1K0XA

Solution structure of melanoma inhibitory activity protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
b'MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Melanoma Derived Growth Regulatory Protein
publication title Solution structure and dynamics of melanoma inhibitory activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0xA00
1V1CA 4R0KA 5FWCA 2G6FX 3A98A 1UTIA 1GL5A 4OMNA 2JS0A 2I0NA 1Z9QA 2J05A 4J9FA 3UF4A 1GFCA 3M0SA 3VS0A 1OPLA 2ROLA 4Z8AA 1JXOA 1X43A 1GFDA 1UUEA 1H92A 4LUDA 1UGVA 2JS2A 1S1NA 2OJ2A 4E6RA 1NLOC 3TSWA 4J9CA 1UDLA 1BK2A 3VRZA 2LMJA 2YDLA 1K1ZA 5GJVB 1M3AA 2KRNA 3REAB 5HCKA 2RQVA 4QT7A 2RN8A 1UFFA 2DNUA 2KR3A 2LP5A 4F17A 2DRKA 3C0CA 2V1QA 2RQTA 1GCQA 3O5ZA 2F2XA 2JW4A 2KYBA 3I5RA 5I11A 2EYYA 1X6GA 2DMOA 1AZGB 1RI9A 2D0NA 2CH4W 4HVWA 2KRMA 1JEGA 1PRLC 3PVLA 4DEXA 2CSQA 2A37A 1QWFA 3M0PA 2DM1A 1VA7A 2PZ1A 2EKHA 2J6FA 2CSIA 3UA6A 2LCSA 2EGAA 3EG1A 2DL5A 2X3XD 3EGUA 4F14A 1TUDA 4D8DA 2O2OA 4RTTA 2C0TA 4J9HA 1SHFA 1KIKA 1TG0A 2JMCA 2RF0A 1U06A 1MV3A 2NUZA 2RMOA 1ZUYA 4HCKA 3SHWA 4J9EA 2EYZA 2KE9A 3H0FA 2LQWA 5ECAA 2KEAA 1WI7A 4GLMA 4OMLA 1UJYA 2FG0A 2ROTA 4OMPA 5IHKA 2BTTA 1PKTA 1RLQC 3VS3A 5FW9A 3I35A 1X6BA 4FSSA 4F16A 4IIOA 1ZBJA 1B07A 1PWTA 2MOXA 1ABOA 4HVVA 3ULRB 1I1JA 2O88A 1NYGA 2KXDA 2RQRA 1T0HA 1AWWA 1X27A 1JO8A 1K76A 2KROA 1X2KA 2LJ3A 3RBBB 1KJWA 2CH4A 1AOJA 1WFWA 2LNHB 1FMKA 1UJ0A 1WX6A 1AVZC 2O31A 1X2QA 2DRMA 2DYBA 2MCNA 2RQWA 1CKAA 1QCFA 2KBTA 1QWEA 2DILA 2K79A 3CQTA 2RNAA 1NLPC 1WXTA 4HVUA 2LZ6B 1NM7A 4A63B 2DBKA 1UECA 1OV3A 2HEQA 1KFZA 1VYVA 2KYMA 1YNZA 2BZXA 2MIOA 3SEMA 2YUNA 1IO6A 2KRSA 2GNCA 2HBWA 4LNPA 5IXBA 2CDTA 4ZNXA 3EHQA 2LQNA 3ZL7C 4LUEA 1QKXA 3EG2A 1U5SA 2EQIA 2JM8A 4CC7A 4AFSC 2ED1A 5L23A 1NG2A 1AWJA 4Z89A 2EVRA 2ENMA 2JXBA 2ABLA 1WXBA 1PKSA 5GJWB 2EBPA 5IHIA 2W0ZA 4Y92A 1GBQA 2ECZA 3PE0A 4EIKA 1E7OA 2YSQA 2D8JA 2HDAA 1PNJA 2J6OA 2CREA 2K9GA 3LH5A 1ZUKA 5FWBA 2XMFA 3QWXX 2JM9A 2IIMA 1AEYA 1H8KA 1RLPC 1M3CA 2EYWA 1QKWA 1BB9A 1WXUA 2J6KA 2X3WD 1WYXA 2L2PA 1HJDA 4RUGA 1W70A 4J9IA 2L3SA 2H8HA 1VYTA 3VS4A 4LE9A 1GBRA 4JJDA 2FPDA 2VVKA 3I9QA 1W1FA 2PNIA 2OAWA 2K2MA 4D8KA 2DX1A 3REBB 2K6DA 2JT4A 3FJ5A 4GBQA 1M3BA 2AKLA 4WCIA 2PTKA 1SPKA 4KRTA 4AFZC 2FEIA 3M0QA 1YCSB 4JJBA 5IHNA 4ORZA 1AWOA 4LN2A 2SEMA 3IQLA 1K0XA 1BBZA 1Z9ZA 2L3PA 2O9VA 2CT3A 4JZ4A 2FRYA 2A28A 1WIEA 2B86A 1QLYA 1I07A 2GQIA 2ED0A 2KNBB 3NGPA 4RTZA 3TSZA 1M30A 1NEGA 2DL3A 1NEBA 4IIMA 4ESRA 3UA7A 1PHTA 2O9SA 2YUQA 2EYXA 2A36A 2HSPA 2DA9A 1E6HA 2YT6A 2DL4A 3H41A 2RPNA 1H3HA 2DVJA 1K4US 5IXFA 2DLPA 1SHGA 3NMZC 2A08A 1T3LA 2C0OA 1YWPA 2J06A 1GCQC 2AZSA 4RTWA 1Y0MA 1M27C 1WLPB 1ZLMA 1UHFA 2D1XA 1YN8A 4JZ3A 2KT8A 2FRWA 4OMOA 2L3QA 5IH2A 4K11A 4AFUC 3VRYA 2GTJA 3VS6A 2JMAA 4OMMA 1G83A 2DE0X 1SSHA 4JPBW 2EGCA 2EW3A 1Y57A 1OOTA 2YUPA 3H0HA 1YWOA 2CT4A 3M0TA 3NHNA 3TVTA 1MUZA 1B3QA 1OEBA 4OMQA 2C0IA 2M0YA 3VS7A 1HSQA 2BZYA 1KSWA 2LJ1A 2K7AA 1E6GA 2KGTA 2FO0A 1X69A 1SEMA 2BZ8A 2P4RA 2DBMA 2RQUA 1T0JA 1JXMA 1AD5A 2LX7A 1ARKA 2DL8A 2GGRA 1WA7A 1K0SA 2HCKA 1CKBA 4CC3A 2CUBA 1ABQA 2K3BA 4J9GA 1AZEA 2DL7A 1J3TA 4CC4B 4DEYA 4AG2C 1T3SA 1ZUUA 2DF6A 1UG1A 3U23A 2F2VA 4RTUA 1UHCA 3THKA 3M0RA 4JJCA 1K9AA 1TUCA 3NPFA 4RTYA 1G2BA 1RUWA 2F2WA 2V1RA 2E5KA 1MV0B 3EHRA 1U3OA 1BU1A 4Z88A 1GRIA 5EC7A 1HD3A 2FPEA 3JV3A 2EGEA 4AFQC 4M4ZA 1PRMC 3M0UA 4CC2A 1EFNA 1SRMA 2AZVA 1A0NB 4RTXA 3KFVA 2KXCA 2QDLA 1WDXA 2AKKA 3EG3A 3RNJA 2DJQA 4J9DA 1YP5A 4J9BA 3QWYA 2LJ0A 2W10A 2AK5A 2VKNA 1JU5C 2SRCA 1UE9A 4HXJA 3R6NA 1NYFA 1OPKA 2GBQA 2KT1A 3GBQA 1ZSGA 1VYUA 3VS5A 1I0CA 2NWMA 2EPDA 5I22A 2GTOA 3VS2A 1XOVA 3VS1A 3PVQA 2J7IA 2JTEA 1JQQA 1FYNA 4RTVA 2M51A 1N5ZA 2CUDA 1SRLA 1LCKA 4X1VA 4AG1C 1GCPA 1AWXA 3EG0A 3UATA 1M8MA 2L0AA 3H0IA 2YUOA 1W6XA 2VWFA 1CSKA 2ESWA 2OI3A 2FPFA 1ZX6A 3I5SA 2D8HA
chains in the Genus database with same CATH superfamily
2RK1A 4IUTA 1UTIA 1Q86R 3CCRT 2XK0A 3CCET 3G6ET 2KVQG 3G4SA 1WHJA 3X28B 1BI1A 3META 1VQ9A 1XNIA 2CZ7B 2DEUA 5GAN6 1N8RR 1I5OB 2DTIA 3RKYA 4P5NA 1UB4A 1XQHA 4LUDA 2JS2A 3CCMQ 2OJ2A 1K8AC 3BDUA 4E6RA 1M9SA 6AT1B 3TSWA 4PLLA 4J9CA 4M7AF 1WHMA 4NL3A 1UDLA 3FLGA 1VOMA 1M3AA 3M55A 1M2OA 2DKGA 2NUTA 5HCKA 2RO0A 1VQ5Q 3JCMW 2RN8A 4F17A 2QK0A 1WPYA 4ZN1A 2KYBA 3BY7A 1YI2A 1VQ4A 1JRIA 3LW5E 1YIJQ 1X6GA 5GAN8 2DMOA 1AZGB 4BB7A 2LTOA 1RI9A 2D0QB 2D0NA 4HVWA 1JEGA 1VIFA 1QWFA 2LX9A 2DM1A 5D6WA 4E7KA 1Q82U 1YJ9A 1KQ2A 3HKSA 1IB8A 3EGUA 3L2RA 4V2SA 2RM4A 2CP0A 2C0TA 2PU9B 2E64A 1NE8A 3QIIA 2JMCA 1U06A 1VQPQ 1RL2A 4C8QF 4A4FA 4PJOF 1M1KC 1YJNQ 2KE9A 4J7IA 1W4SA 2X4YA 1WI7A 2KQWA 4GLMA 4J7FA 4OMLA 2ROTA 2BTTA 2YXYA 3C94A 1K73R 1PKTA 2NUPA 5FW9A 4OP0A 2DFUA 1KQ1A 1PWTA 1KC8C 3EAEA 3A8HB 4F7UA 3QHSA 2CP5A 2EQMA 3DLLA 1NYGA 2KXDA 2RQRA 2HBPA 1TWBA 4OB2B 1KJWA 4M7DG 2EQUA 1OYXA 2LNHB 1QVFA 1AVZC 1LVKA 2O31A 1HYOA 2DRMA 3C95A 2O01E 3OYLA 3CCJQ 2DILA 4N4IA 3M57A 2RNAA 3G4SQ 1PCXA 5J39A 4OGCA 4F7UB 4F04B 1ZSZB 2JN0A 2K5IA 1NM7A 2LZ6B 3A5ZB 2AHJB 4UC4A 4MZMA 4IKFA 3OY9A 1IHWA 3SEMA 2YUNA 1K8AR 1VIEA 1N6AA 2CKKA 4QQGA 3EFRA 4LNPA 4ZNXA 3CCRA 3CCEA 3V8KA 1BIAA 3GLXA 4XU0A 3ZL7C 1BYMA 2CP6A 2ED1A 2FZCB 1NG2A 4MMLA 2ABLA 1WXBA 1PKSA 3OYDA 2COZA 5IHIA 2W0ZA 2LT1A 4XU3A 1YI2Q 1VQ4Q 1IHVA 1GBQA 4DBFA 2L8DA 1VQKQ 2XI9A 1K9MU 1XJWB 4ZTFA 4L5GA 4XTWA 2NLUA 1RI0A 3PNWC 3QWXX 1NPRA 2VV5A 2IIMA 1M3CA 2J6KA 3SWNA 1W70A 4A54A 3ZBDA 1M90C 1M90U 2H8HA 2DEQA 4PFPA 1GXIE 2ZGWA 2QYZA 5LJ3f 3I55Q 1TOVA 4O5VA 1M1KR 2Y4XA 4N0AC 2DPPB 5KYNA 3D7SB 4D8KA 2V8IA 5DY9A 3SWNB 1FMWA 2E1HA 4HA8A 5CKBA 2AKLA 4FYWB 4M77G 5J3BA 4PL6A 5GAOq 1KC8R 3M53A 3GNFB 4FIBA 3TEEA 1MNEA 1BI2A 4KRTA 1YHQA 1N27A 3MP8A 2JTFA 4BI8B 5GAMj 2CYZB 4EDUA 4M75B 5GAOl 1UGPB 3S3OA 2DZCA 4F7UF 2FZGB 1Z9ZA 1RABB 2O9VA 4BE0A 2A28A 1WIEA 3EGXA 1U8RA 3CD6T 3ER0A 2LQKA 1B7TA 1NEGA 2DL3A 3OYKA 2E6ZA 5LJ3h 3JCMc 5A0GA 3R6OA 2RJDA 4RMOA 2EYXA 4JS4A 2A36A 2PUKB 3CC7T 3UT1A 1I4K1 2RPNA 1ACMB 2DLPA 3V7SA 3NMZC 1T3LA 2C0OA 1YWPA 2J06A 2M1HA 1YN8A 2FRWA 4FSXA 2DXTA 3EFOA 4N4HA 4AFUC 3CCMT 1VQ8A 1D0XA 1ZA1B 2FVUA 2JMAA 5GANe 4E7SA 3CPWS 4JPBW 3UDCA 1Y57A 2COWA 2DIGA 2YUPA 3PFSA 1VQ5T 4C0DB 1H3ZA 1MUZA 1B3QA 2C0IA 4KT0E 3VS7A 1HSQA 2P0KA 1VQNQ 3RR6A 4M78G 4M77C 1X69A 1YIJT 3QJYA 4KGVB 2R5MA 4IUUA 2DBMA 3VU3C 5FU7C 5CAIA 2OX7A 1ARKA 3J7AF 2A3LA 2GGRA 3JSCA 5GAN5 9ATCB 4A4GA 2OTLQ 4J9GA 4C8QC 2LT4A 1LJOA 1MNDA 3QBYA 3HHTB 1WNLA 1K9AA 3A8OB 3NPFA 2HL5C 4M75F 1D3BB 1YHQQ 1HD3A 3L2QA 1EX4A 2M9UA 2BIVA 1PRMC 1D09B 3M0UA 1WJQA 3ME9A 1YJNT 1IGQA 1Y07A 3CCSA 2AKKA 3EG3A 3RNJA 4NL2A 2CZ0B 5LJ5e 4J9DA 5AYFA 2HL3A 2LJ0A 2VKNA 4BI3A 2SRCA 1UE9A 3JCMf 2KT1A 3TREA 2KY9A 1I0CA 4N0AA 2EPDA 3H8ZA 5I22A 3VS2A 3HL8A 4XTUA 1RAEB 1VQLQ 2XG8D 5IN1A 4M7DA 1FYNA 4RTVA 4BE2A 1SRLA 1LCKA 4X1VA 5I2MA 4A53A 3GF5A 3CD6A 5KE3A 3G71Q 1X75C 3M4GA 3PIOA 3CMEQ 3CCJT 1QVGS 1B34A 2OI3A 3G4ST 1G5VA 3BFMA 5FWCA 1VQ9T 3A98A 4M7AD 4ZTJA 1GL5A 4OMNA 5GAMe 4Q5WA 2JS0A 3OS1A 4M7DB 3E2UA 4RCCA 4JJNK 1VQ8Q 3CPFA 4J9FA 3BE3A 3RMSA 3M0SA 1SF9A 1JXOA 3JAME 1X43A 2RHYA 3MEWA 1H92A 1S1NA 1TSFA 2LRQA 4C92G 5GAN2 1NLOC 3OSVA 2RI3A 1M8VA 5DLQE 3CCMA 3JCMh 3VRZA 3CCUA 5GJVB 2EYQA 1YI2T 1VQ4T 1MMAA 4J6XA 3REAB 4QT7A 3V8LA 1RACB 5IAYA 2KR3A 1VQKT 2DRKA 2V1QA 2RHZA 1KQSS 4OGEA 3I5RA 5I11A 2EYYA 3FDRA 2ZCFB 3INZA 2CH4W 2KRMA 2HZYA 5HK3A 3OMGA 4M7AE 1PRLC 4DEXA 5GANd 1M2VA 2A37A 4PJOD 3M0PA 4HCBA 4QVZA 2J6FA 5GMKh 2CSIA 2YWWA 1C0MA 1WQWA 2DK3A 3CBPA 4LDXA 2EGAA 2VASA 2H3EB 2DL5A 3JB9H 4Z02A 2X3XD 4F14A 2WSEE 3I55T 3EH2A 1QCOA 2MI6A 3JB9G 4RTTA 4J9HA 3LH0A 1VQMA 2HD0A 1KD1R 2EQJA 4B9XA 4II1A 2NUZA 2RMOA 4HCKA 4M77A 4E2FB 4J9EA 5D6YA 1IXDA 1VQPA 4FW1A 2CGHA 5ECAA 2A0FB 5GAMg 1YJNA 1RLQC 3VS3A 3CXCP 3A8MB 2ZPGB 4F16A 2P4TA 2H3JA 2QGGA 4IIOA 3CCQQ 3OW2P 1Q7YC 4HVVA 3ULRB 2DVEA 4XQ3A 3ASKA 1T0HA 1JO8A 4J8OA 3RBBB 1AOJA 2K5LA 4OMFB 2PQWA 4JUVA 5LJ5d 2DYBA 2RQWA 4BDYA 1K73U 2KBTA 4QVDA 2K79A 1D1BA 3CQTA 1G3YA 1JJ2P 1ZBXA 3OS5A 2ZPFB 2QGFB 1WXTA 1PG5B 3CCJA 2X4JA 4HVUA 5FU6C 4A63B 1UECA 4J5YA 1OV3A 5CIUA 2BZXA 4LDYA 1IO6A 4E7HA 3V8JA 4EPCA 5IXBA 1RAHB 2CDTA 3PMIA 4B9WA 4BY6C 4X9CA 2M16A 3GNGA 3CCUQ 5AT1B 3EG2A 5L8RE 5D7UA 2ZPBB 4CC7A 5KCOA 5GAOm 2JXBA 5GJWB 2EBPA 1W2BA 5GAMd 3OYJA 3M9QA 2LQ8A 3NTKA 3PE0A 4EIKA 5KYWA 2D8JA 1I5LA 2HDAA 1PNJA 2J6OA 2CREA 1QQJA 1OX9A 5HK0A 3NFCA 4RKUE 5FWBA 2XMFA 4X34A 2JM9A 4M78A 2Y90A 1H8KA 1VQKA 1VQNT 1OZ3A 4PJMA 2QG9B 1QKWA 1WXUA 1HJDA 1Q82C 2NUTB 5C0MA 3OS2A 2DETA 4LE9A 1VQMQ 2OTLT 5KYWB 2LC4A 1P92A 1WJSA 2R57A 3RUXA 2MK5A 1QVFS 4M78B 2FHDA 2PNIA 3I55A 2OAWA 5GAN3 2VC8A 2DZ9A 1YHQT 2WSFE 2JT4A 4WTOB 2QQRA 2HQXA 2QQAA 2GFAA 2IPOB 4E7JA 2FL7A 2PTKA 2QTVA 4ELZC 4DBQA 1Q7YR 3TCJA 3VYHB 3M0QA 1AT1B 3QG1A 4JLIA 4X9DA 1Q81R 3WVDB 1C6VX 2K2VA 1QP3A 2SEMA 3IQLA 3JB9J 5GAN4 2YRVA 1BCOA 1DJ7B 3RDVA 4JS5A 4JZ4A 4BACA 3MP1A 5CVIA 5LL6S 1VQLT 4YTLA 2NUPB 3QO3A 1QLYA 1I07A 2QASA 5GANj 3HTRA 3TSZA 1M30A 5C6SA 2OAUA 1NEBA 4IIMA 2A7YA 1O75A 4ESRA 3UA7A 1PHTA 4PJJA 3G71T 2JNGA 2YRDA 2YUQA 3CMET 3LWHA 4F7UE 2DA9A 3FC3A 2DL4A 4HKEA 1H3HA 4FYVB 3CBMA 2G3RA 3E19A 3CXCA 2A08A 2P0QA 1GCQC 3V7CA 1VQ8T 3SD4A 1WLPB 1UHFA 4JZ3A 2DERA 2AIRB 3OW2A 3QSUA 2L3QA 1WHHA 3VRYA 4C92A 2B8AA 3MEAA 2OTJQ 3OYAA 3VS6A 3GOXA 1MMDA 1SSHA 1R77A 1K9MC 2EW3A 5KCHA 2X4WA 1RAAB 4ZN3A 1JJ2A 3M5AA 1YWOA 4DOWA 3OA6A 4OMQA 3A8LB 2QAZA 2LJ1A 3P8HA 3PIPA 2KGTA 4M75D 4C92B 1SEMA 5LJ5j 2P4RA 4JRPA 1VQNA 3A1PA 4MDWA 1T0JA 3JCMP 1K0SA 2QA4Q 1CKBA 5GAOn 1ABQA 5HY6A 4QKUA 2HQHA 2DF6A 2KDSA 2EAYA 2CP7A 4RTUA 3PTAA 2OTLA 2M0OA 1WQ7A 2CZ6B 4RTYA 5KE2A 3MP6A 3QJ6A 1FMVA 4LD9K 3CCST 1BU1A 1WGSA 3I56Q 2EGEA 5CKHA 4M4ZA 3TU4K 4CC2A 2AZVA 3VUZA 4RTXA 2KXCA 4C8QG 2E41A 4PJOG 5DLOA 4FCYA 1LOJA 3QXEB 4JRIA 1UGSB 4J9BA 3QWYA 2E12A 4M75E 2AK5A 1JU5C 1NYFA 1OPKA 1WHGA 2GBQA 5CKDA 3VS5A 1VYUA 3CCQT 2NWMA 2RHUA 1EZZB 1KHIA 2EFIA 5A2QE 3PVQA 2J7IA 1JQQA 2Z0WA 2WACA 4O6JA 4C5EA 3S3NA 1VQLA 3OS0A 3UATA 4E7ZA 4A4EA 3OQ5A 1CSKA 3J81E 3LGFA 3I5SA 4LDUA 2D8HA 1V1CA 2X9HA 4R0KA 4M7AC 3G71A 3JCMJ 3CMEA 2E65A 3EGXB 2I0NA 1Z9QA 3JRZA 1SSFA 1QW1A 2J05A 3UF4A 2D9TA 3QUIA 3G6EQ 4MDXA 3CCUT 2HNIA 1GFDA 1K9MR 2BKDN 3LYIA 3OYGA 4C92F 3PGGA 3RKWA 4VUBA 3C4SA 4ZGDB 3QPHA 2LMJA 2YDLA 2K3YA 4EMKC 4J6WA 2RQVA 1M90R 2RH2A 3DKMA 3HFNA 3EFOB 4ANJA 1UFFA 2LP5A 5IT9E 1MHNA 1GCQA 2RQTA 2F2XA 2VB6A 2HAXA 4Y28E 3H6ZA 5DM7R 1M1GA 3CMAQ 3PVLA 3Q1JA 2PUOB 4PJOC 2M02A 4FW2A 4B6MA 3UA6A 1UGQB 1U1SA 1VQMT 4HT9A 3CCLA 4HT8A 4XTZA 1FWZA 4MZPA 4CRIA 4IUVA 4D8DA 3H9NA 4PFZA 1BCMA 2R5AA 3BW1A 3P8DA 1SHFA 1VQPT 3OB9A 5GANf 1OZ2A 1TG0A 2I2LA 4JRKA 2VXFA 1ZUYA 3SHWA 4IURA 1VQ7Q 2HKQB 1NJIU 4M7DD 2MAMA 3H0FA 2LQWA 2QI2A 2E70A 4XTXA 2KEAA 3ZFJA 1UJYA 1Y96A 3HRUA 5IHKA 3GPLA 4ELYC 1YJWA 5GMKe 2EQKA 2K57A 3VYGA 1MGQA 1B07A 2MOXA 1OU9A 3URGA 3L42A 1KD1U 1YFNA 2XU8A 2DXCA 2DO3A 1BI3A 2RJCA 3CCQA 1K76A 2KROA 5GANg 2LJ3A 4A4KA 2L5QA 1FMKA 1WX6A 2MF2A 1CKAA 1QCFA 3X26B 1AHJB 2F69A 2IG0A 4BE1A 3CC4Q 2E10A 2E3IA 2JUFA 4BDZA 3L2VA 1TUGB 2DBKA 4M7DE 1NZ9A 2HEQA 2QQBA 1VYVA 1YNZA 5LJ5f 3QKJA 3UPUA 1D0ZA 3J80E 5HKCA 1B34B 2ZPIB 1U5SA 3OYNA 2JM8A 3CCVA 4AFSC 1VUBA 2ENMA 2PVGB 1IZ6A 1Q86U 2OTJT 4AMCA 2COYA 3A8GB 3M59A 5GMKl 2ECZA 1E7OA 2YLBA 2YSQA 1X01A 1N8RU 3VUBA 2RI5A 3LH5A 5FRMA 1ZUKA 4J6YA 2L89A 5LJ5g 5KYYA 1AEYA 2EYWA 3FIFA 5GAMf 2X3WD 1WYXA 2GQVA 2QQ9A 2L2PA 4LXCA 3CCLQ 1YITQ 1MMNA 1VQ6Q 3LLRA 4J9IA 3HFOA 3OYYA 4XTYA 3VS4A 2QA4T 4EMKA 1KG1A 4E7IA 2FPDA 3I9QA 5KYYB 2D6FA 1MMGA 1M2VB 1SKUB 4DBRA 1YJWQ 2K6DA 3FJ5A 1ZSZC 3CC2Q 3I56T 1M3BA 4LDVA 4M75G 3UWNA 3FJPA 1Y7XA 4WCIA 3JCMQ 2X35A 5KYXA 3OYMA 4C8QA 4PJOA 4FT2A 5FROA 2FEIA 1TU0B 3LWIA 1YCSB 3S6WA 2KSSA 3EGDA 4M77B 3OYHA 4LN2A 1K0XA 4M7DF 1UGRB 4C0GA 5FU7B 1BBZA 4M77E 2MYSA 1HK9A 2L3PA 5GAMh 2ZPHB 2DYIA 4PJNA 3O8VA 2E5QA 4C8QB 5LJ3j 2B86A 1W2BS 1K73C 4PLIA 2KNBB 2HMAA 2XDDA 3MPUB 2HKNA 2KMTA 4FL6A 1YCYA 4FM4B 3CBOA 4C5IA 3EGDB 1E6HA 2VGMA 2DVJA 1K4US 5IXFA 1SHGA 3FEOA 2RD1A 5CQXA 2XDBA 3CCVQ 5FLXE 3HSBA 2AZSA 1VQOA 1Y0MA 4PK4A 3G7ZA 1M27C 4QVCA 2KT8A 2QTXA 1D1AA 4XU1A 3EG9A 4M78D 4OMOA 3KBGA 5IH2A 2QEXA 3SWNC 1OU8A 2HQEA 3MHXA 5KH6A 1KK7A 4A4HA 1K8AU 1R0CB 2EGCA 2C06A 1M5Q1 2BE7D 2OTJA 1WHLA 2IVWA 3L1AA 1N9RA 1X6OA 2CT4A 2MWOA 1OQKA 3NHNA 3TVTA 1OEBA 2M0YA 2LCLA 2CS7A 3EG9B 1R0BG 1KSWA 2XD0A 4M75C 4HCCA 3FRNA 3E9GA 3CMAT 2RQUA 2LDMA 3SB2A 3RESA 2DL8A 3V7RA 4KGZB 4CC3A 2CUBA 1BI0A 2K3BA 1AZEA 2DL7A 1FXXA 3HRTA 4CC4B 4DEYA 4XAXB 1ZUUA 2QA4A 3E9FA 1I8FA 1S72A 1UG1A 2F2VA 2LCCA 4KH1B 4DBHA 3L2WA 4M78E 1RADB 4JJCA 1TUCA 1TH7A 1RUWA 5M9OA 4M77F 1RAIB 2F2WA 2V1RA 1IGUA 2E5KA 2YLCA 3EHRA 1U3OA 4AFQC 2LVMA 2RJEA 3QDFA 4R55A 1C1AA 5A0LA 2QQSA 1VQ7T 1EFNA 3KFVA 3I56A 4BI4A 4MZTA 3CXCS 1WDXA 1M1KU 2K3XA 2DJQA 4DA4A 2W10A 3OW2S 4HXJA 2DD5A 2DXBA 3QYGB 2JOYA 1XOVA 1KC8U 1YBYA 1ZSZA 2M51A 2CUDA 2XKOC 4LD6A 1BKBA 4C0DC 1D1CA 3MJXA 4AG1C 1GCPA 1AWXA 1OULA 3EG0A 4FU6A 3QZ5B 1M8MA 1JJ2S 3H0IA 2PVDB 2VWFA 2VGNA 2ZZDA 1VQOQ 4C5GA 3CC4T 2FPFA 4C92D 3OBYA 2G6FX 4OVAA 4PJLA 1VQ9Q 3AHUA 2QEXQ 3X25B 2DD4A 2EIFA 1M1FA 1GFCA 2ATCB 3VS0A 3MKDA 1OPLA 2ROLA 4Z8AA 4JRQA 4KULA 5LJ3e 1UUEA 1UGVA 2MPXC 3G6EA 3E1SA 2R58A 2RHIA 2WSCE 1G8XA 4M7AG 2V8JA 1BK2A 1K1ZA 1Q82R 4AT1B 3T9NA 2KRNA 5CO7A 1LPLA 3M58A 2EWNA 3CPWP 4C0ZA 2EJFA 4M78F 2YHTA 2DNUA 3C0CA 2E3HA 4KGXB 3O5ZA 2JW4A 3JB9D 4ZGEB 4C92E 5GMKj 1S72Q 4RG2A 3CCLT 1YJ9Q 1YITT 2CSQA 1VQ6T 5FU6B 4C0FA 1VA7A 3CMAA 2PZ1A 2EKHA 3OYFA 2LCSA 3OYCA 1BIBA 3L2ZA 4Y91A 3OSSC 2RHXA 3EG1A 4BY6B 1O9SA 3MEVA 1TUDA 2V8KA 2O2OA 3OMCA 5CR2A 1EIFA 2DAQA 3N5BB 1KIKA 2FZKB 2L3RA 2P0PA 2CP2A 2YRCA 3CEYA 1KHCA 2RF0A 1MV3A 1YJWT 4ZGJB 2O4XA 4M75A 3CC2T 3WXMB 3QYHB 1UEBA 4RG8A 4M7DC 2EYZA 1R8OB 3FB9A 3SFMA 5GMKm 5D6XA 4PNOA 2EJ9A 2FG0A 3PT9A 4OMPA 1VQ7A 1I81A 3I35A 1X6BA 4FSSA 4KBMB 3RIRA 1ZBJA 2MWPA 2JTMA 1TS9A 1ABOA 1I1JA 2O88A 1H641 1ZQ1A 2O4XB 2JVVA 5LJ3g 1AWWA 1X27A 1FX7A 2K4YA 1X2KA 4NOYA 4OB1B 4D6WA 1QVPA 2CH4A 1WFWA 2F5TX 2GFUA 1UJ0A 3HP9A 1X2QA 4FYXB 3LX7A 1PD0A 2KAFA 2MCNA 1OI1A 4PFOA 1QWEA 2XDPA 1TTHB 3S3MA 1NLPC 2E6NA 1QVGP 4EMGA 3MEUA 4BD3A 3PMTA 3CC4A 1PD1A 5GMKi 5A0DA 3CCRQ 1Y71A 2ZPEB 3CCEQ 1KFZA 2KYMA 3NTHA 2MIOA 1WZOA 2QXFA 3CCVT 2KRSA 5GAOp 2GNCA 2HBWA 3EHQA 2LQNA 5GAOr 4LUEA 1QKXA 2DXUA 3DLMA 2EQIA 1ZA2B 2EJGA 5L23A 4Z89A 1AWJA 2EVRA 3OYEA 1LNXA 5FRNA 3G1JA 4Y92A 2X51A 8ATCB 1QMCA 2HSEB 4IUPA 1N9SA 3MO8A 4RCBA 2QDYB 4R56A 2JJ9A 5EG2A 1NPPA 4FT4A 2K9GA 5CK9A 2Y4YA 3VJPA 3KXTA 5LJ3d 4BUGA 3ZEHA 1KQSP 1RLPC 3M54A 4QW2A 4QQ6A 1BB9A 3JCMV 1ZHIA 1WHKA 1M4ZA 4RUGA 1QP2A 1IREB 2L3SA 3JCMe 2KI7A 2MMPA 5CKEA 1D3BA 1VYTA 1YITA 1QCNA 1VQ6A 2BE9B 1GBRA 3RKXA 4JJDA 3JB9F 4XK8E 2XIDA 8AT1B 2VVKA 4EMHA 1W1FA 3JB9I 4HCZA 2K2MA 3VV0A 2DX1A 3REBB 1U1TA 1RAGB 1NJIC 2EKOA 3L2UA 3CPWA 1XTDA 4GBQA 4C5HA 1NBEB 2GF7A 1TXQA 4NS5A 2RJFA 4L6V5 2DTHA 2BUDA 2RB6A 3CC2A 4DOVA 2DTOA 1SPKA 4KH0B 4AFZC 4JJBA 4N4GA 2DIQA 1KD1C 5IHNA 4ORZA 1AWOA 3JCMb 2XHCA 4OB0B 3WVEB 3EH1A 4F7UG 3AT1B 2RK2A 2P84A 2CT3A 1Y96B 1G3WA 2FRYA 1PM3A 4ATOA 2GQIA 5GAN7 2ED0A 4WF2A 3GP8A 3OYBA 3MCAB 3NGPA 3OBWA 4RTZA 1PC0A 4J83A 1IRXA 4QQDA 1W2BP 2F1LA 7AT1B 2O9SA 5GANh 4GY5A 2HSPA 1VQOT 2YT6A 1OX8A 3H41A 3M4YA 1WJRA 5KYUA 4DQ2A 1V76A 2QEXT 3CC7A 4RTWA 3HRSA 1D0YA 1ZLMA 2D1XA 3JCMg 1RAFB 4KUIA 3P8BB 4M78C 4OB3B 4K11A 1F1BB 1Q86C 1G3SA 3DB4A 3NTIA 1HXDA 2GTJA 3LGLA 2K5FA 4M7AA 3RMQA 5KYUB 4OMMA 3VKIA 1G83A 2DE0X 2FYKA 1N8RC 2E4HA 3EFSA 4IUQA 3JCMX 1OOTA 3H0HA 2V26A 4E47A 1JBMA 3M0TA 3OYIA 4L59A 2F5KA 3HPWA 1QVGA 3QZ9B 2NYSA 2BZYA 5CKFA 3F70A 2K7AA 1E6GA 2FO0A 2BZ8A 4M77D 1VQ5A 2DJZA 1S72T 4M7AB 4OF1A 4E7LA 1JXMA 1AD5A 1YJ9T 2LX7A 1WA7A 3X24B 2HCKA 3KUFA 1Q95G 4JLGA 5LJ5h 1J3TA 4C8QD 1YIJA 2KK4A 4XU2A 4AG2C 1T3SA 1NJIR 2RI2A 3U23A 1SG5A 2CP3A 2LNVA 4CI0C 1UHCA 4PKCC 3THKA 3M0RA 5CQYA 1QVFP 1G2BA 1PSFA 2RA2A 3X20B 1MV0B 2PVOB 3TQ7P 4Z88A 1GRIA 4LDWA 5EC7A 2X4XA 4MMKA 1JB0E 2FPEA 3JV3A 3JCMd 3M56A 3CCSQ 3GIBA 1G3TA 2AT1B 4EMKB 1SRMA 1A0NB 1V29B 2VXEA 2QDLA 4FYYB 3SDZA 1KQSA 3BDLA 4ME7A 2VUBA 2XICA 4KUDK 2FB7A 1YP5A 3DB3A 2VYTA 5CCAA 4TVRA 3R6NA 5I21A 3GBQA 1ZSGA 3C12A 3QDRB 5KYXB 2CZ1B 2GTOA 4PJOB 1PSEA 3VS1A 5I2SA 1Q7YU 2JTEA 4C8QE 2ZAEA 3RERA 5J26A 4PJOE 1N5ZA 3CD6Q 4GLKA 2GCXA 4XTVA 1Q81C 1Q81U 4JDSA 2JZ2A 2L0AA 2YUOA 1W6XA 3CC7Q 4C92C 2ESWA 1ZX6A
chains in the Genus database with same CATH topology
1V1CA 4R0KA 5FWCA 2G6FX 3A98A 1UTIA 1GL5A 4OMNA 2JS0A 2I0NA 1Z9QA 2J05A 4J9FA 3UF4A 1GFCA 3M0SA 3VS0A 1OPLA 2ROLA 4Z8AA 1JXOA 1X43A 1GFDA 1UUEA 1H92A 4LUDA 1UGVA 2JS2A 1S1NA 2OJ2A 4E6RA 1NLOC 3TSWA 4J9CA 1UDLA 1BK2A 3VRZA 2LMJA 2YDLA 1K1ZA 5GJVB 1M3AA 2KRNA 3REAB 5HCKA 2RQVA 4QT7A 2RN8A 1UFFA 2DNUA 2KR3A 2LP5A 4F17A 2DRKA 3C0CA 2V1QA 2RQTA 1GCQA 3O5ZA 2F2XA 2JW4A 2KYBA 3I5RA 5I11A 2EYYA 1X6GA 2DMOA 1AZGB 1RI9A 2D0NA 2CH4W 4HVWA 2KRMA 1JEGA 1PRLC 3PVLA 4DEXA 2CSQA 2A37A 1QWFA 3M0PA 2DM1A 1VA7A 2PZ1A 2EKHA 2J6FA 2CSIA 3UA6A 2LCSA 2EGAA 3EG1A 2DL5A 2X3XD 3EGUA 4F14A 1TUDA 4D8DA 2O2OA 4RTTA 2C0TA 4J9HA 1SHFA 1KIKA 1TG0A 2JMCA 2RF0A 1U06A 1MV3A 2NUZA 2RMOA 1ZUYA 4HCKA 3SHWA 4J9EA 2EYZA 2KE9A 3H0FA 2LQWA 5ECAA 2KEAA 1WI7A 4GLMA 4OMLA 1UJYA 2FG0A 2ROTA 4OMPA 5IHKA 2BTTA 1PKTA 1RLQC 3VS3A 5FW9A 3I35A 1X6BA 4FSSA 4F16A 4IIOA 1ZBJA 1B07A 1PWTA 2MOXA 1ABOA 4HVVA 3ULRB 1I1JA 2O88A 1NYGA 2KXDA 2RQRA 1T0HA 1AWWA 1X27A 1JO8A 1K76A 2KROA 1X2KA 2LJ3A 3RBBB 1KJWA 2CH4A 1AOJA 1WFWA 2LNHB 1FMKA 1UJ0A 1WX6A 1AVZC 2O31A 1X2QA 2DRMA 2DYBA 2MCNA 2RQWA 1CKAA 1QCFA 2KBTA 1QWEA 2DILA 2K79A 3CQTA 2RNAA 1NLPC 1WXTA 4HVUA 2LZ6B 1NM7A 4A63B 2DBKA 1UECA 1OV3A 2HEQA 1KFZA 1VYVA 2KYMA 1YNZA 2BZXA 2MIOA 3SEMA 2YUNA 1IO6A 2KRSA 2GNCA 2HBWA 4LNPA 5IXBA 2CDTA 4ZNXA 3EHQA 2LQNA 3ZL7C 4LUEA 1QKXA 3EG2A 1U5SA 2EQIA 2JM8A 4CC7A 4AFSC 2ED1A 5L23A 1NG2A 1AWJA 4Z89A 2EVRA 2ENMA 2JXBA 2ABLA 1WXBA 1PKSA 5GJWB 2EBPA 5IHIA 2W0ZA 4Y92A 1GBQA 2ECZA 3PE0A 4EIKA 1E7OA 2YSQA 2D8JA 2HDAA 1PNJA 2J6OA 2CREA 2K9GA 3LH5A 1ZUKA 5FWBA 2XMFA 3QWXX 2JM9A 2IIMA 1AEYA 1H8KA 1RLPC 1M3CA 2EYWA 1QKWA 1BB9A 1WXUA 2J6KA 2X3WD 1WYXA 2L2PA 1HJDA 4RUGA 1W70A 4J9IA 2L3SA 2H8HA 1VYTA 3VS4A 4LE9A 1GBRA 4JJDA 2FPDA 2VVKA 3I9QA 1W1FA 2PNIA 2OAWA 2K2MA 4D8KA 2DX1A 3REBB 2K6DA 2JT4A 3FJ5A 4GBQA 1M3BA 2AKLA 4WCIA 2PTKA 1SPKA 4KRTA 4AFZC 2FEIA 3M0QA 1YCSB 4JJBA 5IHNA 4ORZA 1AWOA 4LN2A 2SEMA 3IQLA 1K0XA 1BBZA 1Z9ZA 2L3PA 2O9VA 2CT3A 4JZ4A 2FRYA 2A28A 1WIEA 2B86A 1QLYA 1I07A 2GQIA 2ED0A 2KNBB 3NGPA 4RTZA 3TSZA 1M30A 1NEGA 2DL3A 1NEBA 4IIMA 4ESRA 3UA7A 1PHTA 2O9SA 2YUQA 2EYXA 2A36A 2HSPA 2DA9A 1E6HA 2YT6A 2DL4A 3H41A 2RPNA 1H3HA 2DVJA 1K4US 5IXFA 2DLPA 1SHGA 3NMZC 2A08A 1T3LA 2C0OA 1YWPA 2J06A 1GCQC 2AZSA 4RTWA 1Y0MA 1M27C 1WLPB 1ZLMA 1UHFA 2D1XA 1YN8A 4JZ3A 2KT8A 2FRWA 4OMOA 2L3QA 5IH2A 4K11A 4AFUC 3VRYA 2GTJA 3VS6A 2JMAA 4OMMA 1G83A 2DE0X 1SSHA 4JPBW 2EGCA 2EW3A 1Y57A 1OOTA 2YUPA 3H0HA 1YWOA 2CT4A 3M0TA 3NHNA 3TVTA 1MUZA 1B3QA 1OEBA 4OMQA 2C0IA 2M0YA 3VS7A 1HSQA 2BZYA 1KSWA 2LJ1A 2K7AA 1E6GA 2KGTA 2FO0A 1X69A 1SEMA 2BZ8A 2P4RA 2DBMA 2RQUA 1T0JA 1JXMA 1AD5A 2LX7A 1ARKA 2DL8A 2GGRA 1WA7A 1K0SA 2HCKA 1CKBA 4CC3A 2CUBA 1ABQA 2K3BA 4J9GA 1AZEA 2DL7A 1J3TA 4CC4B 4DEYA 4AG2C 1T3SA 1ZUUA 2DF6A 1UG1A 3U23A 2F2VA 4RTUA 1UHCA 3THKA 3M0RA 4JJCA 1K9AA 1TUCA 3NPFA 4RTYA 1G2BA 1RUWA 2F2WA 2V1RA 2E5KA 1MV0B 3EHRA 1U3OA 1BU1A 4Z88A 1GRIA 5EC7A 1HD3A 2FPEA 3JV3A 2EGEA 4AFQC 4M4ZA 1PRMC 3M0UA 4CC2A 1EFNA 1SRMA 2AZVA 1A0NB 4RTXA 3KFVA 2KXCA 2QDLA 1WDXA 2AKKA 3EG3A 3RNJA 2DJQA 4J9DA 1YP5A 4J9BA 3QWYA 2LJ0A 2W10A 2AK5A 2VKNA 1JU5C 2SRCA 1UE9A 4HXJA 3R6NA 1NYFA 1OPKA 2GBQA 2KT1A 3GBQA 1ZSGA 1VYUA 3VS5A 1I0CA 2NWMA 2EPDA 5I22A 2GTOA 3VS2A 1XOVA 3VS1A 3PVQA 2J7IA 2JTEA 1JQQA 1FYNA 4RTVA 2M51A 1N5ZA 2CUDA 1SRLA 1LCKA 4X1VA 4AG1C 1GCPA 1AWXA 3EG0A 3UATA 1M8MA 2L0AA 3H0IA 2YUOA 1W6XA 2VWFA 1CSKA 2ESWA 2OI3A 2FPFA 1ZX6A 3I5SA 2D8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  4R0K A;  5FWC A;  2G6F X;  3A98 A;  1UTI A;  1GL5 A;  4OMN A;  2JS0 A;  2I0N A;  1Z9Q A;  2J05 A;  4J9F A;  3UF4 A;  1GFC A;  3M0S A;  3VS0 A;  1OPL A;  2ROL A;  4Z8A A;  1JXO A;  1X43 A;  1GFD A;  1UUE A;  1H92 A;  4LUD A;  1UGV A;  2JS2 A;  1S1N A;  2OJ2 A;  4E6R A;  1NLO C;  3TSW A;  4J9C A;  1UDL A;  1BK2 A;  3VRZ A;  2LMJ A;  2YDL A;  1K1Z A;  5GJV B;  1M3A A;  2KRN A;  3REA B;  5HCK A;  2RQV A;  4QT7 A;  2RN8 A;  1UFF A;  2DNU A;  2KR3 A;  2LP5 A;  4F17 A;  2DRK A;  3C0C A;  2V1Q A;  2RQT A;  1GCQ A;  3O5Z A;  2F2X A;  2JW4 A;  2KYB A;  3I5R A;  5I11 A;  2EYY A;  1X6G A;  2DMO A;  1AZG B;  1RI9 A;  2D0N A;  2CH4 W;  4HVW A;  2KRM A;  1JEG A;  1PRL C;  3PVL A;  4DEX A;  2CSQ A;  2A37 A;  1QWF A;  3M0P A;  2DM1 A;  1VA7 A;  2PZ1 A;  2EKH A;  2J6F A;  2CSI A;  3UA6 A;  2LCS A;  2EGA A;  3EG1 A;  2DL5 A;  2X3X D;  3EGU A;  4F14 A;  1TUD A;  4D8D A;  2O2O A;  4RTT A;  2C0T A;  4J9H A;  1SHF A;  1KIK A;  1TG0 A;  2JMC A;  2RF0 A;  1U06 A;  1MV3 A;  2NUZ A;  2RMO A;  1ZUY A;  4HCK A;  3SHW A;  4J9E A;  2EYZ A;  2KE9 A;  3H0F A;  2LQW A;  5ECA A;  2KEA A;  1WI7 A;  4GLM A;  4OML A;  1UJY A;  2FG0 A;  2ROT A;  4OMP A;  5IHK A;  2BTT A;  1PKT A;  1RLQ C;  3VS3 A;  5FW9 A;  3I35 A;  1X6B A;  4FSS A;  4F16 A;  4IIO A;  1ZBJ A;  1B07 A;  1PWT A;  2MOX A;  1ABO A;  4HVV A;  3ULR B;  1I1J A;  2O88 A;  1NYG A;  2KXD A;  2RQR A;  1T0H A;  1AWW A;  1X27 A;  1JO8 A;  1K76 A;  2KRO A;  1X2K A;  2LJ3 A;  3RBB B;  1KJW A;  2CH4 A;  1AOJ A;  1WFW A;  2LNH B;  1FMK A;  1UJ0 A;  1WX6 A;  1AVZ C;  2O31 A;  1X2Q A;  2DRM A;  2DYB A;  2MCN A;  2RQW A;  1CKA A;  1QCF A;  2KBT A;  1QWE A;  2DIL A;  2K79 A;  3CQT A;  2RNA A;  1NLP C;  1WXT A;  4HVU A;  2LZ6 B;  1NM7 A;  4A63 B;  2DBK A;  1UEC A;  1OV3 A;  2HEQ A;  1KFZ A;  1VYV A;  2KYM A;  1YNZ A;  2BZX A;  2MIO A;  3SEM A;  2YUN A;  1IO6 A;  2KRS A;  2GNC A;  2HBW A;  4LNP A;  5IXB A;  2CDT A;  4ZNX A;  3EHQ A;  2LQN A;  3ZL7 C;  4LUE A;  1QKX A;  3EG2 A;  1U5S A;  2EQI A;  2JM8 A;  4CC7 A;  4AFS C;  2ED1 A;  5L23 A;  1NG2 A;  1AWJ A;  4Z89 A;  2EVR A;  2ENM A;  2JXB A;  2ABL A;  1WXB A;  1PKS A;  5GJW B;  2EBP A;  5IHI A;  2W0Z A;  4Y92 A;  1GBQ A;  2ECZ A;  3PE0 A;  4EIK A;  1E7O A;  2YSQ A;  2D8J A;  2HDA A;  1PNJ A;  2J6O A;  2CRE A;  2K9G A;  3LH5 A;  1ZUK A;  5FWB A;  2XMF A;  3QWX X;  2JM9 A;  2IIM A;  1AEY A;  1H8K A;  1RLP C;  1M3C A;  2EYW A;  1QKW A;  1BB9 A;  1WXU A;  2J6K A;  2X3W D;  1WYX A;  2L2P A;  1HJD A;  4RUG A;  1W70 A;  4J9I A;  2L3S A;  2H8H A;  1VYT A;  3VS4 A;  4LE9 A;  1GBR A;  4JJD A;  2FPD A;  2VVK A;  3I9Q A;  1W1F A;  2PNI A;  2OAW A;  2K2M A;  4D8K A;  2DX1 A;  3REB B;  2K6D A;  2JT4 A;  3FJ5 A;  4GBQ A;  1M3B A;  2AKL A;  4WCI A;  2PTK A;  1SPK A;  4KRT A;  4AFZ C;  2FEI A;  3M0Q A;  1YCS B;  4JJB A;  5IHN A;  4ORZ A;  1AWO A;  4LN2 A;  2SEM A;  3IQL A;  1K0X A;  1BBZ A;  1Z9Z A;  2L3P A;  2O9V A;  2CT3 A;  4JZ4 A;  2FRY A;  2A28 A;  1WIE A;  2B86 A;  1QLY A;  1I07 A;  2GQI A;  2ED0 A;  2KNB B;  3NGP A;  4RTZ A;  3TSZ A;  1M30 A;  1NEG A;  2DL3 A;  1NEB A;  4IIM A;  4ESR A;  3UA7 A;  1PHT A;  2O9S A;  2YUQ A;  2EYX A;  2A36 A;  2HSP A;  2DA9 A;  1E6H A;  2YT6 A;  2DL4 A;  3H41 A;  2RPN A;  1H3H A;  2DVJ A;  1K4U S;  5IXF A;  2DLP A;  1SHG A;  3NMZ C;  2A08 A;  1T3L A;  2C0O A;  1YWP A;  2J06 A;  1GCQ C;  2AZS A;  4RTW A;  1Y0M A;  1M27 C;  1WLP B;  1ZLM A;  1UHF A;  2D1X A;  1YN8 A;  4JZ3 A;  2KT8 A;  2FRW A;  4OMO A;  2L3Q A;  5IH2 A;  4K11 A;  4AFU C;  3VRY A;  2GTJ A;  3VS6 A;  2JMA A;  4OMM A;  1G83 A;  2DE0 X;  1SSH A;  4JPB W;  2EGC A;  2EW3 A;  1Y57 A;  1OOT A;  2YUP A;  3H0H A;  1YWO A;  2CT4 A;  3M0T A;  3NHN A;  3TVT A;  1MUZ A;  1B3Q A;  1OEB A;  4OMQ A;  2C0I A;  2M0Y A;  3VS7 A;  1HSQ A;  2BZY A;  1KSW A;  2LJ1 A;  2K7A A;  1E6G A;  2KGT A;  2FO0 A;  1X69 A;  1SEM A;  2BZ8 A;  2P4R A;  2DBM A;  2RQU A;  1T0J A;  1JXM A;  1AD5 A;  2LX7 A;  1ARK A;  2DL8 A;  2GGR A;  1WA7 A;  1K0S A;  2HCK A;  1CKB A;  4CC3 A;  2CUB A;  1ABQ A;  2K3B A;  4J9G A;  1AZE A;  2DL7 A;  1J3T A;  4CC4 B;  4DEY A;  4AG2 C;  1T3S A;  1ZUU A;  2DF6 A;  1UG1 A;  3U23 A;  2F2V A;  4RTU A;  1UHC A;  3THK A;  3M0R A;  4JJC A;  1K9A A;  1TUC A;  3NPF A;  4RTY A;  1G2B A;  1RUW A;  2F2W A;  2V1R A;  2E5K A;  1MV0 B;  3EHR A;  1U3O A;  1BU1 A;  4Z88 A;  1GRI A;  5EC7 A;  1HD3 A;  2FPE A;  3JV3 A;  2EGE A;  4AFQ C;  4M4Z A;  1PRM C;  3M0U A;  4CC2 A;  1EFN A;  1SRM A;  2AZV A;  1A0N B;  4RTX A;  3KFV A;  2KXC A;  2QDL A;  1WDX A;  2AKK A;  3EG3 A;  3RNJ A;  2DJQ A;  4J9D A;  1YP5 A;  4J9B A;  3QWY A;  2LJ0 A;  2W10 A;  2AK5 A;  2VKN A;  1JU5 C;  2SRC A;  1UE9 A;  4HXJ A;  3R6N A;  1NYF A;  1OPK A;  2GBQ A;  2KT1 A;  3GBQ A;  1ZSG A;  1VYU A;  3VS5 A;  1I0C A;  2NWM A;  2EPD A;  5I22 A;  2GTO A;  3VS2 A;  1XOV A;  3VS1 A;  3PVQ A;  2J7I A;  2JTE A;  1JQQ A;  1FYN A;  4RTV A;  2M51 A;  1N5Z A;  2CUD A;  1SRL A;  1LCK A;  4X1V A;  4AG1 C;  1GCP A;  1AWX A;  3EG0 A;  3UAT A;  1M8M A;  2L0A A;  3H0I A;  2YUO A;  1W6X A;  2VWF A;  1CSK A;  2ESW A;  2OI3 A;  2FPF A;  1ZX6 A;  3I5S A;  2D8H A; 
#chains in the Genus database with same CATH topology
 2RK1 A;  4IUT A;  1UTI A;  1Q86 R;  3CCR T;  2XK0 A;  3CCE T;  3G6E T;  2KVQ G;  3G4S A;  1WHJ A;  3X28 B;  1BI1 A;  3MET A;  1VQ9 A;  1XNI A;  2CZ7 B;  2DEU A;  5GAN 6;  1N8R R;  1I5O B;  2DTI A;  3RKY A;  4P5N A;  1UB4 A;  1XQH A;  4LUD A;  2JS2 A;  3CCM Q;  2OJ2 A;  1K8A C;  3BDU A;  4E6R A;  1M9S A;  6AT1 B;  3TSW A;  4PLL A;  4J9C A;  4M7A F;  1WHM A;  4NL3 A;  1UDL A;  3FLG A;  1VOM A;  1M3A A;  3M55 A;  1M2O A;  2DKG A;  2NUT A;  5HCK A;  2RO0 A;  1VQ5 Q;  3JCM W;  2RN8 A;  4F17 A;  2QK0 A;  1WPY A;  4ZN1 A;  2KYB A;  3BY7 A;  1YI2 A;  1VQ4 A;  1JRI A;  3LW5 E;  1YIJ Q;  1X6G A;  5GAN 8;  2DMO A;  1AZG B;  4BB7 A;  2LTO A;  1RI9 A;  2D0Q B;  2D0N A;  4HVW A;  1JEG A;  1VIF A;  1QWF A;  2LX9 A;  2DM1 A;  5D6W A;  4E7K A;  1Q82 U;  1YJ9 A;  1KQ2 A;  3HKS A;  1IB8 A;  3EGU A;  3L2R A;  4V2S A;  2RM4 A;  2CP0 A;  2C0T A;  2PU9 B;  2E64 A;  1NE8 A;  3QII A;  2JMC A;  1U06 A;  1VQP Q;  1RL2 A;  4C8Q F;  4A4F A;  4PJO F;  1M1K C;  1YJN Q;  2KE9 A;  4J7I A;  1W4S A;  2X4Y A;  1WI7 A;  2KQW A;  4GLM A;  4J7F A;  4OML A;  2ROT A;  2BTT A;  2YXY A;  3C94 A;  1K73 R;  1PKT A;  2NUP A;  5FW9 A;  4OP0 A;  2DFU A;  1KQ1 A;  1PWT A;  1KC8 C;  3EAE A;  3A8H B;  4F7U A;  3QHS A;  2CP5 A;  2EQM A;  3DLL A;  1NYG A;  2KXD A;  2RQR A;  2HBP A;  1TWB A;  4OB2 B;  1KJW A;  4M7D G;  2EQU A;  1OYX A;  2LNH B;  1QVF A;  1AVZ C;  1LVK A;  2O31 A;  1HYO A;  2DRM A;  3C95 A;  2O01 E;  3OYL A;  3CCJ Q;  2DIL A;  4N4I A;  3M57 A;  2RNA A;  3G4S Q;  1PCX A;  5J39 A;  4OGC A;  4F7U B;  4F04 B;  1ZSZ B;  2JN0 A;  2K5I A;  1NM7 A;  2LZ6 B;  3A5Z B;  2AHJ B;  4UC4 A;  4MZM A;  4IKF A;  3OY9 A;  1IHW A;  3SEM A;  2YUN A;  1K8A R;  1VIE A;  1N6A A;  2CKK A;  4QQG A;  3EFR A;  4LNP A;  4ZNX A;  3CCR A;  3CCE A;  3V8K A;  1BIA A;  3GLX A;  4XU0 A;  3ZL7 C;  1BYM A;  2CP6 A;  2ED1 A;  2FZC B;  1NG2 A;  4MML A;  2ABL A;  1WXB A;  1PKS A;  3OYD A;  2COZ A;  5IHI A;  2W0Z A;  2LT1 A;  4XU3 A;  1YI2 Q;  1VQ4 Q;  1IHV A;  1GBQ A;  4DBF A;  2L8D A;  1VQK Q;  2XI9 A;  1K9M U;  1XJW B;  4ZTF A;  4L5G A;  4XTW A;  2NLU A;  1RI0 A;  3PNW C;  3QWX X;  1NPR A;  2VV5 A;  2IIM A;  1M3C A;  2J6K A;  3SWN A;  1W70 A;  4A54 A;  3ZBD A;  1M90 C;  1M90 U;  2H8H A;  2DEQ A;  4PFP A;  1GXI E;  2ZGW A;  2QYZ A;  5LJ3 f;  3I55 Q;  1TOV A;  4O5V A;  1M1K R;  2Y4X A;  4N0A C;  2DPP B;  5KYN A;  3D7S B;  4D8K A;  2V8I A;  5DY9 A;  3SWN B;  1FMW A;  2E1H A;  4HA8 A;  5CKB A;  2AKL A;  4FYW B;  4M77 G;  5J3B A;  4PL6 A;  5GAO q;  1KC8 R;  3M53 A;  3GNF B;  4FIB A;  3TEE A;  1MNE A;  1BI2 A;  4KRT A;  1YHQ A;  1N27 A;  3MP8 A;  2JTF A;  4BI8 B;  5GAM j;  2CYZ B;  4EDU A;  4M75 B;  5GAO l;  1UGP B;  3S3O A;  2DZC A;  4F7U F;  2FZG B;  1Z9Z A;  1RAB B;  2O9V A;  4BE0 A;  2A28 A;  1WIE A;  3EGX A;  1U8R A;  3CD6 T;  3ER0 A;  2LQK A;  1B7T A;  1NEG A;  2DL3 A;  3OYK A;  2E6Z A;  5LJ3 h;  3JCM c;  5A0G A;  3R6O A;  2RJD A;  4RMO A;  2EYX A;  4JS4 A;  2A36 A;  2PUK B;  3CC7 T;  3UT1 A;  1I4K 1;  2RPN A;  1ACM B;  2DLP A;  3V7S A;  3NMZ C;  1T3L A;  2C0O A;  1YWP A;  2J06 A;  2M1H A;  1YN8 A;  2FRW A;  4FSX A;  2DXT A;  3EFO A;  4N4H A;  4AFU C;  3CCM T;  1VQ8 A;  1D0X A;  1ZA1 B;  2FVU A;  2JMA A;  5GAN e;  4E7S A;  3CPW S;  4JPB W;  3UDC A;  1Y57 A;  2COW A;  2DIG A;  2YUP A;  3PFS A;  1VQ5 T;  4C0D B;  1H3Z A;  1MUZ A;  1B3Q A;  2C0I A;  4KT0 E;  3VS7 A;  1HSQ A;  2P0K A;  1VQN Q;  3RR6 A;  4M78 G;  4M77 C;  1X69 A;  1YIJ T;  3QJY A;  4KGV B;  2R5M A;  4IUU A;  2DBM A;  3VU3 C;  5FU7 C;  5CAI A;  2OX7 A;  1ARK A;  3J7A F;  2A3L A;  2GGR A;  3JSC A;  5GAN 5;  9ATC B;  4A4G A;  2OTL Q;  4J9G A;  4C8Q C;  2LT4 A;  1LJO A;  1MND A;  3QBY A;  3HHT B;  1WNL A;  1K9A A;  3A8O B;  3NPF A;  2HL5 C;  4M75 F;  1D3B B;  1YHQ Q;  1HD3 A;  3L2Q A;  1EX4 A;  2M9U A;  2BIV A;  1PRM C;  1D09 B;  3M0U A;  1WJQ A;  3ME9 A;  1YJN T;  1IGQ A;  1Y07 A;  3CCS A;  2AKK A;  3EG3 A;  3RNJ A;  4NL2 A;  2CZ0 B;  5LJ5 e;  4J9D A;  5AYF A;  2HL3 A;  2LJ0 A;  2VKN A;  4BI3 A;  2SRC A;  1UE9 A;  3JCM f;  2KT1 A;  3TRE A;  2KY9 A;  1I0C A;  4N0A A;  2EPD A;  3H8Z A;  5I22 A;  3VS2 A;  3HL8 A;  4XTU A;  1RAE B;  1VQL Q;  2XG8 D;  5IN1 A;  4M7D A;  1FYN A;  4RTV A;  4BE2 A;  1SRL A;  1LCK A;  4X1V A;  5I2M A;  4A53 A;  3GF5 A;  3CD6 A;  5KE3 A;  3G71 Q;  1X75 C;  3M4G A;  3PIO A;  3CME Q;  3CCJ T;  1QVG S;  1B34 A;  2OI3 A;  3G4S T;  1G5V A;  3BFM A;  5FWC A;  1VQ9 T;  3A98 A;  4M7A D;  4ZTJ A;  1GL5 A;  4OMN A;  5GAM e;  4Q5W A;  2JS0 A;  3OS1 A;  4M7D B;  3E2U A;  4RCC A;  4JJN K;  1VQ8 Q;  3CPF A;  4J9F A;  3BE3 A;  3RMS A;  3M0S A;  1SF9 A;  1JXO A;  3JAM E;  1X43 A;  2RHY A;  3MEW A;  1H92 A;  1S1N A;  1TSF A;  2LRQ A;  4C92 G;  5GAN 2;  1NLO C;  3OSV A;  2RI3 A;  1M8V A;  5DLQ E;  3CCM A;  3JCM h;  3VRZ A;  3CCU A;  5GJV B;  2EYQ A;  1YI2 T;  1VQ4 T;  1MMA A;  4J6X A;  3REA B;  4QT7 A;  3V8L A;  1RAC B;  5IAY A;  2KR3 A;  1VQK T;  2DRK A;  2V1Q A;  2RHZ A;  1KQS S;  4OGE A;  3I5R A;  5I11 A;  2EYY A;  3FDR A;  2ZCF B;  3INZ A;  2CH4 W;  2KRM A;  2HZY A;  5HK3 A;  3OMG A;  4M7A E;  1PRL C;  4DEX A;  5GAN d;  1M2V A;  2A37 A;  4PJO D;  3M0P A;  4HCB A;  4QVZ A;  2J6F A;  5GMK h;  2CSI A;  2YWW A;  1C0M A;  1WQW A;  2DK3 A;  3CBP A;  4LDX A;  2EGA A;  2VAS A;  2H3E B;  2DL5 A;  3JB9 H;  4Z02 A;  2X3X D;  4F14 A;  2WSE E;  3I55 T;  3EH2 A;  1QCO A;  2MI6 A;  3JB9 G;  4RTT A;  4J9H A;  3LH0 A;  1VQM A;  2HD0 A;  1KD1 R;  2EQJ A;  4B9X A;  4II1 A;  2NUZ A;  2RMO A;  4HCK A;  4M77 A;  4E2F B;  4J9E A;  5D6Y A;  1IXD A;  1VQP A;  4FW1 A;  2CGH A;  5ECA A;  2A0F B;  5GAM g;  1YJN A;  1RLQ C;  3VS3 A;  3CXC P;  3A8M B;  2ZPG B;  4F16 A;  2P4T A;  2H3J A;  2QGG A;  4IIO A;  3CCQ Q;  3OW2 P;  1Q7Y C;  4HVV A;  3ULR B;  2DVE A;  4XQ3 A;  3ASK A;  1T0H A;  1JO8 A;  4J8O A;  3RBB B;  1AOJ A;  2K5L A;  4OMF B;  2PQW A;  4JUV A;  5LJ5 d;  2DYB A;  2RQW A;  4BDY A;  1K73 U;  2KBT A;  4QVD A;  2K79 A;  1D1B A;  3CQT A;  1G3Y A;  1JJ2 P;  1ZBX A;  3OS5 A;  2ZPF B;  2QGF B;  1WXT A;  1PG5 B;  3CCJ A;  2X4J A;  4HVU A;  5FU6 C;  4A63 B;  1UEC A;  4J5Y A;  1OV3 A;  5CIU A;  2BZX A;  4LDY A;  1IO6 A;  4E7H A;  3V8J A;  4EPC A;  5IXB A;  1RAH B;  2CDT A;  3PMI A;  4B9W A;  4BY6 C;  4X9C A;  2M16 A;  3GNG A;  3CCU Q;  5AT1 B;  3EG2 A;  5L8R E;  5D7U A;  2ZPB B;  4CC7 A;  5KCO A;  5GAO m;  2JXB A;  5GJW B;  2EBP A;  1W2B A;  5GAM d;  3OYJ A;  3M9Q A;  2LQ8 A;  3NTK A;  3PE0 A;  4EIK A;  5KYW A;  2D8J A;  1I5L A;  2HDA A;  1PNJ A;  2J6O A;  2CRE A;  1QQJ A;  1OX9 A;  5HK0 A;  3NFC A;  4RKU E;  5FWB A;  2XMF A;  4X34 A;  2JM9 A;  4M78 A;  2Y90 A;  1H8K A;  1VQK A;  1VQN T;  1OZ3 A;  4PJM A;  2QG9 B;  1QKW A;  1WXU A;  1HJD A;  1Q82 C;  2NUT B;  5C0M A;  3OS2 A;  2DET A;  4LE9 A;  1VQM Q;  2OTL T;  5KYW B;  2LC4 A;  1P92 A;  1WJS A;  2R57 A;  3RUX A;  2MK5 A;  1QVF S;  4M78 B;  2FHD A;  2PNI A;  3I55 A;  2OAW A;  5GAN 3;  2VC8 A;  2DZ9 A;  1YHQ T;  2WSF E;  2JT4 A;  4WTO B;  2QQR A;  2HQX A;  2QQA A;  2GFA A;  2IPO B;  4E7J A;  2FL7 A;  2PTK A;  2QTV A;  4ELZ C;  4DBQ A;  1Q7Y R;  3TCJ A;  3VYH B;  3M0Q A;  1AT1 B;  3QG1 A;  4JLI A;  4X9D A;  1Q81 R;  3WVD B;  1C6V X;  2K2V A;  1QP3 A;  2SEM A;  3IQL A;  3JB9 J;  5GAN 4;  2YRV A;  1BCO A;  1DJ7 B;  3RDV A;  4JS5 A;  4JZ4 A;  4BAC A;  3MP1 A;  5CVI A;  5LL6 S;  1VQL T;  4YTL A;  2NUP B;  3QO3 A;  1QLY A;  1I07 A;  2QAS A;  5GAN j;  3HTR A;  3TSZ A;  1M30 A;  5C6S A;  2OAU A;  1NEB A;  4IIM A;  2A7Y A;  1O75 A;  4ESR A;  3UA7 A;  1PHT A;  4PJJ A;  3G71 T;  2JNG A;  2YRD A;  2YUQ A;  3CME T;  3LWH A;  4F7U E;  2DA9 A;  3FC3 A;  2DL4 A;  4HKE A;  1H3H A;  4FYV B;  3CBM A;  2G3R A;  3E19 A;  3CXC A;  2A08 A;  2P0Q A;  1GCQ C;  3V7C A;  1VQ8 T;  3SD4 A;  1WLP B;  1UHF A;  4JZ3 A;  2DER A;  2AIR B;  3OW2 A;  3QSU A;  2L3Q A;  1WHH A;  3VRY A;  4C92 A;  2B8A A;  3MEA A;  2OTJ Q;  3OYA A;  3VS6 A;  3GOX A;  1MMD A;  1SSH A;  1R77 A;  1K9M C;  2EW3 A;  5KCH A;  2X4W A;  1RAA B;  4ZN3 A;  1JJ2 A;  3M5A A;  1YWO A;  4DOW A;  3OA6 A;  4OMQ A;  3A8L B;  2QAZ A;  2LJ1 A;  3P8H A;  3PIP A;  2KGT A;  4M75 D;  4C92 B;  1SEM A;  5LJ5 j;  2P4R A;  4JRP A;  1VQN A;  3A1P A;  4MDW A;  1T0J A;  3JCM P;  1K0S A;  2QA4 Q;  1CKB A;  5GAO n;  1ABQ A;  5HY6 A;  4QKU A;  2HQH A;  2DF6 A;  2KDS A;  2EAY A;  2CP7 A;  4RTU A;  3PTA A;  2OTL A;  2M0O A;  1WQ7 A;  2CZ6 B;  4RTY A;  5KE2 A;  3MP6 A;  3QJ6 A;  1FMV A;  4LD9 K;  3CCS T;  1BU1 A;  1WGS A;  3I56 Q;  2EGE A;  5CKH A;  4M4Z A;  3TU4 K;  4CC2 A;  2AZV A;  3VUZ A;  4RTX A;  2KXC A;  4C8Q G;  2E41 A;  4PJO G;  5DLO A;  4FCY A;  1LOJ A;  3QXE B;  4JRI A;  1UGS B;  4J9B A;  3QWY A;  2E12 A;  4M75 E;  2AK5 A;  1JU5 C;  1NYF A;  1OPK A;  1WHG A;  2GBQ A;  5CKD A;  3VS5 A;  1VYU A;  3CCQ T;  2NWM A;  2RHU A;  1EZZ B;  1KHI A;  2EFI A;  5A2Q E;  3PVQ A;  2J7I A;  1JQQ A;  2Z0W A;  2WAC A;  4O6J A;  4C5E A;  3S3N A;  1VQL A;  3OS0 A;  3UAT A;  4E7Z A;  4A4E A;  3OQ5 A;  1CSK A;  3J81 E;  3LGF A;  3I5S A;  4LDU A;  2D8H A;  1V1C A;  2X9H A;  4R0K A;  4M7A C;  3G71 A;  3JCM J;  3CME A;  2E65 A;  3EGX B;  2I0N A;  1Z9Q A;  3JRZ A;  1SSF A;  1QW1 A;  2J05 A;  3UF4 A;  2D9T A;  3QUI A;  3G6E Q;  4MDX A;  3CCU T;  2HNI A;  1GFD A;  1K9M R;  2BKD N;  3LYI A;  3OYG A;  4C92 F;  3PGG A;  3RKW A;  4VUB A;  3C4S A;  4ZGD B;  3QPH A;  2LMJ A;  2YDL A;  2K3Y A;  4EMK C;  4J6W A;  2RQV A;  1M90 R;  2RH2 A;  3DKM A;  3HFN A;  3EFO B;  4ANJ A;  1UFF A;  2LP5 A;  5IT9 E;  1MHN A;  1GCQ A;  2RQT A;  2F2X A;  2VB6 A;  2HAX A;  4Y28 E;  3H6Z A;  5DM7 R;  1M1G A;  3CMA Q;  3PVL A;  3Q1J A;  2PUO B;  4PJO C;  2M02 A;  4FW2 A;  4B6M A;  3UA6 A;  1UGQ B;  1U1S A;  1VQM T;  4HT9 A;  3CCL A;  4HT8 A;  4XTZ A;  1FWZ A;  4MZP A;  4CRI A;  4IUV A;  4D8D A;  3H9N A;  4PFZ A;  1BCM A;  2R5A A;  3BW1 A;  3P8D A;  1SHF A;  1VQP T;  3OB9 A;  5GAN f;  1OZ2 A;  1TG0 A;  2I2L A;  4JRK A;  2VXF A;  1ZUY A;  3SHW A;  4IUR A;  1VQ7 Q;  2HKQ B;  1NJI U;  4M7D D;  2MAM A;  3H0F A;  2LQW A;  2QI2 A;  2E70 A;  4XTX A;  2KEA A;  3ZFJ A;  1UJY A;  1Y96 A;  3HRU A;  5IHK A;  3GPL A;  4ELY C;  1YJW A;  5GMK e;  2EQK A;  2K57 A;  3VYG A;  1MGQ A;  1B07 A;  2MOX A;  1OU9 A;  3URG A;  3L42 A;  1KD1 U;  1YFN A;  2XU8 A;  2DXC A;  2DO3 A;  1BI3 A;  2RJC A;  3CCQ A;  1K76 A;  2KRO A;  5GAN g;  2LJ3 A;  4A4K A;  2L5Q A;  1FMK A;  1WX6 A;  2MF2 A;  1CKA A;  1QCF A;  3X26 B;  1AHJ B;  2F69 A;  2IG0 A;  4BE1 A;  3CC4 Q;  2E10 A;  2E3I A;  2JUF A;  4BDZ A;  3L2V A;  1TUG B;  2DBK A;  4M7D E;  1NZ9 A;  2HEQ A;  2QQB A;  1VYV A;  1YNZ A;  5LJ5 f;  3QKJ A;  3UPU A;  1D0Z A;  3J80 E;  5HKC A;  1B34 B;  2ZPI B;  1U5S A;  3OYN A;  2JM8 A;  3CCV A;  4AFS C;  1VUB A;  2ENM A;  2PVG B;  1IZ6 A;  1Q86 U;  2OTJ T;  4AMC A;  2COY A;  3A8G B;  3M59 A;  5GMK l;  2ECZ A;  1E7O A;  2YLB A;  2YSQ A;  1X01 A;  1N8R U;  3VUB A;  2RI5 A;  3LH5 A;  5FRM A;  1ZUK A;  4J6Y A;  2L89 A;  5LJ5 g;  5KYY A;  1AEY A;  2EYW A;  3FIF A;  5GAM f;  2X3W D;  1WYX A;  2GQV A;  2QQ9 A;  2L2P A;  4LXC A;  3CCL Q;  1YIT Q;  1MMN A;  1VQ6 Q;  3LLR A;  4J9I A;  3HFO A;  3OYY A;  4XTY A;  3VS4 A;  2QA4 T;  4EMK A;  1KG1 A;  4E7I A;  2FPD A;  3I9Q A;  5KYY B;  2D6F A;  1MMG A;  1M2V B;  1SKU B;  4DBR A;  1YJW Q;  2K6D A;  3FJ5 A;  1ZSZ C;  3CC2 Q;  3I56 T;  1M3B A;  4LDV A;  4M75 G;  3UWN A;  3FJP A;  1Y7X A;  4WCI A;  3JCM Q;  2X35 A;  5KYX A;  3OYM A;  4C8Q A;  4PJO A;  4FT2 A;  5FRO A;  2FEI A;  1TU0 B;  3LWI A;  1YCS B;  3S6W A;  2KSS A;  3EGD A;  4M77 B;  3OYH A;  4LN2 A;  1K0X A;  4M7D F;  1UGR B;  4C0G A;  5FU7 B;  1BBZ A;  4M77 E;  2MYS A;  1HK9 A;  2L3P A;  5GAM h;  2ZPH B;  2DYI A;  4PJN A;  3O8V A;  2E5Q A;  4C8Q B;  5LJ3 j;  2B86 A;  1W2B S;  1K73 C;  4PLI A;  2KNB B;  2HMA A;  2XDD A;  3MPU B;  2HKN A;  2KMT A;  4FL6 A;  1YCY A;  4FM4 B;  3CBO A;  4C5I A;  3EGD B;  1E6H A;  2VGM A;  2DVJ A;  1K4U S;  5IXF A;  1SHG A;  3FEO A;  2RD1 A;  5CQX A;  2XDB A;  3CCV Q;  5FLX E;  3HSB A;  2AZS A;  1VQO A;  1Y0M A;  4PK4 A;  3G7Z A;  1M27 C;  4QVC A;  2KT8 A;  2QTX A;  1D1A A;  4XU1 A;  3EG9 A;  4M78 D;  4OMO A;  3KBG A;  5IH2 A;  2QEX A;  3SWN C;  1OU8 A;  2HQE A;  3MHX A;  5KH6 A;  1KK7 A;  4A4H A;  1K8A U;  1R0C B;  2EGC A;  2C06 A;  1M5Q 1;  2BE7 D;  2OTJ A;  1WHL A;  2IVW A;  3L1A A;  1N9R A;  1X6O A;  2CT4 A;  2MWO A;  1OQK A;  3NHN A;  3TVT A;  1OEB A;  2M0Y A;  2LCL A;  2CS7 A;  3EG9 B;  1R0B G;  1KSW A;  2XD0 A;  4M75 C;  4HCC A;  3FRN A;  3E9G A;  3CMA T;  2RQU A;  2LDM A;  3SB2 A;  3RES A;  2DL8 A;  3V7R A;  4KGZ B;  4CC3 A;  2CUB A;  1BI0 A;  2K3B A;  1AZE A;  2DL7 A;  1FXX A;  3HRT A;  4CC4 B;  4DEY A;  4XAX B;  1ZUU A;  2QA4 A;  3E9F A;  1I8F A;  1S72 A;  1UG1 A;  2F2V A;  2LCC A;  4KH1 B;  4DBH A;  3L2W A;  4M78 E;  1RAD B;  4JJC A;  1TUC A;  1TH7 A;  1RUW A;  5M9O A;  4M77 F;  1RAI B;  2F2W A;  2V1R A;  1IGU A;  2E5K A;  2YLC A;  3EHR A;  1U3O A;  4AFQ C;  2LVM A;  2RJE A;  3QDF A;  4R55 A;  1C1A A;  5A0L A;  2QQS A;  1VQ7 T;  1EFN A;  3KFV A;  3I56 A;  4BI4 A;  4MZT A;  3CXC S;  1WDX A;  1M1K U;  2K3X A;  2DJQ A;  4DA4 A;  2W10 A;  3OW2 S;  4HXJ A;  2DD5 A;  2DXB A;  3QYG B;  2JOY A;  1XOV A;  1KC8 U;  1YBY A;  1ZSZ A;  2M51 A;  2CUD A;  2XKO C;  4LD6 A;  1BKB A;  4C0D C;  1D1C A;  3MJX A;  4AG1 C;  1GCP A;  1AWX A;  1OUL A;  3EG0 A;  4FU6 A;  3QZ5 B;  1M8M A;  1JJ2 S;  3H0I A;  2PVD B;  2VWF A;  2VGN A;  2ZZD A;  1VQO Q;  4C5G A;  3CC4 T;  2FPF A;  4C92 D;  3OBY A;  2G6F X;  4OVA A;  4PJL A;  1VQ9 Q;  3AHU A;  2QEX Q;  3X25 B;  2DD4 A;  2EIF A;  1M1F A;  1GFC A;  2ATC B;  3VS0 A;  3MKD A;  1OPL A;  2ROL A;  4Z8A A;  4JRQ A;  4KUL A;  5LJ3 e;  1UUE A;  1UGV A;  2MPX C;  3G6E A;  3E1S A;  2R58 A;  2RHI A;  2WSC E;  1G8X A;  4M7A G;  2V8J A;  1BK2 A;  1K1Z A;  1Q82 R;  4AT1 B;  3T9N A;  2KRN A;  5CO7 A;  1LPL A;  3M58 A;  2EWN A;  3CPW P;  4C0Z A;  2EJF A;  4M78 F;  2YHT A;  2DNU A;  3C0C A;  2E3H A;  4KGX B;  3O5Z A;  2JW4 A;  3JB9 D;  4ZGE B;  4C92 E;  5GMK j;  1S72 Q;  4RG2 A;  3CCL T;  1YJ9 Q;  1YIT T;  2CSQ A;  1VQ6 T;  5FU6 B;  4C0F A;  1VA7 A;  3CMA A;  2PZ1 A;  2EKH A;  3OYF A;  2LCS A;  3OYC A;  1BIB A;  3L2Z A;  4Y91 A;  3OSS C;  2RHX A;  3EG1 A;  4BY6 B;  1O9S A;  3MEV A;  1TUD A;  2V8K A;  2O2O A;  3OMC A;  5CR2 A;  1EIF A;  2DAQ A;  3N5B B;  1KIK A;  2FZK B;  2L3R A;  2P0P A;  2CP2 A;  2YRC A;  3CEY A;  1KHC A;  2RF0 A;  1MV3 A;  1YJW T;  4ZGJ B;  2O4X A;  4M75 A;  3CC2 T;  3WXM B;  3QYH B;  1UEB A;  4RG8 A;  4M7D C;  2EYZ A;  1R8O B;  3FB9 A;  3SFM A;  5GMK m;  5D6X A;  4PNO A;  2EJ9 A;  2FG0 A;  3PT9 A;  4OMP A;  1VQ7 A;  1I81 A;  3I35 A;  1X6B A;  4FSS A;  4KBM B;  3RIR A;  1ZBJ A;  2MWP A;  2JTM A;  1TS9 A;  1ABO A;  1I1J A;  2O88 A;  1H64 1;  1ZQ1 A;  2O4X B;  2JVV A;  5LJ3 g;  1AWW A;  1X27 A;  1FX7 A;  2K4Y A;  1X2K A;  4NOY A;  4OB1 B;  4D6W A;  1QVP A;  2CH4 A;  1WFW A;  2F5T X;  2GFU A;  1UJ0 A;  3HP9 A;  1X2Q A;  4FYX B;  3LX7 A;  1PD0 A;  2KAF A;  2MCN A;  1OI1 A;  4PFO A;  1QWE A;  2XDP A;  1TTH B;  3S3M A;  1NLP C;  2E6N A;  1QVG P;  4EMG A;  3MEU A;  4BD3 A;  3PMT A;  3CC4 A;  1PD1 A;  5GMK i;  5A0D A;  3CCR Q;  1Y71 A;  2ZPE B;  3CCE Q;  1KFZ A;  2KYM A;  3NTH A;  2MIO A;  1WZO A;  2QXF A;  3CCV T;  2KRS A;  5GAO p;  2GNC A;  2HBW A;  3EHQ A;  2LQN A;  5GAO r;  4LUE A;  1QKX A;  2DXU A;  3DLM A;  2EQI A;  1ZA2 B;  2EJG A;  5L23 A;  4Z89 A;  1AWJ A;  2EVR A;  3OYE A;  1LNX A;  5FRN A;  3G1J A;  4Y92 A;  2X51 A;  8ATC B;  1QMC A;  2HSE B;  4IUP A;  1N9S A;  3MO8 A;  4RCB A;  2QDY B;  4R56 A;  2JJ9 A;  5EG2 A;  1NPP A;  4FT4 A;  2K9G A;  5CK9 A;  2Y4Y A;  3VJP A;  3KXT A;  5LJ3 d;  4BUG A;  3ZEH A;  1KQS P;  1RLP C;  3M54 A;  4QW2 A;  4QQ6 A;  1BB9 A;  3JCM V;  1ZHI A;  1WHK A;  1M4Z A;  4RUG A;  1QP2 A;  1IRE B;  2L3S A;  3JCM e;  2KI7 A;  2MMP A;  5CKE A;  1D3B A;  1VYT A;  1YIT A;  1QCN A;  1VQ6 A;  2BE9 B;  1GBR A;  3RKX A;  4JJD A;  3JB9 F;  4XK8 E;  2XID A;  8AT1 B;  2VVK A;  4EMH A;  1W1F A;  3JB9 I;  4HCZ A;  2K2M A;  3VV0 A;  2DX1 A;  3REB B;  1U1T A;  1RAG B;  1NJI C;  2EKO A;  3L2U A;  3CPW A;  1XTD A;  4GBQ A;  4C5H A;  1NBE B;  2GF7 A;  1TXQ A;  4NS5 A;  2RJF A;  4L6V 5;  2DTH A;  2BUD A;  2RB6 A;  3CC2 A;  4DOV A;  2DTO A;  1SPK A;  4KH0 B;  4AFZ C;  4JJB A;  4N4G A;  2DIQ A;  1KD1 C;  5IHN A;  4ORZ A;  1AWO A;  3JCM b;  2XHC A;  4OB0 B;  3WVE B;  3EH1 A;  4F7U G;  3AT1 B;  2RK2 A;  2P84 A;  2CT3 A;  1Y96 B;  1G3W A;  2FRY A;  1PM3 A;  4ATO A;  2GQI A;  5GAN 7;  2ED0 A;  4WF2 A;  3GP8 A;  3OYB A;  3MCA B;  3NGP A;  3OBW A;  4RTZ A;  1PC0 A;  4J83 A;  1IRX A;  4QQD A;  1W2B P;  2F1L A;  7AT1 B;  2O9S A;  5GAN h;  4GY5 A;  2HSP A;  1VQO T;  2YT6 A;  1OX8 A;  3H41 A;  3M4Y A;  1WJR A;  5KYU A;  4DQ2 A;  1V76 A;  2QEX T;  3CC7 A;  4RTW A;  3HRS A;  1D0Y A;  1ZLM A;  2D1X A;  3JCM g;  1RAF B;  4KUI A;  3P8B B;  4M78 C;  4OB3 B;  4K11 A;  1F1B B;  1Q86 C;  1G3S A;  3DB4 A;  3NTI A;  1HXD A;  2GTJ A;  3LGL A;  2K5F A;  4M7A A;  3RMQ A;  5KYU B;  4OMM A;  3VKI A;  1G83 A;  2DE0 X;  2FYK A;  1N8R C;  2E4H A;  3EFS A;  4IUQ A;  3JCM X;  1OOT A;  3H0H A;  2V26 A;  4E47 A;  1JBM A;  3M0T A;  3OYI A;  4L59 A;  2F5K A;  3HPW A;  1QVG A;  3QZ9 B;  2NYS A;  2BZY A;  5CKF A;  3F70 A;  2K7A A;  1E6G A;  2FO0 A;  2BZ8 A;  4M77 D;  1VQ5 A;  2DJZ A;  1S72 T;  4M7A B;  4OF1 A;  4E7L A;  1JXM A;  1AD5 A;  1YJ9 T;  2LX7 A;  1WA7 A;  3X24 B;  2HCK A;  3KUF A;  1Q95 G;  4JLG A;  5LJ5 h;  1J3T A;  4C8Q D;  1YIJ A;  2KK4 A;  4XU2 A;  4AG2 C;  1T3S A;  1NJI R;  2RI2 A;  3U23 A;  1SG5 A;  2CP3 A;  2LNV A;  4CI0 C;  1UHC A;  4PKC C;  3THK A;  3M0R A;  5CQY A;  1QVF P;  1G2B A;  1PSF A;  2RA2 A;  3X20 B;  1MV0 B;  2PVO B;  3TQ7 P;  4Z88 A;  1GRI A;  4LDW A;  5EC7 A;  2X4X A;  4MMK A;  1JB0 E;  2FPE A;  3JV3 A;  3JCM d;  3M56 A;  3CCS Q;  3GIB A;  1G3T A;  2AT1 B;  4EMK B;  1SRM A;  1A0N B;  1V29 B;  2VXE A;  2QDL A;  4FYY B;  3SDZ A;  1KQS A;  3BDL A;  4ME7 A;  2VUB A;  2XIC A;  4KUD K;  2FB7 A;  1YP5 A;  3DB3 A;  2VYT A;  5CCA A;  4TVR A;  3R6N A;  5I21 A;  3GBQ A;  1ZSG A;  3C12 A;  3QDR B;  5KYX B;  2CZ1 B;  2GTO A;  4PJO B;  1PSE A;  3VS1 A;  5I2S A;  1Q7Y U;  2JTE A;  4C8Q E;  2ZAE A;  3RER A;  5J26 A;  4PJO E;  1N5Z A;  3CD6 Q;  4GLK A;  2GCX A;  4XTV A;  1Q81 C;  1Q81 U;  4JDS A;  2JZ2 A;  2L0A A;  2YUO A;  1W6X A;  3CC7 Q;  4C92 C;  2ESW A;  1ZX6 A; 
#chains in the Genus database with same CATH homology
 1V1C A;  4R0K A;  5FWC A;  2G6F X;  3A98 A;  1UTI A;  1GL5 A;  4OMN A;  2JS0 A;  2I0N A;  1Z9Q A;  2J05 A;  4J9F A;  3UF4 A;  1GFC A;  3M0S A;  3VS0 A;  1OPL A;  2ROL A;  4Z8A A;  1JXO A;  1X43 A;  1GFD A;  1UUE A;  1H92 A;  4LUD A;  1UGV A;  2JS2 A;  1S1N A;  2OJ2 A;  4E6R A;  1NLO C;  3TSW A;  4J9C A;  1UDL A;  1BK2 A;  3VRZ A;  2LMJ A;  2YDL A;  1K1Z A;  5GJV B;  1M3A A;  2KRN A;  3REA B;  5HCK A;  2RQV A;  4QT7 A;  2RN8 A;  1UFF A;  2DNU A;  2KR3 A;  2LP5 A;  4F17 A;  2DRK A;  3C0C A;  2V1Q A;  2RQT A;  1GCQ A;  3O5Z A;  2F2X A;  2JW4 A;  2KYB A;  3I5R A;  5I11 A;  2EYY A;  1X6G A;  2DMO A;  1AZG B;  1RI9 A;  2D0N A;  2CH4 W;  4HVW A;  2KRM A;  1JEG A;  1PRL C;  3PVL A;  4DEX A;  2CSQ A;  2A37 A;  1QWF A;  3M0P A;  2DM1 A;  1VA7 A;  2PZ1 A;  2EKH A;  2J6F A;  2CSI A;  3UA6 A;  2LCS A;  2EGA A;  3EG1 A;  2DL5 A;  2X3X D;  3EGU A;  4F14 A;  1TUD A;  4D8D A;  2O2O A;  4RTT A;  2C0T A;  4J9H A;  1SHF A;  1KIK A;  1TG0 A;  2JMC A;  2RF0 A;  1U06 A;  1MV3 A;  2NUZ A;  2RMO A;  1ZUY A;  4HCK A;  3SHW A;  4J9E A;  2EYZ A;  2KE9 A;  3H0F A;  2LQW A;  5ECA A;  2KEA A;  1WI7 A;  4GLM A;  4OML A;  1UJY A;  2FG0 A;  2ROT A;  4OMP A;  5IHK A;  2BTT A;  1PKT A;  1RLQ C;  3VS3 A;  5FW9 A;  3I35 A;  1X6B A;  4FSS A;  4F16 A;  4IIO A;  1ZBJ A;  1B07 A;  1PWT A;  2MOX A;  1ABO A;  4HVV A;  3ULR B;  1I1J A;  2O88 A;  1NYG A;  2KXD A;  2RQR A;  1T0H A;  1AWW A;  1X27 A;  1JO8 A;  1K76 A;  2KRO A;  1X2K A;  2LJ3 A;  3RBB B;  1KJW A;  2CH4 A;  1AOJ A;  1WFW A;  2LNH B;  1FMK A;  1UJ0 A;  1WX6 A;  1AVZ C;  2O31 A;  1X2Q A;  2DRM A;  2DYB A;  2MCN A;  2RQW A;  1CKA A;  1QCF A;  2KBT A;  1QWE A;  2DIL A;  2K79 A;  3CQT A;  2RNA A;  1NLP C;  1WXT A;  4HVU A;  2LZ6 B;  1NM7 A;  4A63 B;  2DBK A;  1UEC A;  1OV3 A;  2HEQ A;  1KFZ A;  1VYV A;  2KYM A;  1YNZ A;  2BZX A;  2MIO A;  3SEM A;  2YUN A;  1IO6 A;  2KRS A;  2GNC A;  2HBW A;  4LNP A;  5IXB A;  2CDT A;  4ZNX A;  3EHQ A;  2LQN A;  3ZL7 C;  4LUE A;  1QKX A;  3EG2 A;  1U5S A;  2EQI A;  2JM8 A;  4CC7 A;  4AFS C;  2ED1 A;  5L23 A;  1NG2 A;  1AWJ A;  4Z89 A;  2EVR A;  2ENM A;  2JXB A;  2ABL A;  1WXB A;  1PKS A;  5GJW B;  2EBP A;  5IHI A;  2W0Z A;  4Y92 A;  1GBQ A;  2ECZ A;  3PE0 A;  4EIK A;  1E7O A;  2YSQ A;  2D8J A;  2HDA A;  1PNJ A;  2J6O A;  2CRE A;  2K9G A;  3LH5 A;  1ZUK A;  5FWB A;  2XMF A;  3QWX X;  2JM9 A;  2IIM A;  1AEY A;  1H8K A;  1RLP C;  1M3C A;  2EYW A;  1QKW A;  1BB9 A;  1WXU A;  2J6K A;  2X3W D;  1WYX A;  2L2P A;  1HJD A;  4RUG A;  1W70 A;  4J9I A;  2L3S A;  2H8H A;  1VYT A;  3VS4 A;  4LE9 A;  1GBR A;  4JJD A;  2FPD A;  2VVK A;  3I9Q A;  1W1F A;  2PNI A;  2OAW A;  2K2M A;  4D8K A;  2DX1 A;  3REB B;  2K6D A;  2JT4 A;  3FJ5 A;  4GBQ A;  1M3B A;  2AKL A;  4WCI A;  2PTK A;  1SPK A;  4KRT A;  4AFZ C;  2FEI A;  3M0Q A;  1YCS B;  4JJB A;  5IHN A;  4ORZ A;  1AWO A;  4LN2 A;  2SEM A;  3IQL A;  1K0X A;  1BBZ A;  1Z9Z A;  2L3P A;  2O9V A;  2CT3 A;  4JZ4 A;  2FRY A;  2A28 A;  1WIE A;  2B86 A;  1QLY A;  1I07 A;  2GQI A;  2ED0 A;  2KNB B;  3NGP A;  4RTZ A;  3TSZ A;  1M30 A;  1NEG A;  2DL3 A;  1NEB A;  4IIM A;  4ESR A;  3UA7 A;  1PHT A;  2O9S A;  2YUQ A;  2EYX A;  2A36 A;  2HSP A;  2DA9 A;  1E6H A;  2YT6 A;  2DL4 A;  3H41 A;  2RPN A;  1H3H A;  2DVJ A;  1K4U S;  5IXF A;  2DLP A;  1SHG A;  3NMZ C;  2A08 A;  1T3L A;  2C0O A;  1YWP A;  2J06 A;  1GCQ C;  2AZS A;  4RTW A;  1Y0M A;  1M27 C;  1WLP B;  1ZLM A;  1UHF A;  2D1X A;  1YN8 A;  4JZ3 A;  2KT8 A;  2FRW A;  4OMO A;  2L3Q A;  5IH2 A;  4K11 A;  4AFU C;  3VRY A;  2GTJ A;  3VS6 A;  2JMA A;  4OMM A;  1G83 A;  2DE0 X;  1SSH A;  4JPB W;  2EGC A;  2EW3 A;  1Y57 A;  1OOT A;  2YUP A;  3H0H A;  1YWO A;  2CT4 A;  3M0T A;  3NHN A;  3TVT A;  1MUZ A;  1B3Q A;  1OEB A;  4OMQ A;  2C0I A;  2M0Y A;  3VS7 A;  1HSQ A;  2BZY A;  1KSW A;  2LJ1 A;  2K7A A;  1E6G A;  2KGT A;  2FO0 A;  1X69 A;  1SEM A;  2BZ8 A;  2P4R A;  2DBM A;  2RQU A;  1T0J A;  1JXM A;  1AD5 A;  2LX7 A;  1ARK A;  2DL8 A;  2GGR A;  1WA7 A;  1K0S A;  2HCK A;  1CKB A;  4CC3 A;  2CUB A;  1ABQ A;  2K3B A;  4J9G A;  1AZE A;  2DL7 A;  1J3T A;  4CC4 B;  4DEY A;  4AG2 C;  1T3S A;  1ZUU A;  2DF6 A;  1UG1 A;  3U23 A;  2F2V A;  4RTU A;  1UHC A;  3THK A;  3M0R A;  4JJC A;  1K9A A;  1TUC A;  3NPF A;  4RTY A;  1G2B A;  1RUW A;  2F2W A;  2V1R A;  2E5K A;  1MV0 B;  3EHR A;  1U3O A;  1BU1 A;  4Z88 A;  1GRI A;  5EC7 A;  1HD3 A;  2FPE A;  3JV3 A;  2EGE A;  4AFQ C;  4M4Z A;  1PRM C;  3M0U A;  4CC2 A;  1EFN A;  1SRM A;  2AZV A;  1A0N B;  4RTX A;  3KFV A;  2KXC A;  2QDL A;  1WDX A;  2AKK A;  3EG3 A;  3RNJ A;  2DJQ A;  4J9D A;  1YP5 A;  4J9B A;  3QWY A;  2LJ0 A;  2W10 A;  2AK5 A;  2VKN A;  1JU5 C;  2SRC A;  1UE9 A;  4HXJ A;  3R6N A;  1NYF A;  1OPK A;  2GBQ A;  2KT1 A;  3GBQ A;  1ZSG A;  1VYU A;  3VS5 A;  1I0C A;  2NWM A;  2EPD A;  5I22 A;  2GTO A;  3VS2 A;  1XOV A;  3VS1 A;  3PVQ A;  2J7I A;  2JTE A;  1JQQ A;  1FYN A;  4RTV A;  2M51 A;  1N5Z A;  2CUD A;  1SRL A;  1LCK A;  4X1V A;  4AG1 C;  1GCP A;  1AWX A;  3EG0 A;  3UAT A;  1M8M A;  2L0A A;  3H0I A;  2YUO A;  1W6X A;  2VWF A;  1CSK A;  2ESW A;  2OI3 A;  2FPF A;  1ZX6 A;  3I5S A;  2D8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...