 1EL0A 5J3BA 2R7FA 5DAUA 1PZID 1HFNA 5GJVB 2F69A 4BI4A 4OO1G 2E64A 5CORA 1ZSZB 3OYHA 4A3BH 2K5LA 1EWIA 4DV4L 2V8JA 4RAUC 3GO5A 1UHCA 1QKXA 1M27C 1H641 2JNGA 2LCSA 5DM73 3S1QB 3X26B 5IGDA 4IKFA 5IY0A 4E7KA 4BY7H 3M0PA 2F3WA 1F2YA 2KVMA 2AHJB 1T5EA 4XXEA 1C48A 1XNQQ 2COYA 2VXWA 4HVVA 3EROA 2JS0A 2KAFA 3UATA 2F03A 4A3GH 2L1BA 1P92A 2WKDA 2UUBQ 2QW7A 2F3IA 2K5QA 2KCCA 1ICFB 4B3RQ 4O2DA 2E2HH 1Y96B 3N5BB 2KE9A 1SR3A 4J9CA 5G3LD 2IIMA 4NOYA 2ICIA 2MFIA 1LPLA 2CH4W 4EMGA 8ATCB 1I5FA 1S5CD 2F0HA 4HMJA 5KYLA 2MWPA 5AT1B 1HFGA 3JCMP 3VR5A 4R0KA 1VQ8Q 1NTGA 2Z4IA 3BFMA 5CV4A 5D14A 4A3MB 2SNMA 3VS5A 2D9TA 2J4XA 2LSSA 1IL2A 4R8NA 2UXCL 1BU1A 4LNQA 4A3FG 1OU9A 2RHUA 1WVLA 1AEYA 3LWUA 1PTOF 3AFPA 4DUZQ 4IURA 1BB9A 2GCXA 2ZPFB 3HFOA 2DUDA 3PE0A 5IIFA 4FO2A 1G51A 3CKIB 1V1OA 3M57A 2DNEA 4AG1C 1WTQA 4POGA 1QCBD 1RF2D 1PFMA 2A1AA 1VQNA 3RZDB 2UU9L 4DV1L 4E7JA 1NJIR 1N34Q 1E1TA 3TSWA 5I2SA 3GIBA 3HKZB 1V29B 3CCQT 3CD6Q 7AT1B 2F0JA 5C4XH 4Z02A 2AKWB 3A8LB 3TU4K 4CJ1B 2JJ9A 2NYZD 1CHQD 2M0OA 3FP9A 4RTXA 3L0OA 2PQAA 3L9AX 4QJFA 5COYA 3WOEA 2L8DA 4A3IG 1GL5A 3M3YB 4DBRA 1OPKA 2AK5A 1V43A 4CRIA 1TWCH 1FWZA 1EZZB 1O7LA 4JI2L 2RHIA 4A3BB 5LJ5d 4Y92A 2O5IC 3M0SA 2JEAI 5I2MA 1O75A 3I56A 2JA6H 3G1JA 3DM3A 4BY7B 3PV0A 3C95A 4UP8A 1N32Q 2VC8A 1BI3A 1YNZA 3JCMQ 2HQLA 3FHWA 1JO8A 3CCUT 2F0OA 4M77D 1VQKQ 5C0XI 2B2YA 2I07B 4HJ7A 5GAMh 4LF9L 3HOYH 1ZA1B 2Y0SG 4XT3B 4LDXA 4A3GB 5HKCA 4EMKB 1PFSA 2ED0A 3LLRA 2PNHA 2CKZB 2IG0A 1IXRA 4FVMA 4HA8A 1S5ED 1QW1A 1SMXA 1X32A 1SEMA 2E2HB 2OTJA 1OU8A 3UWNA 3DEOA 3E9GA 1QVFA 2KY9A 1WTRA 4CC3A 1STAA 5ELDA 1KQ1A 1HXDA 1CZGA 2J6KA 2K5VA 3CCMA 2RJFA 1JOOA 2M9VA 4UAIA 4JYAL 2EGCA 1GO3E 4KT0E 3BZKA 3G6EQ 3FC3A 3OS1A 1G83A 2XU8A 2DF6A 3OB9A 5GMKe 4PJOE 4UPAA 1XNQL 3PO3H 2DRMA 1K9MR 1WTHA 2ZTCA 3TQYA 4F7UG 5JVH3 2A68D 1FJGL 5FW9A 3Q23A 2BCOA 2EPDA 1EY6A 4B3RL 2EY2A 1WI5A 2TSSA 4KJNA 4DAYB 1GFDA 2RF0A 3QHSA 2FPFA 4M77A 4MZPA 5AJ3Q 1I1JA 4X66Q 5F2DA 1QZGA 2LQKA 2KYMA 4XQ3A 3KFVA 1S5BD 5M3MH 5ISRA 5FWCA 3RLOA 4C2MH 1VQJA 4E7HA 2RVLA 3F2BA 3HFNA 1VQOA 1VQ5A 3TSSA 1S40A 5C4XB 2MWOA 1H9SB 4ZCKA 2E5KA 4IUPA 2EJFA 1Y8PB 2MP1A 3OHXC 2JMCA 1E22A 4DUZL 3C3LA 3JCMh 1TWCB 1YBYA 2VB2X 3L2UA 2GA4B 2PQEA 3VR2A 5JJLA 2JA8H 1HPCA 2AQ3B 2AQ2B 2EJGC 2JA6B 4LJZC 1PTOD 4PJOF 1NJIC 3KF6A 1N34L 1H3ZA 3S15H 4R56A 3R8BA 4IFDI 1X3QA 4HCKA 3QBYA 2F0GA 1E6GA 3EAEA 3OYGA 1CM9A 2RSNA 2XVSA 3FDTA 5KRUA 2R7ZG 3HOYB 1DJRD 3HRZC 4FF3A 1IW7C 3HOZH 5C44G 2DEUA 2XICA 4C0FA 2QQ9A 1UUPA 2JM9A 5JEAH 3MXUA 1PDQA 4LFCQ 4M77B 1MMDA 1SSOA 5M9OA 1CHPD 4LUZA 1EIYB 3S3NA 5LJ3e 1NYGA 3CMAQ 1IZ6A 1TH7A 3TCJA 1YHQA 4G57A 2GQVA 4LDWA 2NUPB 4IUTA 3DWQA 2RF4A 4CI0C 1N32L 1PSEA 1TQOA 5L23A 2GVBA 3V8JA 4JRQA 1HNWQ 1EY4A 2NTTA 2RBMA 2YRVA 3D6WA 4HEDA 3E2UA 3HPWA 1TR5A 4BD3A 1H92A 3PO3B 1HD3A 3EGDA 2J6FA 3EG9B 1VF7A 4DV6Q 2HQXA 3TP7A 1EYGA 1LACA 2GVAA 1BVSA 3AHUA 3CQZH 4BDYA 3BZDB 1C1AA 4IPGA 4FYWB 2OQKA 2P84A 1HSQA 2AKKA 5FU7B 2D62A 2JE6I 1VQPQ 1AWOA 1FGBD 1STNA 1H3HA 2QQBA 3CC2A 4A3CG 5M3MB 4C0DC 2ZCFB 4J9IA 4C2MB 2C0OA 3LX7A 4BY6B 2YTYA 3U4VA 1PH9A 4JI6Q 4LUVA 3KJOA 2RJCA 4M78D 3M9QA 1ZKOA 3M53A 4A75A 4J7FA 4FXGC 1RODA 1K9MC 4PK4A 4ZGEB 1O7YA 1F9SA 4A3MG 2PMZE 2B3GA 4PFOA 2Z9HA 2L5QA 3CCST 1ASZA 2JA8B 1VQLQ 1EQRA 2R5AA 2BE9B 2W0ZA 1I81A 2EYXA 4D8KA 2NBFA 4I7AA 2ZTEA 1QMCA 5BN5A 3S15B 4QCLA 4ABNA 4X66L 4OF1A 4JRKA 1FNUA 3V7SA 3EGDB 1JXMA 2PQWA 1G5VA 1M2VA 1U4LA 4DNRB 3M85A 1B4OA 1X9NA 1MHNA 3HOZB 5BN4A 3L3OC 4XDXA 2DEQA 4MZMA 1E3PA 2OF1A 2A6ED 3HKZG 3K5OA 5IP7G 1EY8A 1NLPC 2A3LA 2IX3A 1I4PA 1QQJA 5A2QL 4LD6A 2D9UA 2I5LX 1YJNT 2WAQG 5C6AA 2FEIA 3U9SA 1T3LA 2QDYB 4PKCC 5CCAA 5FLMG 4QT7A 3PIP3 4JV5Q 1JORA 2FINB 2EQIA 1U1TA 4M78A 1UHFA 2YDLA 2PW7A 4DR1Q 4IPDA 2RDGA 2YUPA 3CCEQ 3LGFA 2EQSA 4B3MQ 2DE0X 2NWMA 1KAAA 1UECA 1NBWA 3JRZA 2XDDA 4DR4Q 1Q82R 4LFAQ 2A28A 4IUNA 4CDDC 4BY7G 2PO4A 1FGUA 1CT1D 4ZTFA 3CQZB 4A3LG 4LFCL 2A08A 3DWAA 2QDBA 2KBTA 2RQWA 4AG2C 2XNAC 5LL6X 1QNUA 2KJXA 1KG1A 4IN3A 3RNJA 3FPUB 5GAEC 1ET6A 4AYBB 1Y69U 2KEEA 4FYDA 1EY5A 3QOLA 1RLQC 1MJEA 5C3WA 3PIPA 3UI2A 3TZUA 1MMAA 2BE7D 2QI2A 2EE1A 1YI2A 4P75A 3C4SA 1ABOA 1NJIU 4JJBA 2QCPX 3BDCA 2RHYA 1HNWL 1SNDA 3QDRB 5L8RE 3N52A 4RCNA 5CKDA 2C0TA 2B8AA 3I4MH 5J39A 4DV6L 1EYCA 5CBAE 5GANf 2QG9B 3KDFA 1SXTA 4M78B 2IT1A 4RHSA 2EYWA 1K76A 3VYHB 3CCVT 3SWNC 5D3DA 3META 5GADC 3E6ZX 3UA6A 2O2LD 1HUMA 3C12A 1X2KA 3OY9A 2VUMG 3OTOQ 2G6FX 1TWHH 4JI6L 4RG2A 1W3SA 3NWSA 2O88A 3AB9A 3TEEA 1N6AA 2EFIA 5JPMC 4GN5A 4J6XA 1W6KA 3P20A 1UE9A 4PNOA 2M00A 2EKOA 3M56A 5IE8A 4NXML 2L3RA 4IQZA 5IODA 3HHTB 3SHLA 1HJDA 4C92G 3HKSA 1WLPB 1LTGD 1E2ZA 3R6OA 1KLUD 1YEZA 1Q86R 1K73R 1R0BG 4CKBA 4C92C 1LM0A 4BY1H 2CSQA 2F0UA 2V8IA 3UF4A 4PZ6A 1B8AA 1QP3A 2RJDA 2JQOA 3KDFB 2DTIA 2DTHA 4R4TA 2ES2A 2LVMA 2QGFB 1AT1B 4EQ5A 5J22A 4HN7A 4A93H 5D6WA 2EDGA 3T53B 3VS6A 2AWOA 2BTTA 1U4MA 1GUGA 2BKDN 2MAMA 1PNJA 5A0LA 1CKNB 1K9MU 4JV5L 1CUKA 2JN4A 2LRQA 1NY4A 3VS2A 1LTSD 2Z0SA 5C0XG 1YHBA 1PRTB 4Z9CB 4CDEC 4E7SA 5KYWA 2NWGA 1VQ4T 5CV9A 1VQ9T 4B3ML 3SFMA 3VV0A 1H9RA 1D09B 1C9OA 1NAPA 2XG8D 3OYDA 2BH8A 2QTXA 2Z1CA 3BVMA 4DNTB 1SMYC 1S72T 4C3JH 4DR4L 1Q82C 2Y0SE 4JCVE 3I4NH 3JCMJ 4HT8A 3JSCA 3I4MB 1FR3A 3T16A 1HA6A 3VR6A 1WHGA 5I21A 4CJ0B 4ZAIA 2K79A 4KHVA 2LDMA 4KGZB 3RESA 5I11A 3NUCA 1CSQA 4ME3A 3M4OH 3QIIA 4QKUA 3PO3G 5HK0A 1TSFA 3R2IA 5FO8B 2DJFC 1X69A 4Q5VA 2V1RA 2ZPHB 4DKAC 2ROTA 4EMHA 3MEVA 2EY5A 1YIJT 2AKLA 2KVQG 1CFMA 3L2PA 1TWHB 2RQUA 1PM3A 2X6GA 1RL2A 1MSHA 3MXNA 2K04A 1ENCA 2K2VA 2VY3A 4N4GA 2CT3A 2K9GA 4A4HA 5LJ3g 3CCQA 2F0MA 4B6MA 4ZK9B 1S1NA 1K8AU 2UXBQ 3EGXA 5M3MG 1HHVA 2LMJA 1A3TA 4IALA 2CT4A 2CP7A 2M1HA 2YXYA 5I6WA 5CAIA 1YITT 2NZ1D 3DUZA 2R58A 3DB4A 3AT1B 5KYWB 1JQYD 3K5LA 3NTIA 4X64L 3ERSX 4JDSA 2WINB 3ERQA 4FF2A 4OO1I 1X54A 4IIMA 2VL6A 4MHEA 4CDCC 3K59A 2PPBC 1RAAB 2HIXA 4RCCA 1LTAD 4CHTB 2UUCL 4BY1B 3VYUA 2DLPA 2QEXQ 3E9IA 1CA5A 2N88A 2JA8G 1KNAA 1QILA 1K8MA 3ER0A 1MV0B 2YT6A 4A93B 1UFFA 3OSVA 4OMFB 3CCUA 3UA7A 4N0AC 5IN1A 2FL7A 1CK1A 4TRDA 1ML0D 4DNIA
chains in the Genus database with same CATH topology
2I0NA 2YSQA 2A36A 2JW4A 3JV3A 1B3QA 1K1ZA 1ZLMA 2O9SA 3PVQA 3VRYA 4ORZA 1JU5C 1KSWA 1I07A 3EHRA 3I5RA 1NEBA 4OMOA 1KFZA 1ZSGA 2LQWA 2DVJA 4J9BA 1V1CA 1MV3A 3SHWA 3RBBB 1YP5A 4Z8AA 4E6RA 2K2MA 3EGUA 2SEMA 1AD5A 2L2PA 2EGAA 4RTTA 1ABQA 1GCQA 1XOVA 2BZYA 2KNBB 1K4US 1WDXA 2ABLA 2DL4A 3VS0A 3M0RA 2EW3A 1M3AA 2D8HA 2ENMA 2KRSA 4J9GA 1OEBA 3H41A 2DJQA 1YN8A 1UJYA 1WXUA 3LH5A 1GBRA 2H8HA 4HVUA 1ARKA 2ECZA 2DRKA 2OAWA 2B86A 2PTKA 4LE9A 3ZL7C 1PHTA 2DBKA 3REAB 3FJ5A 1VYUA 2OJ2A 2KXCA 1X27A 4AFSC 2J05A 5GJVB 1NM7A 2XMFA 2L0AA 1GCQC 1UHCA 1QKXA 1M27C 2LCSA 3M0PA 2GTJA 1VYTA 2KEAA 4J9FA 2K7AA 2KRNA 3O5ZA 4JPBW 2KXDA 4HVVA 2JS0A 3UATA 4LN2A 4KRTA 2NUZA 1GRIA 2KE9A 2CUDA 4J9CA 2IIMA 2CH4W 1SRLA 4R0KA 3THKA 1SHFA 3EG2A 2YUNA 3VS5A 1GFCA 3EG0A 2LX7A 1BU1A 2RNAA 3NMZC 1Y0MA 1UGVA 1AEYA 2GQIA 4RTUA 1BB9A 3PE0A 4AG1C 4GLMA 4FSSA 2F2VA 4LUDA 5HCKA 3NHNA 2VWFA 3TSWA 1IO6A 1AZGB 2A37A 2CDTA 3GBQA 4RTXA 1GL5A 3CQTA 1B07A 2FG0A 1OPKA 2AK5A 2LZ6B 4IIOA 2X3XD 3A98A 2DYBA 1K0XA 2DL7A 4Y92A 1GBQA 3M0SA 2AZVA 2MCNA 3ULRB 2DA9A 2SRCA 1JQQA 4OMPA 1W1FA 2EVRA 3C0CA 2LJ1A 1YNZA 2PZ1A 1JO8A 4F14A 4OMLA 2HEQA 4HVWA 2M51A 4RTZA 1K9AA 4LNPA 2ED0A 2GNCA 1WXTA 1A0NB 1Y57A 2FO0A 1NLOC 1SEMA 1X6GA 2MOXA 2RPNA 1WYXA 2O9VA 2CSIA 1OOTA 1J3TA 4OMMA 1SRMA 1ZUUA 4Z88A 1QKWA 4CC3A 2J6KA 1YWOA 3IQLA 2EGCA 1AWXA 4RTYA 1AZEA 1G83A 2DF6A 4X1VA 1UJ0A 2DRMA 4OMQA 1RLPC 2RN8A 3R6NA 2EBPA 5FW9A 2KRMA 3M0TA 2EPDA 2DNUA 4HXJA 4F16A 2GGRA 1WIEA 1GFDA 2RF0A 1X43A 2FPFA 3I9QA 1PWTA 1I1JA 3M0QA 3QWYA 4RUGA 2KYMA 3KFVA 2YUOA 5FWCA 1E6HA 1T3SA 2FPEA 1TUCA 1ZBJA 4J9EA 4OMNA 2E5KA 1I0CA 2JMCA 1KIKA 2DMOA 3VS7A 2RQTA 2DL3A 3NGPA 2ROLA 1SPKA 2O2OA 1N5ZA 1PRMC 4HCKA 1BBZA 1E6GA 1VA7A 3H0HA 1M3CA 2BZ8A 1AOJA 1WFWA 1QWFA 2JM9A 1QWEA 4EIKA 2P4RA 1K0SA 1SHGA 2DL5A 2V1QA 4J9DA 1NYGA 2C0IA 2LJ3A 2D1XA 5L23A 3H0FA 2CREA 3EG1A 2JMAA 2ESWA 1H92A 1HD3A 1TUDA 2J6FA 4ZNXA 2JT4A 1FYNA 2F2XA 1X6BA 1NG2A 1PRLC 1HSQA 1KJWA 2AKKA 2HSPA 4RTVA 1AWOA 1H3HA 4J9IA 2C0OA 4CC4B 1AWJA 1U5SA 1JXOA 2DBMA 2F2WA 2FRWA 1MUZA 3PVLA 1H8KA 3VS3A 2DL8A 2K3BA 1WI7A 2JS2A 4JZ4A 2D0NA 2W0ZA 4M4ZA 2EYXA 1VYVA 4D8KA 1WX6A 4DEXA 3EHQA 2FRYA 3EG3A 1JXMA 1BK2A 2EYZA 2HCKA 4J9HA 4D8DA 2M0YA 5IHKA 2LNHB 1G2BA 5IXBA 2LQNA 2EYYA 1NLPC 4JJCA 2J06A 2X3WD 5I22A 2FEIA 1T3LA 4QT7A 2EQIA 1UHFA 2YDLA 2LJ0A 1QCFA 2YUPA 1WA7A 2RMOA 1YCSB 2DE0X 2NWMA 1UECA 1ZUKA 1YWPA 2JTEA 2VVKA 1T0JA 2A28A 1WXBA 2A08A 2EKHA 2KBTA 1AVZC 2DX1A 2RQWA 1M30A 4AG2C 3RNJA 1OPLA 4A63B 4Z89A 3QWXX 1RLQC 2KYBA 1FMKA 1ABOA 2LP5A 4JJBA 1AWWA 2KROA 4AFZC 2C0TA 2DM1A 2EYWA 1K76A 2JM8A 2YUQA 1W70A 3UA6A 1NYFA 1TG0A 1QLYA 1X2KA 2RQVA 4WCIA 2G6FX 3M0UA 2JXBA 2O88A 2GBQA 2AZSA 4F17A 3VS1A 1UE9A 2OI3A 2W10A 3REBB 1OV3A 2J6OA 5FWBA 1HJDA 1Z9ZA 1W6XA 1WLPB 2PNIA 5IXFA 1CSKA 1UTIA 1ZUYA 2CSQA 3UF4A 2L3SA 1UG1A 1PKSA 4JJDA 1UDLA 5IHNA 4DEYA 1PKTA 5ECAA 2BZXA 3VS6A 2BTTA 4LUEA 1PNJA 2MIOA 3TVTA 4K11A 1NEGA 3VS2A 1SSHA 2KT1A 1M3BA 4CC2A 1CKAA 2KR3A 1UUEA 3U23A 1EFNA 3VRZA 2FPDA 2KT8A 1U3OA 1GCPA 1E7OA 1U06A 2K79A 2RQRA 2L3QA 4JZ3A 5I11A 2CUBA 2D8JA 5EC7A 1T0HA 1X69A 2GTOA 2KGTA 2V1RA 5IH2A 2ROTA 2AKLA 2CH4A 2RQUA 2EGEA 1X2QA 2CT3A 2K9GA 5IHIA 4CC7A 1S1NA 1RI9A 3I35A 3SEMA 1CKBA 2LMJA 2L3PA 2CT4A 5GJWB 1LCKA 1JEGA 3I5SA 2J7IA 2HDAA 2HBWA 3TSZA 1RUWA 1Z9QA 4RTWA 2ED1A 4IIMA 4AFUC 2DLPA 2DILA 3NPFA 2QDLA 4ESRA 2O31A 3H0IA 1MV0B 2YT6A 1UFFA 4AFQC 1ZX6A 3UA7A 3VS4A 2VKNA 1M8MA 2K6DA 4GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0N A;  2YSQ A;  2A36 A;  2JW4 A;  3JV3 A;  1B3Q A;  1K1Z A;  1ZLM A;  2O9S A;  3PVQ A;  3VRY A;  4ORZ A;  1JU5 C;  1KSW A;  1I07 A;  3EHR A;  3I5R A;  1NEB A;  4OMO A;  1KFZ A;  1ZSG A;  2LQW A;  2DVJ A;  4J9B A;  1V1C A;  1MV3 A;  3SHW A;  3RBB B;  1YP5 A;  4Z8A A;  4E6R A;  2K2M A;  3EGU A;  2SEM A;  1AD5 A;  2L2P A;  2EGA A;  4RTT A;  1ABQ A;  1GCQ A;  1XOV A;  2BZY A;  2KNB B;  1K4U S;  1WDX A;  2ABL A;  2DL4 A;  3VS0 A;  3M0R A;  2EW3 A;  1M3A A;  2D8H A;  2ENM A;  2KRS A;  4J9G A;  1OEB A;  3H41 A;  2DJQ A;  1YN8 A;  1UJY A;  1WXU A;  3LH5 A;  1GBR A;  2H8H A;  4HVU A;  1ARK A;  2ECZ A;  2DRK A;  2OAW A;  2B86 A;  2PTK A;  4LE9 A;  3ZL7 C;  1PHT A;  2DBK A;  3REA B;  3FJ5 A;  1VYU A;  2OJ2 A;  2KXC A;  1X27 A;  4AFS C;  2J05 A;  5GJV B;  1NM7 A;  2XMF A;  2L0A A;  1GCQ C;  1UHC A;  1QKX A;  1M27 C;  2LCS A;  3M0P A;  2GTJ A;  1VYT A;  2KEA A;  4J9F A;  2K7A A;  2KRN A;  3O5Z A;  4JPB W;  2KXD A;  4HVV A;  2JS0 A;  3UAT A;  4LN2 A;  4KRT A;  2NUZ A;  1GRI A;  2KE9 A;  2CUD A;  4J9C A;  2IIM A;  2CH4 W;  1SRL A;  4R0K A;  3THK A;  1SHF A;  3EG2 A;  2YUN A;  3VS5 A;  1GFC A;  3EG0 A;  2LX7 A;  1BU1 A;  2RNA A;  3NMZ C;  1Y0M A;  1UGV A;  1AEY A;  2GQI A;  4RTU A;  1BB9 A;  3PE0 A;  4AG1 C;  4GLM A;  4FSS A;  2F2V A;  4LUD A;  5HCK A;  3NHN A;  2VWF A;  3TSW A;  1IO6 A;  1AZG B;  2A37 A;  2CDT A;  3GBQ A;  4RTX A;  1GL5 A;  3CQT A;  1B07 A;  2FG0 A;  1OPK A;  2AK5 A;  2LZ6 B;  4IIO A;  2X3X D;  3A98 A;  2DYB A;  1K0X A;  2DL7 A;  4Y92 A;  1GBQ A;  3M0S A;  2AZV A;  2MCN A;  3ULR B;  2DA9 A;  2SRC A;  1JQQ A;  4OMP A;  1W1F A;  2EVR A;  3C0C A;  2LJ1 A;  1YNZ A;  2PZ1 A;  1JO8 A;  4F14 A;  4OML A;  2HEQ A;  4HVW A;  2M51 A;  4RTZ A;  1K9A A;  4LNP A;  2ED0 A;  2GNC A;  1WXT A;  1A0N B;  1Y57 A;  2FO0 A;  1NLO C;  1SEM A;  1X6G A;  2MOX A;  2RPN A;  1WYX A;  2O9V A;  2CSI A;  1OOT A;  1J3T A;  4OMM A;  1SRM A;  1ZUU A;  4Z88 A;  1QKW A;  4CC3 A;  2J6K A;  1YWO A;  3IQL A;  2EGC A;  1AWX A;  4RTY A;  1AZE A;  1G83 A;  2DF6 A;  4X1V A;  1UJ0 A;  2DRM A;  4OMQ A;  1RLP C;  2RN8 A;  3R6N A;  2EBP A;  5FW9 A;  2KRM A;  3M0T A;  2EPD A;  2DNU A;  4HXJ A;  4F16 A;  2GGR A;  1WIE A;  1GFD A;  2RF0 A;  1X43 A;  2FPF A;  3I9Q A;  1PWT A;  1I1J A;  3M0Q A;  3QWY A;  4RUG A;  2KYM A;  3KFV A;  2YUO A;  5FWC A;  1E6H A;  1T3S A;  2FPE A;  1TUC A;  1ZBJ A;  4J9E A;  4OMN A;  2E5K A;  1I0C A;  2JMC A;  1KIK A;  2DMO A;  3VS7 A;  2RQT A;  2DL3 A;  3NGP A;  2ROL A;  1SPK A;  2O2O A;  1N5Z A;  1PRM C;  4HCK A;  1BBZ A;  1E6G A;  1VA7 A;  3H0H A;  1M3C A;  2BZ8 A;  1AOJ A;  1WFW A;  1QWF A;  2JM9 A;  1QWE A;  4EIK A;  2P4R A;  1K0S A;  1SHG A;  2DL5 A;  2V1Q A;  4J9D A;  1NYG A;  2C0I A;  2LJ3 A;  2D1X A;  5L23 A;  3H0F A;  2CRE A;  3EG1 A;  2JMA A;  2ESW A;  1H92 A;  1HD3 A;  1TUD A;  2J6F A;  4ZNX A;  2JT4 A;  1FYN A;  2F2X A;  1X6B A;  1NG2 A;  1PRL C;  1HSQ A;  1KJW A;  2AKK A;  2HSP A;  4RTV A;  1AWO A;  1H3H A;  4J9I A;  2C0O A;  4CC4 B;  1AWJ A;  1U5S A;  1JXO A;  2DBM A;  2F2W A;  2FRW A;  1MUZ A;  3PVL A;  1H8K A;  3VS3 A;  2DL8 A;  2K3B A;  1WI7 A;  2JS2 A;  4JZ4 A;  2D0N A;  2W0Z A;  4M4Z A;  2EYX A;  1VYV A;  4D8K A;  1WX6 A;  4DEX A;  3EHQ A;  2FRY A;  3EG3 A;  1JXM A;  1BK2 A;  2EYZ A;  2HCK A;  4J9H A;  4D8D A;  2M0Y A;  5IHK A;  2LNH B;  1G2B A;  5IXB A;  2LQN A;  2EYY A;  1NLP C;  4JJC A;  2J06 A;  2X3W D;  5I22 A;  2FEI A;  1T3L A;  4QT7 A;  2EQI A;  1UHF A;  2YDL A;  2LJ0 A;  1QCF A;  2YUP A;  1WA7 A;  2RMO A;  1YCS B;  2DE0 X;  2NWM A;  1UEC A;  1ZUK A;  1YWP A;  2JTE A;  2VVK A;  1T0J A;  2A28 A;  1WXB A;  2A08 A;  2EKH A;  2KBT A;  1AVZ C;  2DX1 A;  2RQW A;  1M30 A;  4AG2 C;  3RNJ A;  1OPL A;  4A63 B;  4Z89 A;  3QWX X;  1RLQ C;  2KYB A;  1FMK A;  1ABO A;  2LP5 A;  4JJB A;  1AWW A;  2KRO A;  4AFZ C;  2C0T A;  2DM1 A;  2EYW A;  1K76 A;  2JM8 A;  2YUQ A;  1W70 A;  3UA6 A;  1NYF A;  1TG0 A;  1QLY A;  1X2K A;  2RQV A;  4WCI A;  2G6F X;  3M0U A;  2JXB A;  2O88 A;  2GBQ A;  2AZS A;  4F17 A;  3VS1 A;  1UE9 A;  2OI3 A;  2W10 A;  3REB B;  1OV3 A;  2J6O A;  5FWB A;  1HJD A;  1Z9Z A;  1W6X A;  1WLP B;  2PNI A;  5IXF A;  1CSK A;  1UTI A;  1ZUY A;  2CSQ A;  3UF4 A;  2L3S A;  1UG1 A;  1PKS A;  4JJD A;  1UDL A;  5IHN A;  4DEY A;  1PKT A;  5ECA A;  2BZX A;  3VS6 A;  2BTT A;  4LUE A;  1PNJ A;  2MIO A;  3TVT A;  4K11 A;  1NEG A;  3VS2 A;  1SSH A;  2KT1 A;  1M3B A;  4CC2 A;  1CKA A;  2KR3 A;  1UUE A;  3U23 A;  1EFN A;  3VRZ A;  2FPD A;  2KT8 A;  1U3O A;  1GCP A;  1E7O A;  1U06 A;  2K79 A;  2RQR A;  2L3Q A;  4JZ3 A;  5I11 A;  2CUB A;  2D8J A;  5EC7 A;  1T0H A;  1X69 A;  2GTO A;  2KGT A;  2V1R A;  5IH2 A;  2ROT A;  2AKL A;  2CH4 A;  2RQU A;  2EGE A;  1X2Q A;  2CT3 A;  2K9G A;  5IHI A;  4CC7 A;  1S1N A;  1RI9 A;  3I35 A;  3SEM A;  1CKB A;  2LMJ A;  2L3P A;  2CT4 A;  5GJW B;  1LCK A;  1JEG A;  3I5S A;  2J7I A;  2HDA A;  2HBW A;  3TSZ A;  1RUW A;  1Z9Q A;  4RTW A;  2ED1 A;  4IIM A;  4AFU C;  2DLP A;  2DIL A;  3NPF A;  2QDL A;  4ESR A;  2O31 A;  3H0I A;  1MV0 B;  2YT6 A;  1UFF A;  4AFQ C;  1ZX6 A;  3UA7 A;  3VS4 A;  2VKN A;  1M8M A;  2K6D A;  4GBQ A; 
#chains in the Genus database with same CATH topology
 2I0N A;  2RSO A;  2JUF A;  4XIG S;  2A36 A;  2XKO C;  1UGQ B;  3GF5 A;  4IFD G;  3OYK A;  2YRD A;  2O9S A;  1JE4 A;  5JEA G;  1Q86 C;  4ORZ A;  3PUX A;  1K73 C;  4JVZ A;  3GTQ H;  2LS0 1;  1JU5 C;  2B39 A;  4PMC A;  1IHW A;  3PO2 H;  2FMM A;  4Y7N H;  3EGX B;  2FHT A;  4EQP A;  2ZTD A;  4PMB A;  3VYR A;  1NEB A;  4C3J B;  1S5F D;  4IOA A;  4OMO A;  1KFZ A;  4A53 A;  3I4N B;  1ZSG A;  2RO0 A;  4Y52 H;  4AH6 A;  2E6N A;  2YYZ A;  1XQH A;  4JI3 Q;  1KRT A;  3CC7 Q;  2DVJ A;  3J7Z C;  2ZM6 Q;  4ZRZ A;  3M4O B;  1GXI E;  2X51 A;  4RWS C;  4A3D G;  3I3C A;  5AFW A;  1E0B A;  3DM1 A;  2CP6 A;  2K2M A;  3EGU A;  2FMC A;  3ZEH A;  4C8Q C;  2L5T A;  5GAN 2;  5C5L A;  4XQJ A;  1MNE A;  4ZTJ A;  1ABQ A;  1TXQ A;  4BXX H;  3VYT A;  4A3C H;  1QCO A;  1STE A;  2BZY A;  4XU2 A;  5FJ8 G;  4OB2 B;  3RD4 A;  3H9N A;  1EY9 A;  3VS0 A;  2DL4 A;  2YV5 A;  3D6C A;  2EW3 A;  5CKF A;  1BBU A;  1M3A A;  4F87 A;  3DXJ C;  1XMQ Q;  4K5V A;  2D8H A;  2ENM A;  2KRS A;  5KYN A;  1S3O A;  5IP9 G;  4J9G A;  1OEB A;  1MI2 A;  4ZUJ A;  2I0Q A;  1A63 A;  4X3S A;  5IT9 L;  1NE8 A;  2DK3 A;  1HNZ Q;  3QWN A;  3SGI A;  4H0L C;  4O1N A;  1BNZ A;  1QCN A;  2YLB A;  4PJL A;  1QG7 A;  4ZKB B;  1Q8I A;  3RN2 A;  3NPP A;  2X4J A;  5LMN Q;  4JJN K;  3ZL7 C;  1AE3 A;  4YY3 Q;  1BXT A;  2HHH Q;  2BDN A;  1Q82 U;  1VYU A;  1ILQ A;  4GZY C;  3K7A H;  3V7C A;  2F0I A;  5EG2 A;  1U4R A;  4R1J A;  1RTN A;  2A69 D;  2J05 A;  3GTQ B;  4DBQ A;  2XMF A;  2L0A A;  2EQU A;  1VS0 A;  4PZ8 A;  3PO2 B;  3SVM A;  4OON A;  4Y7N B;  1GCQ C;  3ME9 A;  1I4Q A;  1MKH A;  2CGH A;  3MWY W;  5JOB A;  1WCM G;  1LOJ A;  1TII D;  3M4Y A;  4PLI A;  1ZXT A;  1JRI A;  2JK8 A;  4PJO C;  2R6G A;  2V8K A;  1VYT A;  2KEA A;  4J9F A;  1Y07 A;  1TS3 A;  4OWT B;  3VKI A;  3O5Z A;  4JPB W;  2NUC A;  2O01 E;  2KXD A;  2WAQ E;  2E41 A;  4JLG A;  2ID0 A;  1STG A;  4M7A G;  1E2V A;  2FZK B;  4BBS H;  3G7Z A;  2JOY A;  3OW2 A;  3KLW A;  1XTD A;  2KOL A;  1EZ8 A;  3FMC A;  4M7A C;  5GAM f;  1JOK A;  2CUD A;  2VUB A;  5KYU B;  1AEX A;  4DV5 Q;  5EJW A;  1R9T H;  4O42 A;  4GLV B;  5D65 A;  2YTX A;  4NW2 A;  1PSF A;  4M7D G;  3W3A A;  1I94 Q;  3UE0 A;  3THK A;  1SHF A;  1XNR Q;  4XTV A;  2KHJ A;  5CKH A;  4BUG A;  2L0C A;  3LWE A;  3R93 A;  2ZM6 L;  4M7D C;  3MC0 B;  1NE3 A;  2RNA A;  3NMZ C;  1Y14 B;  1A0I A;  4BS9 A;  4GKJ Q;  4R9W A;  3JC6 6;  4B3S Q;  1WD0 A;  3H0G G;  3CCS A;  4IUV A;  3HP9 A;  4KUL A;  4YTL A;  2Z6K C;  4IJH A;  2LTO A;  2M9U A;  2UUA Q;  2WSC E;  2G9D A;  3A56 A;  4J8O A;  3GTL H;  5C4J H;  2VAS A;  4LF6 Q;  2A5H A;  2F2V A;  5EKL A;  3NHN A;  5CBE E;  4U67 3;  4KH1 B;  5FLX L;  1VQ8 T;  1VQM Q;  2EYP A;  1XMQ L;  1O9S A;  1WHK A;  1JJ2 A;  5DEH A;  3K7A B;  4QVD A;  1RAH B;  1CI3 M;  2EQK A;  4M75 G;  1R0C B;  1SYD A;  3CQT A;  2DET A;  1HNZ L;  1B07 A;  2VW9 A;  1YJN A;  1QVG S;  4JS5 A;  2D0P A;  3ULP A;  2XWB B;  4IIO A;  4JI8 L;  2HQH A;  1R77 A;  2DYB A;  4KH0 B;  2KDS A;  4M75 C;  3X25 B;  2EY6 A;  1SFO H;  1K8G A;  5A35 A;  2ZPB B;  2MCN A;  1UGP B;  1SE8 A;  4QQG A;  3H91 A;  1D0Z A;  2H1E A;  4F04 B;  2E75 C;  3JCM f;  3C0C A;  1SYC A;  3QR8 A;  5LMN L;  1A3U A;  3V96 A;  2KCM A;  3CD6 T;  3AFQ A;  1D1A A;  3MFY A;  4YY3 L;  4OGQ C;  4XTZ A;  2K1B A;  2HHH L;  4OML A;  2HEQ A;  3JB9 H;  4N9T A;  2B2V C;  4HVW A;  4C92 E;  4HJ9 A;  2M51 A;  3T9N A;  4B3T Q;  4X6A H;  4VUB A;  4LNP A;  3EH1 A;  3OPO A;  4BBS B;  3FVQ A;  4PZ7 A;  1SLJ A;  1WXT A;  1TT2 A;  3MCA B;  4UY8 C;  4A3E H;  1IBL Q;  1Y57 A;  2L12 A;  5CKB A;  1F2Z A;  3BE3 A;  3MXP A;  2DTO A;  2MOX A;  5EBC A;  1R9T B;  1WYX A;  4ME5 A;  1OOT A;  2EJG A;  1LTB D;  3STB D;  3H6Z A;  1SRM A;  4Z88 A;  4BI3 A;  4X3U A;  2Q2T A;  3CCL Q;  1BBW A;  3TRZ A;  1OYX A;  1YWO A;  3IQL A;  4FCY A;  1Z9F A;  2B63 G;  5TSS A;  1F9Q A;  5GAN 3;  5LL6 S;  5LJ3 d;  3MFG A;  3NBH B;  4JK1 C;  5CR2 A;  4X1V A;  1VQK T;  4DV1 Q;  4O6J A;  3E19 A;  3PCO B;  1PCX A;  1D1C A;  2NVX H;  3CXC A;  1CQV A;  2EBP A;  3CCV A;  3DKM A;  3DHQ A;  1I5L A;  3M0T A;  2ATC B;  3QSU A;  5C4J B;  3GTL B;  4G4K A;  3G48 A;  1ACM B;  4DV5 L;  1KC8 R;  1PVO A;  1WIE A;  4QVZ A;  2NN6 H;  1DZ1 A;  3M7G A;  3FRP B;  1Q46 A;  4RUG A;  4C92 F;  3GLX A;  1IHV A;  2J7Z A;  3EFO A;  1I94 L;  3L2Q A;  1O7Z A;  2K4K A;  1XNR L;  2IHE A;  1U5K A;  1TUC A;  2ZXO A;  1ZBJ A;  3G6E T;  2QAS A;  4CDF C;  5NUC A;  1W2B P;  1BCP F;  1VCI A;  2N55 A;  4OMN A;  4GKJ L;  3KLS X;  1KIK A;  1KNE A;  2PYK A;  4B3S L;  4IUQ A;  1ZYR C;  5M5W H;  1SFO B;  4R55 A;  2DL3 A;  1B34 A;  2D6F A;  4LF6 L;  1SPK A;  1Q8K A;  4GLA C;  4K5W A;  3MPU B;  2CP2 A;  2MO0 A;  3JCM b;  2XDB A;  1S4Z A;  3TDQ A;  3CPW A;  2JYO A;  5IOC A;  2B2U C;  3H0H A;  2KI7 A;  2BDO A;  2QGQ A;  2R57 A;  5K36 H;  3IRB A;  1CKO A;  3A5U A;  3SE0 A;  1N27 A;  3QOJ A;  4JYA Q;  1QWE A;  2JTF A;  4A3E B;  3QKJ A;  2MO1 A;  1MGQ A;  2ZXR A;  3K8A A;  1K0S A;  3MXG A;  5EGT A;  5M3F G;  3P8D A;  2LJ3 A;  4A4I A;  3UDC A;  1VQ4 A;  1VQ9 A;  2OT2 A;  1FJG Q;  1Y1V H;  1UEA B;  3PO2 G;  1AP0 A;  1S72 A;  3H0F A;  3E0J A;  5C3E G;  4RGO S;  2COZ A;  3S2D H;  2ESW A;  3HOX G;  4DK3 C;  4B3T L;  1G8X A;  2NVX B;  1B34 B;  3QG1 A;  2JT4 A;  1FYN A;  2AIR B;  3GP8 A;  5IGG A;  4KHZ A;  4DAV A;  1X6B A;  5JJI A;  3PF5 A;  1IBL L;  4ZGD B;  1J5E L;  2PVO B;  2LT4 A;  4B9X A;  1PRL C;  3LGL A;  4JOI C;  4L59 A;  1YIJ A;  4A54 A;  3BDU A;  1EZ6 A;  1RKN A;  1SYE A;  1NSN S;  4NL2 A;  2F0S A;  3IFD A;  3BY7 A;  3CMA T;  4DBF A;  1J6Q A;  3RUX A;  3IFT A;  4HT9 A;  3BDL A;  2ASB A;  4M1U B;  4BI8 B;  3TS0 A;  1AWJ A;  2EJ9 A;  2HIV A;  4R4C A;  5H1S E;  4ODG A;  2OQ0 A;  3ZYY X;  3ICE A;  4C8Q E;  2AUK A;  5KIX A;  3J7A V;  1JXO A;  5FKA C;  4JI1 Q;  3I90 A;  3NQI A;  1YIT A;  3MAQ A;  2V4D A;  1CZW A;  5C4H A;  5M5W B;  2JS2 A;  4DBH A;  1GKH A;  2F5K A;  3BYY B;  4LUO A;  4GNX C;  1AZP A;  1MJC A;  3HZX A;  1VQP T;  2PCF B;  1WGS A;  1WX6 A;  5KNC A;  1TUG B;  1NBE B;  2GF7 A;  5GAN e;  2XRS D;  3EHQ A;  4GS3 A;  1RJT A;  4KKS A;  4APV A;  2HD3 A;  5GMK l;  1M5Q 1;  2VZA A;  4TSS A;  1BK2 A;  2HCK A;  4FW1 A;  1JWM D;  5LHY 1;  1L0Y B;  1H9K A;  1MGS A;  4L5G A;  2QEJ C;  3U58 A;  4LF8 Q;  3L2W A;  1QE6 A;  1STH A;  3J7A 5;  4PJJ A;  3WWV A;  2LQN A;  2EYY A;  3NEM A;  5GAM d;  3J80 c;  2NVT H;  5LJ5 j;  4JJC A;  3EVQ A;  3Q8D A;  2J06 A;  1ESF A;  2JXM B;  5I22 A;  4DA2 A;  3F8T A;  1SYF A;  5M5X H;  3SWN A;  1VQL T;  5IT9 c;  3U4Z A;  3F1Z A;  4C8Q F;  4PG3 A;  1QCF A;  1HTP A;  3CPF A;  1Y1V B;  4YIJ A;  1YCS B;  2DER A;  5E1F A;  1EYD A;  4ILW A;  5KND A;  3M4G A;  4N9P A;  3S2D B;  1WZO A;  1YWP A;  2JTE A;  2VVK A;  3MTS A;  4DR3 Q;  5LJ5 h;  4ULL A;  4MTN A;  2PQA B;  2NLU A;  3WVD B;  4NB3 A;  1RAF B;  4ZUI A;  3RDV A;  2HKN A;  2EVB A;  1M30 A;  1PH2 A;  3RKX A;  4BBS G;  1OPL A;  5GAN 8;  3QWX X;  3FDR A;  4PJM A;  4C92 A;  2L89 A;  3CCE T;  2KYB A;  1K83 H;  1LTL A;  1VOM A;  2C5C A;  2MJ8 A;  4XQN A;  5E4W C;  5GQO A;  1SRU A;  2M16 A;  3V8L A;  3PTA A;  4RGT A;  1WTX A;  1UGS B;  4AFZ C;  5GAN 6;  4M7A E;  1ZEQ X;  2ZAE A;  4IOC A;  3SWN B;  4XTW A;  2JSO A;  4FYY B;  1B3A A;  4J6H A;  4QQB X;  2VB3 X;  1QUQ A;  4DUY Q;  1RAG B;  1BR9 A;  4R4I A;  4AT1 B;  4LAA A;  2JM8 A;  4PFZ A;  1OXS C;  3JCM d;  2L9H A;  1W70 A;  3AU7 A;  4K5X A;  2CZ6 B;  1TG0 A;  1SSF A;  4LF4 Q;  4M7D E;  1OXU A;  1Y1W G;  3TP8 A;  4V19 0;  5EPJ A;  4WCI A;  3M0U A;  5A2Q E;  2KEC A;  2O5J C;  1WHJ A;  3S2H H;  2JZ2 A;  1RI0 A;  1D1I A;  3OYM A;  1Q95 G;  3A5Z B;  4KKU A;  4DOV A;  1PH7 A;  3CW2 C;  3KK7 A;  4JI1 L;  1K8A R;  2NVT B;  2RHZ A;  1PLF A;  3CCR Q;  1VQ6 Q;  4C0G A;  5M5X B;  1W6X A;  2MK5 A;  3E1S A;  1PTO H;  2TMP A;  3HGB A;  2AUJ D;  4BDZ A;  3PIO 3;  2R93 G;  1UE1 A;  4FSX A;  3UPU A;  1SF9 A;  3G7L A;  3QXE B;  4FL6 A;  1W2B S;  1KRS A;  5E4X A;  4M7A F;  1KDC A;  5DM7 R;  1B9M A;  4ZN3 A;  2L3S A;  2HT1 A;  3OYL A;  5L37 A;  3T1Y L;  3CAM A;  4IJL A;  3J7Y W;  1D3B A;  4LF8 L;  5BN3 A;  5DNF A;  1JB0 E;  1QP2 A;  1UDL A;  2PVG B;  4M75 E;  1D5X C;  5IHN A;  2P0K A;  1O7I A;  1X55 A;  4X9D A;  4XU1 A;  2N49 A;  1DOM A;  2HKQ B;  1Z6H A;  5FLX c;  2BZX A;  4O5V A;  1OUL A;  1PRT F;  4M7D F;  3JB9 G;  4LUE A;  3I55 Q;  2MIO A;  2F0P A;  4BBR H;  3TVT A;  4KJO A;  2MNA A;  2NVQ H;  3HOU H;  1ZSZ C;  2HZY A;  4A4F A;  1C8C A;  3OBW A;  1KQS P;  2KK4 A;  2N78 A;  1NR2 A;  2L15 A;  1HZC A;  4DK1 A;  4CC2 A;  3D4R A;  1CKA A;  1FVI A;  4R4O A;  1AHJ B;  5IGE A;  2DZ9 A;  3HSB A;  1K83 B;  3U23 A;  1KAB A;  1EFN A;  1KC8 U;  2EYO A;  2X6L A;  3A8I E;  3KF6 B;  4YHH L;  3PIO A;  1PYS B;  3DB3 A;  1YJW Q;  2F5T X;  1V1P A;  1GCP A;  4V0B A;  2AT1 B;  3NQT A;  4YCV A;  3OS5 A;  2H3E B;  3A74 A;  4DR3 L;  4KHP Q;  1XJW B;  5I2Y A;  1IHZ A;  2E5Q A;  4N0A A;  3QDF A;  4S3S A;  1EOT A;  1RCV D;  1SBB B;  1VQB A;  1E1O A;  4J8Q A;  4N8F A;  2K5F A;  4JBM A;  1KXL A;  4LFB Q;  4LDU A;  5EC7 A;  2D2C C;  3TZD A;  2MQH A;  3DLM A;  1L1O C;  4DN4 M;  4NXM Q;  4OXP A;  1D3B B;  5GAO l;  4M75 F;  3D31 A;  2DO3 A;  1EWH A;  4E6I A;  4G7H C;  5M5Y H;  2EGE A;  3L2V A;  3S2H B;  3NTK A;  4LWC A;  1OI1 A;  1RAE B;  2CP3 A;  3SEM A;  1VQ8 A;  3I35 A;  3OYF A;  1C0M A;  3KLR A;  4NDX A;  1WTO A;  1CKB A;  2L3P A;  5GJW B;  3E0E A;  5DLQ E;  3K7U C;  2HBW A;  1WQW A;  4DUY L;  1TTH B;  5C0X J;  2CZ7 B;  4DV7 Q;  1G6Z A;  1H9M A;  2LCL A;  3LH0 A;  1PTO B;  2RQX A;  3KUP A;  3X28 B;  2NYS A;  3NBI A;  1ZQ1 A;  4LF4 L;  1G2T A;  3NP8 A;  2K75 A;  4U68 A;  2FZG B;  4C8Q A;  5ELB A;  1EY7 A;  3H0I A;  3Q1J A;  3FKI H;  3A55 A;  3L42 A;  2LKV A;  1PH5 A;  4AFQ C;  2VXF A;  3CD6 A;  1ZX6 A;  5T1I A;  1F77 A;  4GOP A;  1X01 A;  1K8A C;  4A3B G;  2NB0 A;  4BBR B;  3SD4 A;  2F0K A;  1XTC D;  2QA4 Q;  3JV3 A;  4PJO D;  1EEF D;  1SRO A;  2WB1 E;  3HOU B;  2NVQ B;  1K1Z A;  1ZLM A;  5EPK A;  2VYT A;  2H4O A;  1YCY A;  1YVC A;  3PNW C;  3A7L A;  1I07 A;  2QEX T;  4X65 L;  3U9O A;  3QZ9 B;  2KCT A;  1GUT A;  1YNJ D;  4A3G G;  1M2V B;  1ZBX A;  4MZ9 A;  3K0Y A;  3J80 i;  2LQW A;  5GAN g;  2ENB A;  3TP6 A;  1VQK A;  3QJ6 A;  1EU4 A;  4EMK C;  2FVU A;  1RAD B;  3MP6 A;  2FZC B;  1ASY A;  9ATC B;  2FYK A;  3RBB B;  5GRO A;  2KQ3 A;  4QIW E;  1TWB A;  2IJ0 A;  2V1C C;  3GOX A;  3KBX A;  1WJJ A;  4EVO A;  1B50 A;  1WYD A;  3OYE A;  1U0L A;  4GLX A;  2SEM A;  4YWM A;  3BG3 A;  2L2P A;  4OGE A;  2IX0 A;  3A8J E;  4N4H A;  5M5Y B;  1NUC A;  2VQF L;  3DWP A;  2XSC A;  4PMW A;  1GCQ A;  4GOP B;  4X64 Q;  2F0N A;  2K3Y A;  4HKE A;  4MZT A;  3KXT A;  1K4U S;  2UUC Q;  1G3S A;  1ZA2 B;  4UC4 A;  1WDX A;  3ZBD A;  5C3X A;  3M0R A;  4KHP L;  4PJO A;  3CEY A;  3G6E A;  4IFD J;  4RCB A;  5GAM e;  3ZJY C;  3CC7 T;  4LFB L;  4KBM B;  4RKB A;  1PHJ A;  3S1N H;  3OMC A;  2DJQ A;  2RA4 A;  3PMI A;  2JA9 A;  4OGC A;  1NZ9 A;  1UJY A;  1WXU A;  3LH5 A;  3OSS C;  3CC4 Q;  2PW5 A;  5C4X G;  1GBR A;  1MHW C;  1SE4 A;  4HAE A;  2I5M X;  2B2Y C;  3I72 A;  5I4D A;  3O8V A;  3W1B A;  4C3I H;  2DRK A;  3FKI B;  2EYL A;  4OWX B;  2B86 A;  3VYG A;  2PTK A;  4LE9 A;  4DXF A;  1IRE B;  3HOW H;  4Q0F A;  2DBK A;  3REA B;  3FIF A;  3FJ5 A;  4HCC A;  1YNX A;  5I6Y A;  3OYA A;  2OCE A;  4DV7 L;  3RN5 A;  2OJ2 A;  3L1A A;  4K6L A;  2JA6 G;  1A6X A;  1IYV A;  4AFS C;  4DV0 Q;  4L5T A;  1BCP C;  4WF2 A;  1KLG D;  1L2F A;  1SJH D;  3FRN A;  3S9W A;  2RJE A;  1P8L A;  3S3M A;  2Z6K A;  3MEU A;  3AQQ A;  2VNU D;  2NVY H;  5KEE A;  3HOY G;  4PJO B;  4IPH A;  3H15 A;  1BCO A;  3V7R A;  4DU9 A;  2Y4Y A;  3EA6 A;  4J6Y A;  4M77 G;  2GTJ A;  2C9O A;  3F2U A;  4C5I A;  1ONL A;  3UDX A;  3V05 A;  2K7A A;  2KRN A;  3S17 H;  3RIR A;  5ELO A;  5CV6 A;  5CGK A;  2BUD A;  1OXT A;  5EBD A;  4L6T B;  4LN2 A;  1A3V A;  3JCM e;  1GUO A;  1PFN A;  3CBO A;  1GRI A;  3BU2 A;  2R92 H;  2QK0 A;  1GUW A;  2RI5 A;  3A8K E;  3CMA A;  5IT9 E;  4L8J A;  3K58 A;  3H3V H;  1QB5 D;  2I46 A;  1SRL A;  1IKL A;  1KQS S;  2LX7 A;  2CP5 A;  1HCZ A;  1SDF A;  1QVG P;  2KHI A;  3S1N B;  2MPX C;  2ZJP A;  2B2V A;  1UGV A;  4PFP A;  2WP8 J;  4F7U E;  4WJW A;  5FU7 C;  1MIU A;  2QAZ A;  4IPC A;  4K2K A;  5IYD H;  1WTW A;  4XU0 A;  3VU3 C;  2A68 C;  1VQP A;  3R3O A;  5CC4 A;  3VDY A;  3SXH A;  1VQ7 Q;  4GLM A;  4C3I B;  4LUD A;  2VWF A;  1V9P A;  1IO6 A;  1ZYR D;  4HSV A;  4X3K A;  3SEB A;  3HOW B;  2O4X A;  1AZG B;  1CKM A;  5CK9 A;  2RHS B;  2DN8 A;  3ITP A;  3K81 C;  3VA5 A;  3HG9 A;  4QQD A;  3CRK C;  3I8Z A;  1JWU D;  4DR6 L;  1M8A A;  3MKD A;  1JCK B;  1F9P A;  2AWN A;  4HID A;  4IO9 A;  3CCJ Q;  2K4Y A;  1XMO Q;  1K8O A;  4HR7 B;  2IWH A;  3BYT B;  3ND8 A;  1M2O A;  2EYF A;  4D6W A;  1TS2 A;  3S6W A;  5CR3 A;  4J5Y A;  2LZ6 B;  1FX7 A;  3A98 A;  4EQO A;  2ZJQ A;  1VQL A;  2DL7 A;  1K0X A;  5IYB H;  1TOV A;  3KF8 A;  2NVY B;  1YJ9 Q;  1GBQ A;  1KTK A;  1TWA H;  3HOZ G;  1AH9 A;  1PD1 A;  1IB8 A;  3MHX A;  5KCH A;  3ULR B;  4NL3 A;  1G3W A;  3MXN B;  1JQQ A;  2CQA A;  5HK3 A;  3SK5 A;  3WDN A;  3G71 Q;  2LJ1 A;  2PZ1 A;  3OYC A;  1GOZ A;  1II3 A;  4F7U F;  1OXX K;  2EXD A;  3S17 B;  1VQM T;  3E3X A;  4LDY A;  4ZLT F;  1OZ2 A;  2RD1 A;  1LT6 D;  1K9A A;  2COW A;  5IYC H;  4DV0 L;  5GMK i;  3NE5 B;  1TU0 B;  1A62 A;  3QO2 A;  3T13 A;  2GNC A;  4XTY A;  3IAY A;  4YCW A;  2FO0 A;  1EFI D;  2ZXP A;  3U50 C;  3D0F A;  5ELE A;  2R92 B;  3CME Q;  2E2J H;  1OO9 B;  2O4X B;  4UDU C;  1T9H A;  3HOU G;  2CSI A;  2LQ8 A;  2CHB D;  4OMM A;  3CCE A;  1ZUU A;  3B6Y A;  1QKW A;  3MEA A;  1QWY A;  2EPB A;  3PFS A;  2Q8R E;  2VV5 A;  1AWX A;  1AZE A;  1EQV A;  2EWN A;  2B2U A;  3I73 A;  4MNO A;  4OMQ A;  3G4S Q;  4N4I A;  1RLP C;  3KF8 B;  4AYB G;  3J80 L;  3M54 A;  3R6N A;  2F0V A;  3X24 B;  4QMG A;  5FLX E;  1U4P A;  2LFN A;  3GTO H;  2KRM A;  2GFA A;  1VDZ A;  1ESR A;  2A7Y A;  4MN3 A;  4JG2 A;  1IRX A;  2DNU A;  4HXJ A;  4F16 A;  2K6A A;  2Q2U A;  2GGR A;  3M5A A;  4WJ4 A;  3URG A;  1Q1B A;  1TWF H;  1PWT A;  3M0Q A;  2EZV A;  4JI8 Q;  3HFZ B;  3EFX D;  2DD5 A;  4A4G A;  1IL8 A;  1STB A;  2YUO A;  1IBK Q;  1C7Y A;  4M78 G;  1K3R A;  4P5N A;  3CCL T;  4KY6 A;  4UP9 A;  1T3S A;  4NS5 A;  1EWC A;  2MGS A;  2F0T A;  2F0L A;  4J9E A;  1BOS A;  1A8V A;  4FT2 A;  2OTL Q;  3S1R H;  4M78 C;  1I0C A;  1RD9 D;  1X3F A;  1LO5 D;  3GNF B;  4C5H A;  1RIP A;  2DMO A;  3OQ5 A;  3TRE A;  2YLC A;  5GMK m;  2DGY A;  2ZPG B;  4E47 A;  1TWA B;  3PGZ A;  5J1Z A;  2Z6B A;  1YFN A;  4XQQ A;  3S24 A;  4HCE A;  4H13 C;  2DJG C;  1K0R A;  4JOI A;  4KK7 A;  2QF7 A;  4A3I H;  2O2O A;  4XK8 E;  1WHL A;  4AIM A;  4JW0 A;  3C2P A;  5KYY A;  4X9C A;  1PRM C;  2P4T A;  4OB3 B;  1BBZ A;  1VA7 A;  1PV4 A;  1Y8N B;  1ILP A;  3O13 A;  3WVE B;  2CW0 C;  3M4Q A;  2CZ0 B;  3FKI G;  1AOJ A;  1XMO L;  5GAN d;  4LMQ D;  1XNI A;  3GTP H;  2X35 A;  1WFW A;  3GQB A;  1A2U A;  3HKZ E;  3PMF A;  1A2T A;  4EIK A;  1TVX A;  1RHP A;  2A6E C;  5GAM g;  1MBY A;  2E2J B;  3OOC A;  3QYH B;  1VQE A;  3J81 i;  2VS1 A;  2DL5 A;  2V1Q A;  1GD7 A;  4GNX A;  1N8R R;  2E5L Q;  1LTT D;  3P75 A;  3CP0 A;  4FF4 A;  3GD7 A;  4ID6 A;  2D1X A;  1UNS A;  1G3T A;  2F0Q A;  4WFN 3;  4RMO A;  4JC0 A;  3WOF A;  1SKU B;  2JA7 H;  3EG1 A;  2OXP A;  3GTK H;  1Y71 A;  1C0A A;  2JMA A;  2K5I A;  3NFC A;  4PV1 C;  1TUD A;  3X20 B;  1K28 A;  2K32 A;  1D7Q A;  3EFR A;  3X3N A;  2F2X A;  3GTO B;  3D8G A;  1XXG A;  2JJQ A;  4POF A;  1PRT C;  1NG2 A;  4RTV A;  3A0J A;  1JIC A;  1QVF P;  4FXD A;  5LJ5 f;  2CCZ A;  4ME7 A;  1TWF B;  3I4M G;  1VQN Q;  2UXD L;  1Z47 A;  2NUT A;  1HZ9 A;  2MYS A;  3RER A;  3UDF A;  1VQA A;  3UDI A;  3OSO A;  1KDB A;  1C4Q A;  4QB4 A;  2Q8I B;  3PGG A;  1B70 B;  1EYA A;  4HJ5 A;  3HEJ A;  3S1R B;  1U5S A;  1N36 L;  5GMK j;  2A0F B;  1TY2 A;  3PQI A;  3Q22 A;  1H8K A;  3VS3 A;  1U1S A;  2CKK A;  3RLN A;  2K50 A;  2DL8 A;  2K3B A;  1NCV A;  3S14 H;  1G6P A;  4C0Z A;  4C5G A;  2DXC A;  2D0N A;  4M4Z A;  4A3I B;  3T1H Q;  1VYV A;  4Q5W A;  3I56 Q;  3JCM g;  3FEO A;  1IBK L;  2HCI A;  2FRY A;  3EG3 A;  1I3Q H;  5CYU A;  4K6D A;  1IW7 D;  2EYZ A;  4J9H A;  3A8G B;  2HSE B;  2RDF A;  4D8D A;  2M0Y A;  3RMH A;  5IHK A;  4F7U A;  4KLK A;  5GMK h;  3MVV A;  1WJR A;  1BQQ T;  4RCO A;  1NPR A;  4JI5 Q;  5IXB A;  2MI6 A;  2V26 A;  5KGU A;  3GTP B;  4BY1 G;  3JB9 I;  4XYO A;  4L6V 5;  3OW7 A;  4EX5 A;  3JCM V;  1J9O A;  1HQR D;  1Y8O B;  3CXC S;  1M90 U;  2X3W D;  4DF7 A;  4DR7 Q;  3HRU A;  1WHH A;  4HJ8 A;  1SNO A;  1DJ7 B;  4A93 G;  1DOL A;  2EAY A;  2OTJ Q;  2CS7 A;  2R7Z H;  5KYI A;  2Y0S B;  4OIJ A;  1LLR D;  4CJ2 C;  5C44 H;  2QEX A;  1IGQ A;  2LJ0 A;  1HRJ A;  2KQW A;  1WA7 A;  1J5E Q;  1LTI D;  3HRS A;  3PT9 A;  1CQF A;  5GAO r;  3CCM Q;  4QY7 A;  4C1N K;  3GTK B;  3URY A;  1ZUK A;  2LX9 A;  2DNC A;  2MUY A;  1CA6 A;  2JA7 B;  5G3L F;  1AW7 A;  1VQG A;  1LVK A;  1T0J A;  3ULJ A;  5DM6 3;  4R8I A;  1EY0 A;  1PA6 A;  2EKH A;  4DQ2 A;  4HIM A;  1IKM A;  1AVZ C;  2DX1 A;  4ZGJ B;  1F2L A;  1RTO A;  3CHB D;  4C3J G;  2RB6 A;  1ENF A;  3QZ5 B;  2JP1 A;  3I4N G;  5D6X A;  1N8R C;  1M1K U;  3I4O A;  2E5L L;  4Z89 A;  4AQY Q;  2ICE C;  1Z7T A;  5LJ3 j;  2NN6 I;  4M77 E;  2R92 G;  2XIW A;  1FMK A;  1MSG A;  2L55 A;  1EIH A;  1QVC A;  5CV5 A;  1RDP D;  2HBP A;  2E76 C;  2BH2 A;  1VQO Q;  1VQ5 Q;  1NMG A;  4OEM B;  4XU3 A;  3K6O A;  3CC7 A;  5GAO m;  3S14 B;  3TS2 A;  1MND A;  4GY5 A;  1CSP A;  2A74 C;  3PSI A;  4OP0 A;  4P71 A;  3SDZ A;  5FRO A;  2XK0 A;  2RI2 A;  3J81 j;  5JVG 3;  5DLO A;  4JI4 Q;  5FRN A;  5LJ3 h;  5KCO A;  1ZSZ A;  1D5Z C;  2KUM A;  3BS1 A;  2E74 C;  2RQV A;  5JAV A;  4J7I A;  4JLI A;  1I3Q B;  4FP5 D;  4OHJ A;  5FU6 C;  2JXB A;  1EEI D;  1F9R A;  3F2D A;  2GBQ A;  2BE5 C;  2AZS A;  1IBM Q;  2E12 A;  2HL5 C;  1P16 A;  1B1Z A;  2BOS A;  3IL8 A;  3VS1 A;  3S16 H;  4EPC A;  2F52 A;  1Y7X A;  3AMU A;  2RHX A;  5EPL A;  3REB B;  1OV3 A;  2J6O A;  4BAC A;  5FWB A;  2FHD A;  2AQ1 B;  5BR8 L;  4M77 F;  3M4P A;  4WRD A;  4KD3 A;  2R7Z B;  4LD9 K;  5C44 B;  3T1H L;  1Y96 A;  1YHQ Q;  1GHJ A;  1UTI A;  3MA2 B;  5KE3 A;  1FL0 A;  1L1O A;  1HA5 A;  4QF4 A;  3JAM L;  1F2M A;  2F4I A;  1TS5 A;  1UE5 A;  3H09 A;  3EFO B;  1UG1 A;  4K8J A;  4IUU A;  1QJO A;  1JT8 A;  1RAI B;  3FPP A;  1PKS A;  5FLM H;  1BI0 A;  1VQC A;  4JI5 L;  2WII B;  4DEY A;  3RKY A;  2HQE A;  2PZW A;  5CIU A;  1E2W A;  3V2T A;  2DIQ A;  2EYH A;  3K80 C;  4DR7 L;  1NNX A;  5IGC A;  3CCR T;  1VQ6 T;  5IYC G;  3K5N A;  1NEG A;  1SSH A;  2KT1 A;  2OWO A;  2RH2 A;  3RR5 A;  3VA7 A;  4JI0 Q;  4OIK A;  1M4Z A;  5CQY A;  2KR3 A;  4BE1 A;  3CC2 Q;  1BKB A;  1WTV A;  1UUE A;  4A4E A;  4A3L H;  2X4Y A;  4MDW A;  2FPD A;  2KT8 A;  3A8M B;  3VRZ A;  1JJC B;  1W4S A;  3GPL A;  3J81 L;  4C0D B;  1U3O A;  2CFM A;  2HNI A;  3BJU A;  4K0K Q;  4FW2 A;  5CV7 A;  2E70 A;  4H44 C;  4GKK L;  1UE7 A;  1U06 A;  5JJZ A;  2ALY B;  4BXX G;  4JZ3 A;  1OTC A;  5D6Y A;  1KD1 U;  1L1O B;  2D8J A;  1V1Q A;  3I55 T;  2B2W C;  3E9H A;  4YCU A;  2GTO A;  2KGT A;  4HCZ A;  2YU9 H;  1D1B A;  2OEO A;  1EQT A;  3EQL C;  1Q81 R;  5E7N A;  4AQY L;  4RKU E;  1UB4 A;  2BA0 A;  5D3I B;  2CH4 A;  4DR5 Q;  3L2R A;  5DY9 A;  2C35 B;  2XI9 A;  2X69 A;  1X2Q A;  4LW1 A;  4II1 A;  5IHI A;  5CKE A;  1KC8 C;  4CC7 A;  1BO0 A;  1N9W A;  1RI9 A;  1YJW T;  2K05 A;  2RK1 A;  4AYB E;  3S16 B;  2BIV A;  1WHM A;  2HAX A;  3Q24 A;  3JB9 J;  1QVF S;  1V76 A;  1LCK A;  1FYC A;  4R4Q A;  1JEG A;  1D8L A;  1O80 A;  3I5S A;  3T1Y Q;  2VUM H;  2HDA A;  3TSZ A;  6AT1 B;  5C6S A;  2QQA A;  4JUV A;  4EMK A;  1EU3 A;  1RUW A;  2E2I H;  4RTW A;  2ED1 A;  4PJN A;  1BI1 A;  4C92 D;  1UWV A;  1L0W A;  4JI4 L;  2LCC A;  4AFU C;  2B8G A;  3M55 A;  5FO9 B;  4HJA A;  1TXY A;  2Z4H A;  2NZH A;  2IPO B;  1B7T A;  2A8V A;  2HDM A;  1BBX C;  4OB0 B;  2DJZ A;  3VUZ A;  4M78 E;  3NK9 A;  2VQE Q;  1LJO A;  2QDL A;  1N8R U;  4ESR A;  1BCP D;  3C94 A;  2WAQ B;  4J1M A;  1IBM L;  3FB9 A;  2Z8L A;  4KMU C;  5GAM j;  4FXK C;  3VS4 A;  2K57 A;  2VKN A;  5C0M A;  1M8M A;  1VQM A;  2SNS A;  4X3T A;  4C5E A;  4DOW A;  5CV8 A;  2AHO B;  4YHH Q;  3RR6 A;  2WSF E;  2YSQ A;  4DV2 L;  2K52 A;  3MEF A;  2JW4 A;  4KN7 C;  3L2Z A;  1B3Q A;  3PVQ A;  1YNN C;  4E2F B;  1G2S A;  3T4A C;  1KSW A;  1SMY D;  1X75 C;  2A69 C;  4DAY A;  5D7U A;  1N9S A;  3I5R A;  3LYI A;  2D5D A;  1VIF A;  3N6R A;  1YI2 Q;  1XPU A;  4JBW A;  4K8I A;  5C0X H;  1JOQ A;  2K5W A;  1H9S A;  3UDG A;  2JA7 G;  1WQ7 A;  2HUG A;  2ZZD A;  4C3H H;  1MV3 A;  3SHW A;  2AMC B;  4M78 F;  1YP5 A;  4DGZ A;  3W2D A;  1NMF A;  2WSE E;  2QA4 T;  2YU9 B;  4JRI A;  1QOH A;  4A3K H;  1UGR B;  2JTM A;  1N9R A;  3EJI A;  4JI0 L;  4PLL A;  1FNV A;  5KNB A;  2SEB D;  3EH2 A;  4J6W A;  2DZC A;  1ICW A;  1XOV A;  2Q2I A;  1WD1 A;  2KNB B;  4RG8 A;  3CCL A;  1WOC A;  1Q7Y U;  4K0K L;  2ABL A;  5HY6 A;  3C46 A;  4WTO B;  3KJP A;  2RDH A;  2UUB L;  5GAO p;  2VUM B;  4AMC A;  4L5Q A;  1HNX Q;  1F1B B;  1I8F A;  3D4W A;  2E2I B;  4OB1 B;  2CWA A;  3VUB A;  2VGM A;  1VQF A;  2GN5 A;  4JBJ A;  2IY5 B;  1Q81 C;  1HTL D;  5CQX A;  2F1L A;  3D7S B;  4HVU A;  1ARK A;  3VR3 A;  4DR5 L;  2KED A;  3M58 A;  2NUP A;  4DV3 Q;  4C92 B;  2OAW A;  1WPY A;  1PH4 A;  3ASK A;  4FU6 A;  3PF4 A;  4G7O C;  3OBY A;  2RCN A;  1PHT A;  1TKW B;  4X65 Q;  3H6M A;  5FRM A;  5ELN A;  4B08 A;  4RG1 A;  3I2Z A;  1BCP B;  3PUY A;  3EG9 A;  1JR0 D;  3TP5 A;  1OX9 A;  3GTM H;  1QUQ B;  4KY5 A;  4UP7 A;  3MZ5 A;  4ALP A;  3KFU A;  1NM7 A;  2IHF A;  3FLG A;  4LDV A;  4KGX B;  3CC4 T;  2OAU A;  1WTP A;  3ZFJ A;  2B2T C;  1VMC A;  2A6H C;  1QZH A;  2VQE L;  4JI7 L;  1SNC A;  4L5R C;  3LGJ A;  4IFD H;  4RFB A;  5EQ0 A;  1JMC A;  4A3E G;  3E5S A;  2EIF A;  1G8Z D;  1TY0 A;  2MMP A;  2CVR A;  4C3H B;  2NTS A;  2PVD B;  2J0T D;  3Q6S A;  1GJX A;  4BE2 A;  1D5M C;  3OYY A;  1LYL A;  1DD2 A;  2Y4X A;  4IZ8 A;  5EKK A;  4C8Q D;  1D2B A;  4OVA A;  4JS4 A;  3RMQ A;  4A3K B;  5GAO q;  4DA4 A;  1X56 A;  4KRT A;  3NXW A;  2NUZ A;  3TEH B;  1VIE A;  2KHS A;  3IKJ A;  1NPP A;  3OWE B;  1WJQ A;  2EQM A;  3CRL C;  1G3Y A;  4FM4 B;  4I65 A;  4A3D H;  3CCQ Q;  4HCB A;  2XTI A;  2XGT A;  5I9O A;  4GLK A;  4E7Z A;  3STB C;  4PQX A;  3EG2 A;  2YUN A;  4FIB A;  1PXU A;  1KAW A;  3BZC A;  1GFC A;  3EG0 A;  2VB6 A;  1EIG A;  1M1F A;  1KIX A;  2NN6 G;  3HTR A;  1Y0M A;  1W2B A;  3WXM B;  2GQI A;  4C56 C;  1FXX A;  5FJ8 H;  3TME A;  4RTU A;  2Z0W A;  2A73 B;  4MIU A;  4KTA A;  4QUF A;  2Q8T A;  4KN4 C;  3OMG A;  5IAY A;  1Q12 A;  5IP9 H;  2QQS A;  4CGY B;  4FSS A;  2E1H A;  1A15 A;  5HCK A;  1SE2 A;  4ANJ A;  1I4K 1;  2ZJR A;  1V1P B;  1ZHI A;  3CCU Q;  3PUZ A;  1Q90 A;  3I91 A;  1HNX L;  2A37 A;  2CDT A;  3GBQ A;  1M4V A;  1LT4 D;  4KI0 A;  3GTM B;  2QYZ A;  4WJ3 M;  2B29 A;  1PZJ D;  2F4V Q;  2FG0 A;  3HP3 A;  5AJ3 L;  2A19 A;  2X3X D;  1TWG H;  2M02 A;  2CW0 D;  2P0Q A;  4GN4 B;  2AZV A;  5K36 G;  1KHI A;  2N3S A;  2K3X A;  4WOR A;  1VQ7 T;  2EJM A;  4DV3 L;  2M2L A;  2DA9 A;  2SRC A;  4OMP A;  1HZA A;  1W1F A;  4CKC A;  2EVR A;  2ZT9 C;  4BB7 A;  5EAY A;  1U9R A;  3JCM W;  4F14 A;  3MHB A;  4XTX A;  1LTR D;  3HOV H;  3NWT A;  4ATO A;  4HTH A;  1WCM H;  4RTZ A;  3CCJ T;  3OIP A;  2JA5 H;  2RKS A;  1Y1V G;  3A8H B;  4M7A D;  1A0N B;  1HUN A;  2XD0 A;  3H8Z A;  3J7A F;  2QGG A;  4X34 A;  1NLO C;  2F1M A;  3Q0A A;  1X6G A;  1FNW A;  1KHC A;  2RPN A;  2O9V A;  1YJ9 T;  4C8Q B;  3GTJ H;  1J3T A;  1Q81 U;  1HZB A;  3QYG B;  1AN8 A;  4A3D B;  2JVV A;  4XTC S;  2F0F A;  1PRT D;  2HD0 A;  4M7D D;  2F0W A;  4RTY A;  3G71 T;  3JAM c;  3AYH B;  1BDO A;  3MP1 A;  2K33 A;  1KL9 A;  4KUI A;  3DLL A;  5EKI A;  1UJ0 A;  4FYV B;  2RN8 A;  1BYM A;  2X9H A;  2YWW A;  2H3J A;  4FNF A;  1DON A;  2DXB A;  2K7V A;  3OW2 P;  4QVC A;  1J8I A;  4RH6 A;  4OX9 Q;  4DR6 Q;  1KQ2 A;  2K5D A;  5JEA J;  3CME T;  3K57 A;  3K5M A;  3NEL A;  3I9Q A;  1X43 A;  1D6E C;  1LUZ A;  2Y90 A;  1M1G A;  4KKT A;  3QWY A;  2EYJ A;  3LX0 A;  1LT5 D;  4BA1 I;  3H0G H;  5CVI A;  1E6H A;  1HQM C;  5HUR A;  4ZKC B;  3PUW A;  4A3J H;  3H94 A;  3UT1 A;  2FPE A;  4J83 A;  5GAN 5;  2LT1 A;  4M7A A;  5GAO n;  4DPG A;  1IYU A;  4H02 A;  3J81 c;  5LJ5 e;  1R8O B;  3G4S T;  1GUN A;  1UEB A;  4M75 D;  1KDA A;  1BF4 A;  2Q2H A;  5LMU Q;  1EX4 A;  1CKN A;  3VS7 A;  2RQT A;  5GAN 4;  1FD7 D;  1TWG B;  3BVG A;  1B44 D;  4L5S A;  3P7J A;  2E3H A;  3NGP A;  4HMI A;  4M7D A;  2EYQ A;  2ROL A;  4A76 A;  3I7F A;  4K14 A;  5ELF A;  1N5Z A;  1D1K A;  2D0O A;  4KY7 A;  3D4D A;  4MDX A;  2L11 A;  1BIA A;  4HCS A;  3CU7 A;  5T1G A;  5HGQ A;  1M9S A;  3KOJ A;  3QIA A;  1JJ2 P;  3HOV B;  4QL5 A;  3TQ7 P;  2KCN A;  1M3C A;  2BZ8 A;  1WCM B;  4QQ6 A;  2IW3 A;  1BI2 A;  5IWA Q;  5FK9 C;  1XYI A;  1QWF A;  2OTL T;  2G5D A;  2F4V L;  2JA5 B;  1OXV A;  3A8O B;  3OYN A;  1RAB B;  3CCR A;  1VQ6 A;  1XX8 A;  3EBE A;  1YZ6 A;  1D0X A;  1I4X A;  1B7Y B;  4FF1 A;  1ET9 A;  2P4R A;  3ND9 A;  1M90 R;  1SG5 A;  1SHG A;  1VF5 C;  2P5Z X;  2WFW A;  4J9D A;  3FEW X;  4M77 C;  3GTJ B;  3RUZ A;  2VGN A;  3OIQ A;  1MMN A;  2C0I A;  4M7A B;  3J80 E;  3OA6 A;  4E7I A;  2K01 A;  1BIB A;  1VUB A;  1DYQ A;  1GUS A;  1SYB A;  2H5X A;  2DXT A;  3K0X A;  2IPK D;  3H3V I;  3OWF A;  4NMZ A;  2YHT A;  4M75 A;  3S1M H;  2CRE A;  2VXE A;  2PI2 E;  1JJG A;  1TS4 A;  4O0A A;  3VJP A;  1B2T A;  2EJF C;  2NZO A;  1LAB A;  4I7Z C;  4ZNX A;  3ONA B;  4M7D B;  1PH6 A;  1QNK A;  4DR1 L;  3P1H A;  2X4W A;  2CYZ B;  1PC0 A;  3I55 A;  1X3E A;  4RMF A;  3CCS Q;  2E2D C;  4C3H G;  2B63 H;  3KLS A;  5KH6 A;  4DR2 Q;  1R4P B;  1KJW A;  2I2L A;  3GNG A;  2HSP A;  1IYJ B;  2DY7 A;  5E3F A;  1FMW A;  4LK1 C;  3R2T A;  1STY A;  2G9H D;  4A3K G;  4LFA L;  1M1K R;  2HDL A;  2YTV A;  3H0G B;  3QB3 A;  4A3J B;  1LT3 D;  4CC4 B;  4RA8 A;  1YJW A;  1MMG A;  2XRQ D;  2PZU A;  1H95 A;  2RA2 A;  4BY6 C;  1DCZ A;  1VQD A;  5K5P A;  1XJV A;  1K3B C;  2DBM A;  2F2W A;  3CXC P;  2FRW A;  4L63 B;  4P74 A;  1MUZ A;  3PVL A;  3MJX A;  3LNN A;  2RK2 A;  2BE5 D;  1YJN Q;  2BA1 A;  3PMT A;  1WI7 A;  4OX9 L;  1VQH A;  2DPP B;  1XWE A;  4JZ4 A;  8AT1 B;  4KUD K;  1SNQ A;  3A7A B;  3RLF A;  5CMD A;  4M75 B;  4XTU A;  4F8M A;  1DXM A;  4DEX A;  4MMK A;  1VQN T;  3X3M A;  1MD2 D;  1HXY D;  1C6V X;  3OYB A;  2QIL A;  2LNH B;  5LJ3 f;  1G2B A;  1IGU A;  2ZPI B;  2KSS A;  1SN8 A;  5A0D A;  1PTO C;  3D3R A;  2EOT A;  5LMU L;  4OO1 H;  3OTO L;  1JBM A;  4JBK A;  1HK9 A;  1I6H H;  4LF5 Q;  4N8X 1;  4HSP A;  2QTV A;  4K2L A;  3KYH C;  4RGN A;  1EIF A;  2DY8 A;  2E6Z A;  1KQS A;  1PYB A;  1PZK D;  3I56 T;  1I6V C;  1I4H A;  2R5M A;  3DEP A;  2RMO A;  3CPW P;  1OZ3 A;  1U8R A;  1JE5 A;  4BBR G;  4KD4 A;  4TVA B;  1HR0 Q;  3S1M B;  1TU2 B;  3GV6 A;  5A0G A;  3OYJ A;  3BDO A;  2CP0 A;  2IX1 A;  2UXD Q;  5IWA L;  3NEN A;  1HYO A;  1SEB D;  5M3F H;  4J15 A;  1SAP A;  1WXB A;  4A4K A;  4PL6 A;  3NTH A;  2PMZ B;  3CCV Q;  2B63 B;  2QA4 A;  3INZ A;  1OQK A;  4P72 A;  1N36 Q;  1M90 C;  5C3E H;  4G7Z C;  2D0Q B;  2OTJ T;  4P73 A;  4A63 B;  3QJY A;  4P2C B;  3HOX H;  1PH3 A;  1PFB A;  2EXZ A;  3UE1 A;  1PG5 B;  1HJP A;  2FJ2 A;  3G6J B;  4KV6 A;  2XDP A;  3TN2 A;  2E10 A;  4Y91 A;  4FYX B;  3NSW A;  5GAG C;  4OWW B;  2I5H A;  3T51 B;  1JC7 A;  2C06 A;  4C8Q G;  2LP5 A;  1AWW A;  3CCM T;  2EQJ A;  3A1P A;  2KRO A;  4BE0 A;  2WAC A;  3T56 B;  2DIG A;  1OX8 A;  5FOB B;  4A3F H;  2E4H A;  1AFP A;  4TKO B;  1SE3 A;  2DM1 A;  2RI3 A;  1SNM A;  4BWG B;  1SYG A;  2QXF A;  4UHV A;  5C5M A;  2SOB A;  4DR2 L;  1S5D D;  1W6J A;  2IL8 A;  1KD1 R;  2YUQ A;  3GDE A;  1NYF A;  5FU6 B;  4V2S A;  1I50 H;  2DXU A;  1QLY A;  4GOP C;  4DK0 A;  1M1K C;  1DGS A;  2QKI C;  4CKE A;  2JEB I;  3JAM i;  4HIO A;  1WFQ A;  1HH2 P;  1L0X B;  2RHQ B;  2RM4 A;  3OW2 S;  3JCM c;  3PUV A;  3M7N A;  3BVZ A;  4F17 A;  2WB1 B;  4OL7 A;  4MTK A;  2P0P A;  1VQO T;  1VQ5 T;  3JB9 F;  4NPS A;  5CO7 A;  4EQN A;  3F2C A;  2HL3 A;  2MF2 A;  4Y28 E;  2OI3 A;  2DFU A;  2W10 A;  1PH1 A;  3AEV A;  1I6H B;  1Z9Z A;  4JRP A;  2WKC A;  2B2W A;  2KMT A;  2PNI A;  5IXF A;  3CC4 A;  5IGB A;  2LY7 A;  1CSK A;  3W1G A;  2E65 A;  2CZ1 B;  5KYU A;  1ZUY A;  1VQ4 Q;  1VQ9 Q;  1XPR A;  1EUJ A;  4JI7 Q;  2UXB L;  1AE2 A;  5GAN j;  1S72 Q;  2XWJ B;  2PZT A;  1YNN D;  4QIW B;  3BW1 A;  4JJD A;  4ZQ3 A;  5M3F B;  1RAC B;  2PUO B;  4M8A A;  4E7L A;  4LF7 Q;  1PKT A;  5ECA A;  4CBV A;  4TVR A;  2DVE A;  4PJO G;  1ENA A;  1G29 1;  2E3I A;  3RNU A;  3HOV G;  3VR4 A;  5C3E B;  3SB2 A;  4LF5 L;  3RZO H;  5LJ5 g;  4K11 A;  2JA5 G;  1JJ2 S;  3L7Z C;  3HOX B;  1M3B A;  5KYX A;  1YIJ Q;  5FO7 B;  1YHQ T;  1GXD C;  5GAN h;  2FXQ A;  3HRT A;  1JWS D;  3HS0 C;  3EFS A;  4MML A;  5KYY B;  1PD0 A;  1HR0 L;  2K03 A;  3CBM A;  1DM0 B;  1I5O B;  4A3F B;  1FMV A;  3MP8 A;  3DMU A;  3ULL A;  1YNJ C;  2R3Z A;  1KK7 A;  1E7O A;  4DAM A;  1YIT Q;  2CQO A;  4X62 Q;  2RQR A;  2L3Q A;  2HCC A;  1Q3L A;  2CUB A;  1B53 A;  1GVP A;  2R61 A;  4NXN Q;  3SR1 A;  5C4Z A;  2F3V A;  3TBI B;  2XID A;  3A54 A;  3C1F A;  1T0H A;  2LC4 A;  3KUF A;  2LXK A;  5IH2 A;  1I50 B;  2F0D A;  4RGM A;  4BA2 I;  4GNX B;  2PI2 A;  1N33 Q;  5AYF A;  4FT4 A;  2LMC B;  5BR8 Q;  1UAP A;  1X3G A;  2X4X A;  3CC2 T;  4JI3 L;  5J26 A;  3JCM X;  4NKL A;  2YRC A;  5HGT A;  1XPO A;  3EIV A;  2MHV A;  1M8V A;  3HL8 A;  3FJP A;  2GFU A;  3E9F A;  1Q7Y R;  3JAM E;  4A3J G;  4HIK A;  5GAH C;  2J7I A;  2E8G A;  1Y1W H;  5KYX B;  2HMA A;  3S3O A;  3GV3 A;  1I4R A;  3SK4 A;  4C3I G;  1Z9Q A;  1Q86 U;  1K73 U;  1QVP A;  1KD1 C;  2LXJ A;  1NR4 A;  2B8F A;  1WNL A;  3GTG H;  3HOW G;  3VYS A;  4B9W A;  3LWH A;  2QQR A;  1E7Z A;  3NHH A;  1VQ7 A;  4EGV A;  2NUT B;  2DIL A;  5GAN 7;  1BUV T;  2F0E A;  4TQU S;  4DV4 Q;  2LNV A;  3NPF A;  2MPM A;  4DFA A;  3LWI A;  2O31 A;  3SK8 A;  3CF5 A;  1UE6 A;  2G3R A;  1TS9 A;  2R93 H;  4DXG A;  3NBH A;  2K6D A;  1IXD A;  3CBP A;  4GBQ A;  1I4G A;  2DYI A;  3RKW A;  2A6H D;  3LW5 E;  3OS0 A;  1V8Q A;  2RCF A;  3OYI A;  4GN3 B;  4DAP A;  4ZYS A;  3CCJ A;  3M9B A;  1HR0 W;  3J81 E;  2DD4 A;  3RZO B;  4ELZ C;  3JB9 D;  4LXC A;  1GHK A;  5JJK A;  1PH8 A;  3VRY A;  4XT1 B;  3MEH A;  2K14 A;  4GKK Q;  2JN0 A;  3P8H A;  4KGV B;  1VMP A;  2R7D A;  2FFK B;  4QGU A;  1YJ9 A;  2FB7 A;  3I4L A;  3GP7 A;  3F70 A;  1YHA A;  5ELC A;  2PU9 B;  3EHR A;  1E24 A;  5JPN C;  3S1Q H;  4QW2 A;  2OX7 A;  4QUC A;  3G71 A;  2IVW A;  2KEN A;  4F7U B;  4LF7 L;  2K5H A;  5KE2 A;  4ELY C;  4F88 A;  3M59 A;  4EDU A;  2KBN A;  4XYQ A;  1D0Y A;  2ZGW A;  1JB7 A;  2UXC Q;  4J9B A;  1V1C A;  3MEW A;  1QVG A;  1PYW D;  1O78 A;  3CPW S;  4Z8A A;  1T5X D;  4E6R A;  1G91 A;  1AZQ A;  4YWL A;  3MO8 A;  1AD5 A;  1LV9 A;  3CME A;  2EGA A;  3EN2 A;  3H3V C;  1VQI A;  4RTT A;  2EYM A;  1EOV A;  1LNX A;  2UU9 Q;  2B2T A;  1EFW A;  3C1E A;  1YI2 T;  2K5N A;  4FDB A;  5IYD G;  1DOK A;  4YWK A;  4A3M H;  1Y1W B;  1Q1E A;  4X62 L;  1H9J A;  2CWP A;  2VQF Q;  2KA7 A;  4NXN L;  4RHR A;  3G4S A;  3RMS A;  3H41 A;  2ZPE B;  2SDF A;  4C1N I;  1B9N A;  4OEL B;  1YN8 A;  1BCM A;  3OS2 A;  4DK6 C;  1X3P A;  3I70 A;  3GTG B;  1R4Q B;  2DKG A;  1SJE D;  2XN9 C;  4ZN1 A;  3W5O A;  5I9P A;  3QPH A;  4NP5 A;  2PUK B;  4JI2 Q;  1SNP A;  1N33 L;  4XAX B;  2H8H A;  4DV2 Q;  5I2X A;  1WJS A;  2ECZ A;  3RZD H;  3KBG A;  2DAQ A;  3P8B B;  1X65 A;  2EY1 A;  2K28 A;  4PNY A;  3QUI A;  4F7X A;  4H7B A;  3QO3 A;  2R93 B;  2XHC A;  5IP7 H;  1PMR A;  2L4N A;  3SK6 A;  1Q7Y C;  5IYB G;  5LMN W;  3V8K A;  2UUA L;  1EQQ A;  2ATW A;  5IGF A;  4LF9 Q;  1JB3 A;  2OTL A;  1X6O A;  1CTM A;  2WB1 G;  2WV6 D;  2KXC A;  1X27 A;  2N8N A;  4RKL A;  2PNR C;  1GM5 A;  3M3Y H;  1EL0 A;  5J3B A;  2R7F A;  5DAU A;  1PZI D;  1HFN A;  5GJV B;  2F69 A;  4BI4 A;  4OO1 G;  2E64 A;  5COR A;  1ZSZ B;  3OYH A;  4A3B H;  2K5L A;  1EWI A;  4DV4 L;  2V8J A;  4RAU C;  3GO5 A;  1UHC A;  1QKX A;  1M27 C;  1H64 1;  2JNG A;  2LCS A;  5DM7 3;  3S1Q B;  3X26 B;  5IGD A;  4IKF A;  5IY0 A;  4E7K A;  4BY7 H;  3M0P A;  2F3W A;  1F2Y A;  2KVM A;  2AHJ B;  1T5E A;  4XXE A;  1C48 A;  1XNQ Q;  2COY A;  2VXW A;  4HVV A;  3ERO A;  2JS0 A;  2KAF A;  3UAT A;  2F03 A;  4A3G H;  2L1B A;  1P92 A;  2WKD A;  2UUB Q;  2QW7 A;  2F3I A;  2K5Q A;  2KCC A;  1ICF B;  4B3R Q;  4O2D A;  2E2H H;  1Y96 B;  3N5B B;  2KE9 A;  1SR3 A;  4J9C A;  5G3L D;  2IIM A;  4NOY A;  2ICI A;  2MFI A;  1LPL A;  2CH4 W;  4EMG A;  8ATC B;  1I5F A;  1S5C D;  2F0H A;  4HMJ A;  5KYL A;  2MWP A;  5AT1 B;  1HFG A;  3JCM P;  3VR5 A;  4R0K A;  1VQ8 Q;  1NTG A;  2Z4I A;  3BFM A;  5CV4 A;  5D14 A;  4A3M B;  2SNM A;  3VS5 A;  2D9T A;  2J4X A;  2LSS A;  1IL2 A;  4R8N A;  2UXC L;  1BU1 A;  4LNQ A;  4A3F G;  1OU9 A;  2RHU A;  1WVL A;  1AEY A;  3LWU A;  1PTO F;  3AFP A;  4DUZ Q;  4IUR A;  1BB9 A;  2GCX A;  2ZPF B;  3HFO A;  2DUD A;  3PE0 A;  5IIF A;  4FO2 A;  1G51 A;  3CKI B;  1V1O A;  3M57 A;  2DNE A;  4AG1 C;  1WTQ A;  4POG A;  1QCB D;  1RF2 D;  1PFM A;  2A1A A;  1VQN A;  3RZD B;  2UU9 L;  4DV1 L;  4E7J A;  1NJI R;  1N34 Q;  1E1T A;  3TSW A;  5I2S A;  3GIB A;  3HKZ B;  1V29 B;  3CCQ T;  3CD6 Q;  7AT1 B;  2F0J A;  5C4X H;  4Z02 A;  2AKW B;  3A8L B;  3TU4 K;  4CJ1 B;  2JJ9 A;  2NYZ D;  1CHQ D;  2M0O A;  3FP9 A;  4RTX A;  3L0O A;  2PQA A;  3L9A X;  4QJF A;  5COY A;  3WOE A;  2L8D A;  4A3I G;  1GL5 A;  3M3Y B;  4DBR A;  1OPK A;  2AK5 A;  1V43 A;  4CRI A;  1TWC H;  1FWZ A;  1EZZ B;  1O7L A;  4JI2 L;  2RHI A;  4A3B B;  5LJ5 d;  4Y92 A;  2O5I C;  3M0S A;  2JEA I;  5I2M A;  1O75 A;  3I56 A;  2JA6 H;  3G1J A;  3DM3 A;  4BY7 B;  3PV0 A;  3C95 A;  4UP8 A;  1N32 Q;  2VC8 A;  1BI3 A;  1YNZ A;  3JCM Q;  2HQL A;  3FHW A;  1JO8 A;  3CCU T;  2F0O A;  4M77 D;  1VQK Q;  5C0X I;  2B2Y A;  2I07 B;  4HJ7 A;  5GAM h;  4LF9 L;  3HOY H;  1ZA1 B;  2Y0S G;  4XT3 B;  4LDX A;  4A3G B;  5HKC A;  4EMK B;  1PFS A;  2ED0 A;  3LLR A;  2PNH A;  2CKZ B;  2IG0 A;  1IXR A;  4FVM A;  4HA8 A;  1S5E D;  1QW1 A;  1SMX A;  1X32 A;  1SEM A;  2E2H B;  2OTJ A;  1OU8 A;  3UWN A;  3DEO A;  3E9G A;  1QVF A;  2KY9 A;  1WTR A;  4CC3 A;  1STA A;  5ELD A;  1KQ1 A;  1HXD A;  1CZG A;  2J6K A;  2K5V A;  3CCM A;  2RJF A;  1JOO A;  2M9V A;  4UAI A;  4JYA L;  2EGC A;  1GO3 E;  4KT0 E;  3BZK A;  3G6E Q;  3FC3 A;  3OS1 A;  1G83 A;  2XU8 A;  2DF6 A;  3OB9 A;  5GMK e;  4PJO E;  4UPA A;  1XNQ L;  3PO3 H;  2DRM A;  1K9M R;  1WTH A;  2ZTC A;  3TQY A;  4F7U G;  5JVH 3;  2A68 D;  1FJG L;  5FW9 A;  3Q23 A;  2BCO A;  2EPD A;  1EY6 A;  4B3R L;  2EY2 A;  1WI5 A;  2TSS A;  4KJN A;  4DAY B;  1GFD A;  2RF0 A;  3QHS A;  2FPF A;  4M77 A;  4MZP A;  5AJ3 Q;  1I1J A;  4X66 Q;  5F2D A;  1QZG A;  2LQK A;  2KYM A;  4XQ3 A;  3KFV A;  1S5B D;  5M3M H;  5ISR A;  5FWC A;  3RLO A;  4C2M H;  1VQJ A;  4E7H A;  2RVL A;  3F2B A;  3HFN A;  1VQO A;  1VQ5 A;  3TSS A;  1S40 A;  5C4X B;  2MWO A;  1H9S B;  4ZCK A;  2E5K A;  4IUP A;  2EJF A;  1Y8P B;  2MP1 A;  3OHX C;  2JMC A;  1E22 A;  4DUZ L;  3C3L A;  3JCM h;  1TWC B;  1YBY A;  2VB2 X;  3L2U A;  2GA4 B;  2PQE A;  3VR2 A;  5JJL A;  2JA8 H;  1HPC A;  2AQ3 B;  2AQ2 B;  2EJG C;  2JA6 B;  4LJZ C;  1PTO D;  4PJO F;  1NJI C;  3KF6 A;  1N34 L;  1H3Z A;  3S15 H;  4R56 A;  3R8B A;  4IFD I;  1X3Q A;  4HCK A;  3QBY A;  2F0G A;  1E6G A;  3EAE A;  3OYG A;  1CM9 A;  2RSN A;  2XVS A;  3FDT A;  5KRU A;  2R7Z G;  3HOY B;  1DJR D;  3HRZ C;  4FF3 A;  1IW7 C;  3HOZ H;  5C44 G;  2DEU A;  2XIC A;  4C0F A;  2QQ9 A;  1UUP A;  2JM9 A;  5JEA H;  3MXU A;  1PDQ A;  4LFC Q;  4M77 B;  1MMD A;  1SSO A;  5M9O A;  1CHP D;  4LUZ A;  1EIY B;  3S3N A;  5LJ3 e;  1NYG A;  3CMA Q;  1IZ6 A;  1TH7 A;  3TCJ A;  1YHQ A;  4G57 A;  2GQV A;  4LDW A;  2NUP B;  4IUT A;  3DWQ A;  2RF4 A;  4CI0 C;  1N32 L;  1PSE A;  1TQO A;  5L23 A;  2GVB A;  3V8J A;  4JRQ A;  1HNW Q;  1EY4 A;  2NTT A;  2RBM A;  2YRV A;  3D6W A;  4HED A;  3E2U A;  3HPW A;  1TR5 A;  4BD3 A;  1H92 A;  3PO3 B;  1HD3 A;  3EGD A;  2J6F A;  3EG9 B;  1VF7 A;  4DV6 Q;  2HQX A;  3TP7 A;  1EYG A;  1LAC A;  2GVA A;  1BVS A;  3AHU A;  3CQZ H;  4BDY A;  3BZD B;  1C1A A;  4IPG A;  4FYW B;  2OQK A;  2P84 A;  1HSQ A;  2AKK A;  5FU7 B;  2D62 A;  2JE6 I;  1VQP Q;  1AWO A;  1FGB D;  1STN A;  1H3H A;  2QQB A;  3CC2 A;  4A3C G;  5M3M B;  4C0D C;  2ZCF B;  4J9I A;  4C2M B;  2C0O A;  3LX7 A;  4BY6 B;  2YTY A;  3U4V A;  1PH9 A;  4JI6 Q;  4LUV A;  3KJO A;  2RJC A;  4M78 D;  3M9Q A;  1ZKO A;  3M53 A;  4A75 A;  4J7F A;  4FXG C;  1ROD A;  1K9M C;  4PK4 A;  4ZGE B;  1O7Y A;  1F9S A;  4A3M G;  2PMZ E;  2B3G A;  4PFO A;  2Z9H A;  2L5Q A;  3CCS T;  1ASZ A;  2JA8 B;  1VQL Q;  1EQR A;  2R5A A;  2BE9 B;  2W0Z A;  1I81 A;  2EYX A;  4D8K A;  2NBF A;  4I7A A;  2ZTE A;  1QMC A;  5BN5 A;  3S15 B;  4QCL A;  4ABN A;  4X66 L;  4OF1 A;  4JRK A;  1FNU A;  3V7S A;  3EGD B;  1JXM A;  2PQW A;  1G5V A;  1M2V A;  1U4L A;  4DNR B;  3M85 A;  1B4O A;  1X9N A;  1MHN A;  3HOZ B;  5BN4 A;  3L3O C;  4XDX A;  2DEQ A;  4MZM A;  1E3P A;  2OF1 A;  2A6E D;  3HKZ G;  3K5O A;  5IP7 G;  1EY8 A;  1NLP C;  2A3L A;  2IX3 A;  1I4P A;  1QQJ A;  5A2Q L;  4LD6 A;  2D9U A;  2I5L X;  1YJN T;  2WAQ G;  5C6A A;  2FEI A;  3U9S A;  1T3L A;  2QDY B;  4PKC C;  5CCA A;  5FLM G;  4QT7 A;  3PIP 3;  4JV5 Q;  1JOR A;  2FIN B;  2EQI A;  1U1T A;  4M78 A;  1UHF A;  2YDL A;  2PW7 A;  4DR1 Q;  4IPD A;  2RDG A;  2YUP A;  3CCE Q;  3LGF A;  2EQS A;  4B3M Q;  2DE0 X;  2NWM A;  1KAA A;  1UEC A;  1NBW A;  3JRZ A;  2XDD A;  4DR4 Q;  1Q82 R;  4LFA Q;  2A28 A;  4IUN A;  4CDD C;  4BY7 G;  2PO4 A;  1FGU A;  1CT1 D;  4ZTF A;  3CQZ B;  4A3L G;  4LFC L;  2A08 A;  3DWA A;  2QDB A;  2KBT A;  2RQW A;  4AG2 C;  2XNA C;  5LL6 X;  1QNU A;  2KJX A;  1KG1 A;  4IN3 A;  3RNJ A;  3FPU B;  5GAE C;  1ET6 A;  4AYB B;  1Y69 U;  2KEE A;  4FYD A;  1EY5 A;  3QOL A;  1RLQ C;  1MJE A;  5C3W A;  3PIP A;  3UI2 A;  3TZU A;  1MMA A;  2BE7 D;  2QI2 A;  2EE1 A;  1YI2 A;  4P75 A;  3C4S A;  1ABO A;  1NJI U;  4JJB A;  2QCP X;  3BDC A;  2RHY A;  1HNW L;  1SND A;  3QDR B;  5L8R E;  3N52 A;  4RCN A;  5CKD A;  2C0T A;  2B8A A;  3I4M H;  5J39 A;  4DV6 L;  1EYC A;  5CBA E;  5GAN f;  2QG9 B;  3KDF A;  1SXT A;  4M78 B;  2IT1 A;  4RHS A;  2EYW A;  1K76 A;  3VYH B;  3CCV T;  3SWN C;  5D3D A;  3MET A;  5GAD C;  3E6Z X;  3UA6 A;  2O2L D;  1HUM A;  3C12 A;  1X2K A;  3OY9 A;  2VUM G;  3OTO Q;  2G6F X;  1TWH H;  4JI6 L;  4RG2 A;  1W3S A;  3NWS A;  2O88 A;  3AB9 A;  3TEE A;  1N6A A;  2EFI A;  5JPM C;  4GN5 A;  4J6X A;  1W6K A;  3P20 A;  1UE9 A;  4PNO A;  2M00 A;  2EKO A;  3M56 A;  5IE8 A;  4NXM L;  2L3R A;  4IQZ A;  5IOD A;  3HHT B;  3SHL A;  1HJD A;  4C92 G;  3HKS A;  1WLP B;  1LTG D;  1E2Z A;  3R6O A;  1KLU D;  1YEZ A;  1Q86 R;  1K73 R;  1R0B G;  4CKB A;  4C92 C;  1LM0 A;  4BY1 H;  2CSQ A;  2F0U A;  2V8I A;  3UF4 A;  4PZ6 A;  1B8A A;  1QP3 A;  2RJD A;  2JQO A;  3KDF B;  2DTI A;  2DTH A;  4R4T A;  2ES2 A;  2LVM A;  2QGF B;  1AT1 B;  4EQ5 A;  5J22 A;  4HN7 A;  4A93 H;  5D6W A;  2EDG A;  3T53 B;  3VS6 A;  2AWO A;  2BTT A;  1U4M A;  1GUG A;  2BKD N;  2MAM A;  1PNJ A;  5A0L A;  1CKN B;  1K9M U;  4JV5 L;  1CUK A;  2JN4 A;  2LRQ A;  1NY4 A;  3VS2 A;  1LTS D;  2Z0S A;  5C0X G;  1YHB A;  1PRT B;  4Z9C B;  4CDE C;  4E7S A;  5KYW A;  2NWG A;  1VQ4 T;  5CV9 A;  1VQ9 T;  4B3M L;  3SFM A;  3VV0 A;  1H9R A;  1D09 B;  1C9O A;  1NAP A;  2XG8 D;  3OYD A;  2BH8 A;  2QTX A;  2Z1C A;  3BVM A;  4DNT B;  1SMY C;  1S72 T;  4C3J H;  4DR4 L;  1Q82 C;  2Y0S E;  4JCV E;  3I4N H;  3JCM J;  4HT8 A;  3JSC A;  3I4M B;  1FR3 A;  3T16 A;  1HA6 A;  3VR6 A;  1WHG A;  5I21 A;  4CJ0 B;  4ZAI A;  2K79 A;  4KHV A;  2LDM A;  4KGZ B;  3RES A;  5I11 A;  3NUC A;  1CSQ A;  4ME3 A;  3M4O H;  3QII A;  4QKU A;  3PO3 G;  5HK0 A;  1TSF A;  3R2I A;  5FO8 B;  2DJF C;  1X69 A;  4Q5V A;  2V1R A;  2ZPH B;  4DKA C;  2ROT A;  4EMH A;  3MEV A;  2EY5 A;  1YIJ T;  2AKL A;  2KVQ G;  1CFM A;  3L2P A;  1TWH B;  2RQU A;  1PM3 A;  2X6G A;  1RL2 A;  1MSH A;  3MXN A;  2K04 A;  1ENC A;  2K2V A;  2VY3 A;  4N4G A;  2CT3 A;  2K9G A;  4A4H A;  5LJ3 g;  3CCQ A;  2F0M A;  4B6M A;  4ZK9 B;  1S1N A;  1K8A U;  2UXB Q;  3EGX A;  5M3M G;  1HHV A;  2LMJ A;  1A3T A;  4IAL A;  2CT4 A;  2CP7 A;  2M1H A;  2YXY A;  5I6W A;  5CAI A;  1YIT T;  2NZ1 D;  3DUZ A;  2R58 A;  3DB4 A;  3AT1 B;  5KYW B;  1JQY D;  3K5L A;  3NTI A;  4X64 L;  3ERS X;  4JDS A;  2WIN B;  3ERQ A;  4FF2 A;  4OO1 I;  1X54 A;  4IIM A;  2VL6 A;  4MHE A;  4CDC C;  3K59 A;  2PPB C;  1RAA B;  2HIX A;  4RCC A;  1LTA D;  4CHT B;  2UUC L;  4BY1 B;  3VYU A;  2DLP A;  2QEX Q;  3E9I A;  1CA5 A;  2N88 A;  2JA8 G;  1KNA A;  1QIL A;  1K8M A;  3ER0 A;  1MV0 B;  2YT6 A;  4A93 B;  1UFF A;  3OSV A;  4OMF B;  3CCU A;  3UA7 A;  4N0A C;  5IN1 A;  2FL7 A;  1CK1 A;  4TRD A;  1ML0 D;  4DNI A; 
#chains in the Genus database with same CATH homology
 2I0N A;  2YSQ A;  2A36 A;  2JW4 A;  3JV3 A;  1B3Q A;  1K1Z A;  1ZLM A;  2O9S A;  3PVQ A;  3VRY A;  4ORZ A;  1JU5 C;  1KSW A;  1I07 A;  3EHR A;  3I5R A;  1NEB A;  4OMO A;  1KFZ A;  1ZSG A;  2LQW A;  2DVJ A;  4J9B A;  1V1C A;  1MV3 A;  3SHW A;  3RBB B;  1YP5 A;  4Z8A A;  4E6R A;  2K2M A;  3EGU A;  2SEM A;  1AD5 A;  2L2P A;  2EGA A;  4RTT A;  1ABQ A;  1GCQ A;  1XOV A;  2BZY A;  2KNB B;  1K4U S;  1WDX A;  2ABL A;  2DL4 A;  3VS0 A;  3M0R A;  2EW3 A;  1M3A A;  2D8H A;  2ENM A;  2KRS A;  4J9G A;  1OEB A;  3H41 A;  2DJQ A;  1YN8 A;  1UJY A;  1WXU A;  3LH5 A;  1GBR A;  2H8H A;  4HVU A;  1ARK A;  2ECZ A;  2DRK A;  2OAW A;  2B86 A;  2PTK A;  4LE9 A;  3ZL7 C;  1PHT A;  2DBK A;  3REA B;  3FJ5 A;  1VYU A;  2OJ2 A;  2KXC A;  1X27 A;  4AFS C;  2J05 A;  5GJV B;  1NM7 A;  2XMF A;  2L0A A;  1GCQ C;  1UHC A;  1QKX A;  1M27 C;  2LCS A;  3M0P A;  2GTJ A;  1VYT A;  2KEA A;  4J9F A;  2K7A A;  2KRN A;  3O5Z A;  4JPB W;  2KXD A;  4HVV A;  2JS0 A;  3UAT A;  4LN2 A;  4KRT A;  2NUZ A;  1GRI A;  2KE9 A;  2CUD A;  4J9C A;  2IIM A;  2CH4 W;  1SRL A;  4R0K A;  3THK A;  1SHF A;  3EG2 A;  2YUN A;  3VS5 A;  1GFC A;  3EG0 A;  2LX7 A;  1BU1 A;  2RNA A;  3NMZ C;  1Y0M A;  1UGV A;  1AEY A;  2GQI A;  4RTU A;  1BB9 A;  3PE0 A;  4AG1 C;  4GLM A;  4FSS A;  2F2V A;  4LUD A;  5HCK A;  3NHN A;  2VWF A;  3TSW A;  1IO6 A;  1AZG B;  2A37 A;  2CDT A;  3GBQ A;  4RTX A;  1GL5 A;  3CQT A;  1B07 A;  2FG0 A;  1OPK A;  2AK5 A;  2LZ6 B;  4IIO A;  2X3X D;  3A98 A;  2DYB A;  1K0X A;  2DL7 A;  4Y92 A;  1GBQ A;  3M0S A;  2AZV A;  2MCN A;  3ULR B;  2DA9 A;  2SRC A;  1JQQ A;  4OMP A;  1W1F A;  2EVR A;  3C0C A;  2LJ1 A;  1YNZ A;  2PZ1 A;  1JO8 A;  4F14 A;  4OML A;  2HEQ A;  4HVW A;  2M51 A;  4RTZ A;  1K9A A;  4LNP A;  2ED0 A;  2GNC A;  1WXT A;  1A0N B;  1Y57 A;  2FO0 A;  1NLO C;  1SEM A;  1X6G A;  2MOX A;  2RPN A;  1WYX A;  2O9V A;  2CSI A;  1OOT A;  1J3T A;  4OMM A;  1SRM A;  1ZUU A;  4Z88 A;  1QKW A;  4CC3 A;  2J6K A;  1YWO A;  3IQL A;  2EGC A;  1AWX A;  4RTY A;  1AZE A;  1G83 A;  2DF6 A;  4X1V A;  1UJ0 A;  2DRM A;  4OMQ A;  1RLP C;  2RN8 A;  3R6N A;  2EBP A;  5FW9 A;  2KRM A;  3M0T A;  2EPD A;  2DNU A;  4HXJ A;  4F16 A;  2GGR A;  1WIE A;  1GFD A;  2RF0 A;  1X43 A;  2FPF A;  3I9Q A;  1PWT A;  1I1J A;  3M0Q A;  3QWY A;  4RUG A;  2KYM A;  3KFV A;  2YUO A;  5FWC A;  1E6H A;  1T3S A;  2FPE A;  1TUC A;  1ZBJ A;  4J9E A;  4OMN A;  2E5K A;  1I0C A;  2JMC A;  1KIK A;  2DMO A;  3VS7 A;  2RQT A;  2DL3 A;  3NGP A;  2ROL A;  1SPK A;  2O2O A;  1N5Z A;  1PRM C;  4HCK A;  1BBZ A;  1E6G A;  1VA7 A;  3H0H A;  1M3C A;  2BZ8 A;  1AOJ A;  1WFW A;  1QWF A;  2JM9 A;  1QWE A;  4EIK A;  2P4R A;  1K0S A;  1SHG A;  2DL5 A;  2V1Q A;  4J9D A;  1NYG A;  2C0I A;  2LJ3 A;  2D1X A;  5L23 A;  3H0F A;  2CRE A;  3EG1 A;  2JMA A;  2ESW A;  1H92 A;  1HD3 A;  1TUD A;  2J6F A;  4ZNX A;  2JT4 A;  1FYN A;  2F2X A;  1X6B A;  1NG2 A;  1PRL C;  1HSQ A;  1KJW A;  2AKK A;  2HSP A;  4RTV A;  1AWO A;  1H3H A;  4J9I A;  2C0O A;  4CC4 B;  1AWJ A;  1U5S A;  1JXO A;  2DBM A;  2F2W A;  2FRW A;  1MUZ A;  3PVL A;  1H8K A;  3VS3 A;  2DL8 A;  2K3B A;  1WI7 A;  2JS2 A;  4JZ4 A;  2D0N A;  2W0Z A;  4M4Z A;  2EYX A;  1VYV A;  4D8K A;  1WX6 A;  4DEX A;  3EHQ A;  2FRY A;  3EG3 A;  1JXM A;  1BK2 A;  2EYZ A;  2HCK A;  4J9H A;  4D8D A;  2M0Y A;  5IHK A;  2LNH B;  1G2B A;  5IXB A;  2LQN A;  2EYY A;  1NLP C;  4JJC A;  2J06 A;  2X3W D;  5I22 A;  2FEI A;  1T3L A;  4QT7 A;  2EQI A;  1UHF A;  2YDL A;  2LJ0 A;  1QCF A;  2YUP A;  1WA7 A;  2RMO A;  1YCS B;  2DE0 X;  2NWM A;  1UEC A;  1ZUK A;  1YWP A;  2JTE A;  2VVK A;  1T0J A;  2A28 A;  1WXB A;  2A08 A;  2EKH A;  2KBT A;  1AVZ C;  2DX1 A;  2RQW A;  1M30 A;  4AG2 C;  3RNJ A;  1OPL A;  4A63 B;  4Z89 A;  3QWX X;  1RLQ C;  2KYB A;  1FMK A;  1ABO A;  2LP5 A;  4JJB A;  1AWW A;  2KRO A;  4AFZ C;  2C0T A;  2DM1 A;  2EYW A;  1K76 A;  2JM8 A;  2YUQ A;  1W70 A;  3UA6 A;  1NYF A;  1TG0 A;  1QLY A;  1X2K A;  2RQV A;  4WCI A;  2G6F X;  3M0U A;  2JXB A;  2O88 A;  2GBQ A;  2AZS A;  4F17 A;  3VS1 A;  1UE9 A;  2OI3 A;  2W10 A;  3REB B;  1OV3 A;  2J6O A;  5FWB A;  1HJD A;  1Z9Z A;  1W6X A;  1WLP B;  2PNI A;  5IXF A;  1CSK A;  1UTI A;  1ZUY A;  2CSQ A;  3UF4 A;  2L3S A;  1UG1 A;  1PKS A;  4JJD A;  1UDL A;  5IHN A;  4DEY A;  1PKT A;  5ECA A;  2BZX A;  3VS6 A;  2BTT A;  4LUE A;  1PNJ A;  2MIO A;  3TVT A;  4K11 A;  1NEG A;  3VS2 A;  1SSH A;  2KT1 A;  1M3B A;  4CC2 A;  1CKA A;  2KR3 A;  1UUE A;  3U23 A;  1EFN A;  3VRZ A;  2FPD A;  2KT8 A;  1U3O A;  1GCP A;  1E7O A;  1U06 A;  2K79 A;  2RQR A;  2L3Q A;  4JZ3 A;  5I11 A;  2CUB A;  2D8J A;  5EC7 A;  1T0H A;  1X69 A;  2GTO A;  2KGT A;  2V1R A;  5IH2 A;  2ROT A;  2AKL A;  2CH4 A;  2RQU A;  2EGE A;  1X2Q A;  2CT3 A;  2K9G A;  5IHI A;  4CC7 A;  1S1N A;  1RI9 A;  3I35 A;  3SEM A;  1CKB A;  2LMJ A;  2L3P A;  2CT4 A;  5GJW B;  1LCK A;  1JEG A;  3I5S A;  2J7I A;  2HDA A;  2HBW A;  3TSZ A;  1RUW A;  1Z9Q A;  4RTW A;  2ED1 A;  4IIM A;  4AFU C;  2DLP A;  2DIL A;  3NPF A;  2QDL A;  4ESR A;  2O31 A;  3H0I A;  1MV0 B;  2YT6 A;  1UFF A;  4AFQ C;  1ZX6 A;  3UA7 A;  3VS4 A;  2VKN A;  1M8M A;  2K6D A;  4GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...