1K2MA

Solution structure of the fha2 domain of rad53 complexed with a phosphotyrosyl peptide derived from rad9
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
b'GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Kinase SPK1
publication title Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 24
structure length 158
sequence length 158
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1k2mA00
3ELVA 2JPEA 1J4KA 1R21A 4QCJA 2JKDA 2JQJA 2EH0A 1WLNA 3UV0A 2XT9B 1LGPA 3VA1A 1YJMA 4A0EA 4D9VA 1J4LA 1J4OA 1LGQA 2PIEA 2AFFA 2W3OA 4JONA 3UOTA 2G1LA 2JQLA 1G3GA 3VPYA 1MZKA 1K2MA 3ELSA 1K3JA 3MDBA 2FEZA 2KB4A 3POAA 2KFUA 2KB3A 2BRFA 3I0MA 4EJQA 1K3QA 5E50A 2A0TA 3HUEA 1FHRA 3KT9A 1UJXA 2KKLA 3UNNA 1J4QA 1UHTA 3VA4A 1DMZA 1QU5A 3I0NA 1YJ5C 1FHQA 4G2SA 3I6WA 3UN0A 2FF4A 1GXCA 3GQSA 2JQIA 3PO8A 4H87A 1K2NA 3UNMA 1WV3A 3UMZA 3I6UA 1G6GA 3HX1A 1K3NA 2CSWA 3HUFA 2LC1A 1J4PA 3FM8A 5A8IA 3OUNA 4EGXA 5DJOA
chains in the Genus database with same CATH superfamily
3ELVA 1U7FB 5DHPA 2JPEA 1J4KA 5JEJA 1R21A 2QV7A 2P1RA 1U7FA 5DHUA 4QCJA 2JKDA 1U0RA 2JQJA 2EH0A 1DEVA 1WLNA 3UV0A 1MR1A 2XT9B 1LGPA 4V24A 3VA1A 1YJMA 4A0EA 4D9VA 3VZDA 1J4LA 1J4OA 3V7YA 1LGQA 4WRRA 2PIEA 3T5PA 2AFFA 2W3OA 4JONA 3UOTA 5JEKA 2G1LA 2JQLA 3A77A 1G3GA 3VPYA 2BONA 4L02A 3DITA 5DHQA 1MZKA 1K2MA 3ELSA 1K3JA 3MDBA 4KU0D 2FEZA 2KB4A 3V8RA 3POAA 2KFUA 2KB3A 5DHRA 2Q5FA 2BRFA 2AN1A 3VZCA 3I0MA 4EJQA 1KHUA 1K3QA 3AFOA 1QWTA 4JIVD 5E50A 2A0TA 3HUEA 1FHRA 3KT9A 1UJXA 5DHTA 5JEOA 2XXSA 2KKLA 1YT5A 5JEMA 2I29A 2I2FA 3UNNA 1Y3IA 2JGRA 1MK2A 5JERA 5EJFA 5EJHA 1J4QA 1Y3HA 1UHTA 3VA4A 5DHSA 3V7WA 1DMZA 1SUWA 1QU5A 3I0NA 2I1WA 5JELA 1YJ5C 3V8NA 1FHQA 2QVLA 1J2FA 4G2SA 3DSHA 3I6WA 2I2CA 4HAOA 1U7VB 3UN0A 2FF4A 1DD1A 1KHXA 3V80A 3VZBA 1GXCA 2I2DA 3GMJA 3GQSA 2JQIA 3PO8A 4H87A 1MJSA 3S40A 2I2BA 5C4VA 1Z0ZA 1Z0UA 1K2NA 3V8QA 5EJGA 3UNMA 1WV3A 3PFNA 4R9PA 3UMZA 3I6UA 1G6GA 3V7UA 3HX1A 5BVIA 1K3NA 2CSWA 1YGSA 3HUFA 4A4YA 4DY6A 2LC1A 1U0TA 1J4PA 3V8PA 1ZOQA 1Z0SA 5EJIA 3FM8A 5A8IA 2I2AA 3OUNA 4WERA 4JIWD 1G88A 1U7VA 3V8MA 4EGXA 5DJOA
chains in the Genus database with same CATH topology
3ELVA 1U7FB 2JPEA 1J4KA 5JEJA 1R21A 2QV7A 2P1RA 1U7FA 4QCJA 2JKDA 2JQJA 2EH0A 1DEVA 1WLNA 3UV0A 1MR1A 2XT9B 1LGPA 4V24A 3VA1A 1YJMA 4A0EA 4D9VA 3VZDA 1J4LA 1J4OA 1LGQA 4WRRA 2PIEA 3T5PA 2AFFA 2W3OA 4JONA 3UOTA 5JEKA 2G1LA 2JQLA 3A77A 1G3GA 3VPYA 2BONA 4L02A 3DITA 1MZKA 1K2MA 3ELSA 1K3JA 3MDBA 4KU0D 2FEZA 2KB4A 3POAA 2KFUA 2KB3A 2BRFA 3VZCA 3I0MA 4EJQA 1KHUA 1K3QA 4JIVD 1QWTA 5E50A 2A0TA 3HUEA 1FHRA 3KT9A 1UJXA 5JEOA 2XXSA 2KKLA 5JEMA 3UNNA 2JGRA 1MK2A 5JERA 1J4QA 1UHTA 3VA4A 1DMZA 1QU5A 3I0NA 5JELA 1YJ5C 1FHQA 2QVLA 1J2FA 4G2SA 3DSHA 3I6WA 1U7VB 3UN0A 2FF4A 1DD1A 1KHXA 3VZBA 1GXCA 3GMJA 3GQSA 2JQIA 3PO8A 4H87A 1MJSA 3S40A 5C4VA 1K2NA 3UNMA 1WV3A 4R9PA 3UMZA 3I6UA 1G6GA 3HX1A 5BVIA 1K3NA 2CSWA 1YGSA 3HUFA 4A4YA 2LC1A 1J4PA 1ZOQA 3FM8A 5A8IA 3OUNA 4WERA 4JIWD 1G88A 1U7VA 4EGXA 5DJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ELV A;  2JPE A;  1J4K A;  1R21 A;  4QCJ A;  2JKD A;  2JQJ A;  2EH0 A;  1WLN A;  3UV0 A;  2XT9 B;  1LGP A;  3VA1 A;  1YJM A;  4A0E A;  4D9V A;  1J4L A;  1J4O A;  1LGQ A;  2PIE A;  2AFF A;  2W3O A;  4JON A;  3UOT A;  2G1L A;  2JQL A;  1G3G A;  3VPY A;  1MZK A;  1K2M A;  3ELS A;  1K3J A;  3MDB A;  2FEZ A;  2KB4 A;  3POA A;  2KFU A;  2KB3 A;  2BRF A;  3I0M A;  4EJQ A;  1K3Q A;  5E50 A;  2A0T A;  3HUE A;  1FHR A;  3KT9 A;  1UJX A;  2KKL A;  3UNN A;  1J4Q A;  1UHT A;  3VA4 A;  1DMZ A;  1QU5 A;  3I0N A;  1YJ5 C;  1FHQ A;  4G2S A;  3I6W A;  3UN0 A;  2FF4 A;  1GXC A;  3GQS A;  2JQI A;  3PO8 A;  4H87 A;  1K2N A;  3UNM A;  1WV3 A;  3UMZ A;  3I6U A;  1G6G A;  3HX1 A;  1K3N A;  2CSW A;  3HUF A;  2LC1 A;  1J4P A;  3FM8 A;  5A8I A;  3OUN A;  4EGX A;  5DJO A; 
#chains in the Genus database with same CATH topology
 3ELV A;  1U7F B;  5DHP A;  2JPE A;  1J4K A;  5JEJ A;  1R21 A;  2QV7 A;  2P1R A;  1U7F A;  5DHU A;  4QCJ A;  2JKD A;  1U0R A;  2JQJ A;  2EH0 A;  1DEV A;  1WLN A;  3UV0 A;  1MR1 A;  2XT9 B;  1LGP A;  4V24 A;  3VA1 A;  1YJM A;  4A0E A;  4D9V A;  3VZD A;  1J4L A;  1J4O A;  3V7Y A;  1LGQ A;  4WRR A;  2PIE A;  3T5P A;  2AFF A;  2W3O A;  4JON A;  3UOT A;  5JEK A;  2G1L A;  2JQL A;  3A77 A;  1G3G A;  3VPY A;  2BON A;  4L02 A;  3DIT A;  5DHQ A;  1MZK A;  1K2M A;  3ELS A;  1K3J A;  3MDB A;  4KU0 D;  2FEZ A;  2KB4 A;  3V8R A;  3POA A;  2KFU A;  2KB3 A;  5DHR A;  2Q5F A;  2BRF A;  2AN1 A;  3VZC A;  3I0M A;  4EJQ A;  1KHU A;  1K3Q A;  3AFO A;  1QWT A;  4JIV D;  5E50 A;  2A0T A;  3HUE A;  1FHR A;  3KT9 A;  1UJX A;  5DHT A;  5JEO A;  2XXS A;  2KKL A;  1YT5 A;  5JEM A;  2I29 A;  2I2F A;  3UNN A;  1Y3I A;  2JGR A;  1MK2 A;  5JER A;  5EJF A;  5EJH A;  1J4Q A;  1Y3H A;  1UHT A;  3VA4 A;  5DHS A;  3V7W A;  1DMZ A;  1SUW A;  1QU5 A;  3I0N A;  2I1W A;  5JEL A;  1YJ5 C;  3V8N A;  1FHQ A;  2QVL A;  1J2F A;  4G2S A;  3DSH A;  3I6W A;  2I2C A;  4HAO A;  1U7V B;  3UN0 A;  2FF4 A;  1DD1 A;  1KHX A;  3V80 A;  3VZB A;  1GXC A;  2I2D A;  3GMJ A;  3GQS A;  2JQI A;  3PO8 A;  4H87 A;  1MJS A;  3S40 A;  2I2B A;  5C4V A;  1Z0Z A;  1Z0U A;  1K2N A;  3V8Q A;  5EJG A;  3UNM A;  1WV3 A;  3PFN A;  4R9P A;  3UMZ A;  3I6U A;  1G6G A;  3V7U A;  3HX1 A;  5BVI A;  1K3N A;  2CSW A;  1YGS A;  3HUF A;  4A4Y A;  4DY6 A;  2LC1 A;  1U0T A;  1J4P A;  3V8P A;  1ZOQ A;  1Z0S A;  5EJI A;  3FM8 A;  5A8I A;  2I2A A;  3OUN A;  4WER A;  4JIW D;  1G88 A;  1U7V A;  3V8M A;  4EGX A;  5DJO A; 
#chains in the Genus database with same CATH homology
 3ELV A;  1U7F B;  2JPE A;  1J4K A;  5JEJ A;  1R21 A;  2QV7 A;  2P1R A;  1U7F A;  4QCJ A;  2JKD A;  2JQJ A;  2EH0 A;  1DEV A;  1WLN A;  3UV0 A;  1MR1 A;  2XT9 B;  1LGP A;  4V24 A;  3VA1 A;  1YJM A;  4A0E A;  4D9V A;  3VZD A;  1J4L A;  1J4O A;  1LGQ A;  4WRR A;  2PIE A;  3T5P A;  2AFF A;  2W3O A;  4JON A;  3UOT A;  5JEK A;  2G1L A;  2JQL A;  3A77 A;  1G3G A;  3VPY A;  2BON A;  4L02 A;  3DIT A;  1MZK A;  1K2M A;  3ELS A;  1K3J A;  3MDB A;  4KU0 D;  2FEZ A;  2KB4 A;  3POA A;  2KFU A;  2KB3 A;  2BRF A;  3VZC A;  3I0M A;  4EJQ A;  1KHU A;  1K3Q A;  4JIV D;  1QWT A;  5E50 A;  2A0T A;  3HUE A;  1FHR A;  3KT9 A;  1UJX A;  5JEO A;  2XXS A;  2KKL A;  5JEM A;  3UNN A;  2JGR A;  1MK2 A;  5JER A;  1J4Q A;  1UHT A;  3VA4 A;  1DMZ A;  1QU5 A;  3I0N A;  5JEL A;  1YJ5 C;  1FHQ A;  2QVL A;  1J2F A;  4G2S A;  3DSH A;  3I6W A;  1U7V B;  3UN0 A;  2FF4 A;  1DD1 A;  1KHX A;  3VZB A;  1GXC A;  3GMJ A;  3GQS A;  2JQI A;  3PO8 A;  4H87 A;  1MJS A;  3S40 A;  5C4V A;  1K2N A;  3UNM A;  1WV3 A;  4R9P A;  3UMZ A;  3I6U A;  1G6G A;  3HX1 A;  5BVI A;  1K3N A;  2CSW A;  1YGS A;  3HUF A;  4A4Y A;  2LC1 A;  1J4P A;  1ZOQ A;  3FM8 A;  5A8I A;  3OUN A;  4WER A;  4JIW D;  1G88 A;  1U7V A;  4EGX A;  5DJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...