1K2NA

Solution structure of the fha2 domain of rad53 complexed with a phosphothreonyl peptide derived from rad9
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
158
structure length
158
Chain Sequence
b'GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Kinase SPK1
publication title Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 22
structure length 158
sequence length 158
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1k2nA00
2LC1A 1WLNA 1G3GA 4D9VA 2EH0A 3VA1A 2W3OA 1QU5A 1YJ5C 3I6UA 1J4PA 3ELVA 3UMZA 3KT9A 1YJMA 4QCJA 1J4LA 1FHRA 1J4OA 3ELSA 3I6WA 5A8IA 4EJQA 3HX1A 3I0MA 1G6GA 2JQJA 1LGPA 1GXCA 4JONA 3HUFA 2JQIA 1K3NA 3VA4A 4H87A 1K3JA 4A0EA 2JPEA 1J4QA 3HUEA 2FF4A 5DJOA 1DMZA 4EGXA 3I0NA 3UNMA 1UHTA 2JKDA 2XT9B 2KB3A 1FHQA 1UJXA 3MDBA 1K2MA 2A0TA 2KFUA 1J4KA 3FM8A 3UNNA 2KB4A 1MZKA 2KKLA 1WV3A 3OUNA 3UV0A 2BRFA 1R21A 3UN0A 2AFFA 3PO8A 3UOTA 2JQLA 3POAA 2CSWA 2PIEA 5E50A 3VPYA 2G1LA 1K2NA 2FEZA 4G2SA 1LGQA 1K3QA 3GQSA
chains in the Genus database with same CATH superfamily
4WRRA 2LC1A 1WLNA 1G3GA 1Y3IA 1U7FA 4D9VA 2I29A 3A77A 2QV7A 4HAOA 2EH0A 2XXSA 3GMJA 5JEKA 5EJGA 3VA1A 2W3OA 1Z0ZA 1QU5A 1YJ5C 4WERA 3I6UA 5DHRA 1J4PA 3ELVA 5BVIA 3UMZA 3KT9A 1YJMA 4QCJA 1J4LA 1FHRA 1J4OA 3V80A 3ELSA 3V7YA 3I6WA 5A8IA 5JEOA 2I2BA 4EJQA 1KHXA 5DHUA 2P1RA 3HX1A 3V7WA 4KU0D 1U0RA 1ZOQA 1G6GA 3I0MA 5DHPA 1G88A 3T5PA 2JQJA 1LGPA 1GXCA 4JONA 4L02A 3HUFA 5EJIA 2JQIA 1K3NA 3V8PA 3VA4A 4H87A 1K3JA 4A0EA 2JPEA 3S40A 4R9PA 1J4QA 2Q5FA 4JIVD 1MK2A 1Z0SA 3HUEA 2QVLA 2FF4A 5DHQA 5DJOA 3VZBA 3AFOA 1DMZA 4EGXA 3VZDA 2I1WA 3I0NA 3UNMA 1UHTA 2JKDA 1MR1A 2XT9B 2KB3A 3V8NA 1FHQA 1UJXA 3MDBA 5JELA 2A0TA 1K2MA 2I2AA 2KFUA 1J4KA 2I2CA 3V7UA 3FM8A 5DHSA 5JEMA 1YGSA 1KHUA 3VZCA 3V8MA 3UNNA 1YT5A 2KB4A 1DEVA 3DITA 1MZKA 2KKLA 4A4YA 2I2DA 1WV3A 4V24A 2AN1A 3V8RA 1MJSA 5C4VA 3OUNA 3UV0A 1U7FB 5DHTA 2BRFA 1R21A 3DSHA 3UN0A 5JERA 2AFFA 3PO8A 4DY6A 5EJFA 2JGRA 3UOTA 2BONA 2JQLA 3POAA 1U0TA 2CSWA 1Y3HA 2PIEA 5E50A 3V8QA 5EJHA 1SUWA 2I2FA 1U7VB 1J2FA 1DD1A 1QWTA 1U7VA 2G1LA 3VPYA 1K2NA 1Z0UA 2FEZA 4G2SA 1LGQA 3PFNA 4JIWD 1K3QA 3GQSA 5JEJA
chains in the Genus database with same CATH topology
4WRRA 2LC1A 1WLNA 1G3GA 1U7FA 4D9VA 3A77A 2QV7A 2EH0A 2XXSA 3GMJA 5JEKA 3VA1A 2W3OA 4WERA 1QU5A 1YJ5C 3I6UA 1J4PA 3ELVA 5BVIA 3UMZA 3KT9A 1YJMA 4QCJA 1J4LA 1FHRA 1J4OA 3ELSA 3I6WA 5A8IA 5JEOA 4EJQA 1KHXA 3HX1A 2P1RA 4KU0D 1ZOQA 1G6GA 3I0MA 1G88A 3T5PA 2JQJA 1LGPA 1GXCA 4JONA 4L02A 3HUFA 2JQIA 1K3NA 3VA4A 4H87A 1K3JA 4A0EA 2JPEA 3S40A 4R9PA 1J4QA 4JIVD 1MK2A 3HUEA 2QVLA 2FF4A 5DJOA 3VZBA 1DMZA 4EGXA 3VZDA 3I0NA 3UNMA 1UHTA 2JKDA 1MR1A 2XT9B 2KB3A 1FHQA 1UJXA 3MDBA 5JELA 2A0TA 1K2MA 2KFUA 1J4KA 3FM8A 5JEMA 1YGSA 1KHUA 3VZCA 3UNNA 2KB4A 1DEVA 3DITA 1MZKA 2KKLA 4A4YA 4V24A 1WV3A 1MJSA 5C4VA 3OUNA 3UV0A 1U7FB 2BRFA 1R21A 3DSHA 3UN0A 5JERA 2AFFA 3PO8A 3UOTA 2JGRA 2BONA 2JQLA 3POAA 2CSWA 2PIEA 5E50A 1U7VB 1J2FA 1DD1A 1QWTA 1U7VA 3VPYA 2G1LA 1K2NA 2FEZA 4G2SA 1LGQA 4JIWD 1K3QA 3GQSA 5JEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LC1 A;  1WLN A;  1G3G A;  4D9V A;  2EH0 A;  3VA1 A;  2W3O A;  1QU5 A;  1YJ5 C;  3I6U A;  1J4P A;  3ELV A;  3UMZ A;  3KT9 A;  1YJM A;  4QCJ A;  1J4L A;  1FHR A;  1J4O A;  3ELS A;  3I6W A;  5A8I A;  4EJQ A;  3HX1 A;  3I0M A;  1G6G A;  2JQJ A;  1LGP A;  1GXC A;  4JON A;  3HUF A;  2JQI A;  1K3N A;  3VA4 A;  4H87 A;  1K3J A;  4A0E A;  2JPE A;  1J4Q A;  3HUE A;  2FF4 A;  5DJO A;  1DMZ A;  4EGX A;  3I0N A;  3UNM A;  1UHT A;  2JKD A;  2XT9 B;  2KB3 A;  1FHQ A;  1UJX A;  3MDB A;  1K2M A;  2A0T A;  2KFU A;  1J4K A;  3FM8 A;  3UNN A;  2KB4 A;  1MZK A;  2KKL A;  1WV3 A;  3OUN A;  3UV0 A;  2BRF A;  1R21 A;  3UN0 A;  2AFF A;  3PO8 A;  3UOT A;  2JQL A;  3POA A;  2CSW A;  2PIE A;  5E50 A;  3VPY A;  2G1L A;  1K2N A;  2FEZ A;  4G2S A;  1LGQ A;  1K3Q A;  3GQS A; 
#chains in the Genus database with same CATH topology
 4WRR A;  2LC1 A;  1WLN A;  1G3G A;  1Y3I A;  1U7F A;  4D9V A;  2I29 A;  3A77 A;  2QV7 A;  4HAO A;  2EH0 A;  2XXS A;  3GMJ A;  5JEK A;  5EJG A;  3VA1 A;  2W3O A;  1Z0Z A;  1QU5 A;  1YJ5 C;  4WER A;  3I6U A;  5DHR A;  1J4P A;  3ELV A;  5BVI A;  3UMZ A;  3KT9 A;  1YJM A;  4QCJ A;  1J4L A;  1FHR A;  1J4O A;  3V80 A;  3ELS A;  3V7Y A;  3I6W A;  5A8I A;  5JEO A;  2I2B A;  4EJQ A;  1KHX A;  5DHU A;  2P1R A;  3HX1 A;  3V7W A;  4KU0 D;  1U0R A;  1ZOQ A;  1G6G A;  3I0M A;  5DHP A;  1G88 A;  3T5P A;  2JQJ A;  1LGP A;  1GXC A;  4JON A;  4L02 A;  3HUF A;  5EJI A;  2JQI A;  1K3N A;  3V8P A;  3VA4 A;  4H87 A;  1K3J A;  4A0E A;  2JPE A;  3S40 A;  4R9P A;  1J4Q A;  2Q5F A;  4JIV D;  1MK2 A;  1Z0S A;  3HUE A;  2QVL A;  2FF4 A;  5DHQ A;  5DJO A;  3VZB A;  3AFO A;  1DMZ A;  4EGX A;  3VZD A;  2I1W A;  3I0N A;  3UNM A;  1UHT A;  2JKD A;  1MR1 A;  2XT9 B;  2KB3 A;  3V8N A;  1FHQ A;  1UJX A;  3MDB A;  5JEL A;  2A0T A;  1K2M A;  2I2A A;  2KFU A;  1J4K A;  2I2C A;  3V7U A;  3FM8 A;  5DHS A;  5JEM A;  1YGS A;  1KHU A;  3VZC A;  3V8M A;  3UNN A;  1YT5 A;  2KB4 A;  1DEV A;  3DIT A;  1MZK A;  2KKL A;  4A4Y A;  2I2D A;  1WV3 A;  4V24 A;  2AN1 A;  3V8R A;  1MJS A;  5C4V A;  3OUN A;  3UV0 A;  1U7F B;  5DHT A;  2BRF A;  1R21 A;  3DSH A;  3UN0 A;  5JER A;  2AFF A;  3PO8 A;  4DY6 A;  5EJF A;  2JGR A;  3UOT A;  2BON A;  2JQL A;  3POA A;  1U0T A;  2CSW A;  1Y3H A;  2PIE A;  5E50 A;  3V8Q A;  5EJH A;  1SUW A;  2I2F A;  1U7V B;  1J2F A;  1DD1 A;  1QWT A;  1U7V A;  2G1L A;  3VPY A;  1K2N A;  1Z0U A;  2FEZ A;  4G2S A;  1LGQ A;  3PFN A;  4JIW D;  1K3Q A;  3GQS A;  5JEJ A; 
#chains in the Genus database with same CATH homology
 4WRR A;  2LC1 A;  1WLN A;  1G3G A;  1U7F A;  4D9V A;  3A77 A;  2QV7 A;  2EH0 A;  2XXS A;  3GMJ A;  5JEK A;  3VA1 A;  2W3O A;  4WER A;  1QU5 A;  1YJ5 C;  3I6U A;  1J4P A;  3ELV A;  5BVI A;  3UMZ A;  3KT9 A;  1YJM A;  4QCJ A;  1J4L A;  1FHR A;  1J4O A;  3ELS A;  3I6W A;  5A8I A;  5JEO A;  4EJQ A;  1KHX A;  3HX1 A;  2P1R A;  4KU0 D;  1ZOQ A;  1G6G A;  3I0M A;  1G88 A;  3T5P A;  2JQJ A;  1LGP A;  1GXC A;  4JON A;  4L02 A;  3HUF A;  2JQI A;  1K3N A;  3VA4 A;  4H87 A;  1K3J A;  4A0E A;  2JPE A;  3S40 A;  4R9P A;  1J4Q A;  4JIV D;  1MK2 A;  3HUE A;  2QVL A;  2FF4 A;  5DJO A;  3VZB A;  1DMZ A;  4EGX A;  3VZD A;  3I0N A;  3UNM A;  1UHT A;  2JKD A;  1MR1 A;  2XT9 B;  2KB3 A;  1FHQ A;  1UJX A;  3MDB A;  5JEL A;  2A0T A;  1K2M A;  2KFU A;  1J4K A;  3FM8 A;  5JEM A;  1YGS A;  1KHU A;  3VZC A;  3UNN A;  2KB4 A;  1DEV A;  3DIT A;  1MZK A;  2KKL A;  4A4Y A;  4V24 A;  1WV3 A;  1MJS A;  5C4V A;  3OUN A;  3UV0 A;  1U7F B;  2BRF A;  1R21 A;  3DSH A;  3UN0 A;  5JER A;  2AFF A;  3PO8 A;  3UOT A;  2JGR A;  2BON A;  2JQL A;  3POA A;  2CSW A;  2PIE A;  5E50 A;  1U7V B;  1J2F A;  1DD1 A;  1QWT A;  1U7V A;  3VPY A;  2G1L A;  1K2N A;  2FEZ A;  4G2S A;  1LGQ A;  4JIW D;  1K3Q A;  3GQS A;  5JEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...