1K3JA

Refined nmr structure of the fha1 domain of yeast rad53
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
151
Chain Sequence
b'ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Kinase SPK1
publication title Solution structures of two FHA1-phosphothreonine peptide complexes provide insight into the structural basis of the ligand specificity of FHA1 from yeast Rad53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 25
structure length 151
sequence length 151
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1k3jA00
1LGPA 2KB4A 2G1LA 4EGXA 2KFUA 3VA1A 3ELSA 1K2MA 2JKDA 3KT9A 2JQJA 1UHTA 2FF4A 1MZKA 3I0NA 2JPEA 2XT9B 3UMZA 3MDBA 1YJ5C 3FM8A 4A0EA 1G3GA 2BRFA 4H87A 3HX1A 1G6GA 2LC1A 3I6UA 3UOTA 4G2SA 2EH0A 1WV3A 5DJOA 3VA4A 2CSWA 3I0MA 3GQSA 1GXCA 2W3OA 2FEZA 5E50A 1K3NA 1LGQA 4D9VA 3I6WA 4JONA 1K3QA 1J4LA 2JQLA 1J4OA 2PIEA 3UNNA 2KB3A 3HUEA 1FHRA 1K2NA 3UN0A 3PO8A 1R21A 1J4QA 4QCJA 1K3JA 3UNMA 3OUNA 2A0TA 3POAA 1FHQA 1J4KA 1UJXA 1YJMA 1WLNA 3VPYA 5A8IA 1DMZA 2KKLA 3UV0A 2JQIA 2AFFA 1QU5A 3HUFA 3ELVA 1J4PA 4EJQA
chains in the Genus database with same CATH superfamily
1LGPA 2KB4A 2G1LA 4EGXA 2KFUA 1SUWA 2AN1A 2XXSA 2BONA 1KHXA 3ELSA 1K2MA 2JKDA 5DHUA 3KT9A 2P1RA 3V8QA 2I2FA 1KHUA 1UHTA 2JQJA 2FF4A 5JEMA 1U7VB 5EJIA 5EJFA 1MR1A 1MJSA 1MZKA 2JGRA 3I0NA 2JPEA 5EJHA 3VZBA 5EJGA 5JEKA 2XT9B 3UMZA 1U0TA 3MDBA 1U7VA 1U7FA 4HAOA 3VZDA 5JERA 2I29A 1YJ5C 1G88A 5JEJA 2I2AA 3FM8A 4JIWD 4A0EA 4JIVD 5DHQA 1G3GA 2BRFA 4H87A 3HX1A 1G6GA 2LC1A 3I6UA 3UOTA 4G2SA 2EH0A 4WERA 2Q5FA 1WV3A 5DJOA 3VA4A 1Z0ZA 1U0RA 2CSWA 1YT5A 3V7YA 2QV7A 3I0MA 3GQSA 2I2BA 1Y3HA 1GXCA 5DHRA 4R9PA 3T5PA 2W3OA 3V8PA 1DD1A 1QWTA 2FEZA 5C4VA 5E50A 3V8NA 1K3NA 3V7WA 1LGQA 2I1WA 3AFOA 3I6WA 4D9VA 1Y3IA 1Z0SA 1ZOQA 4JONA 1K3QA 1J4LA 2JQLA 5DHPA 5DHSA 1J4OA 2PIEA 3UNNA 1Z0UA 2KB3A 5DHTA 3HUEA 4DY6A 1FHRA 3PFNA 1K2NA 3UN0A 2I2CA 3PO8A 1YGSA 3A77A 4A4YA 2QVLA 1R21A 1J4QA 4QCJA 1K3JA 3GMJA 3UNMA 4V24A 3DSHA 5BVIA 3OUNA 2A0TA 3POAA 4EJQA 1MK2A 4L02A 3V80A 1FHQA 1J4KA 4WRRA 5JELA 1UJXA 1YJMA 3V8MA 3VZCA 1U7FB 3DITA 2I2DA 3V7UA 5JEOA 1WLNA 3V8RA 3VPYA 5A8IA 1DMZA 2KKLA 3UV0A 2JQIA 4KU0D 1DEVA 2AFFA 1QU5A 3S40A 3HUFA 1J2FA 3ELVA 1J4PA 3VA1A
chains in the Genus database with same CATH topology
1LGPA 2KB4A 2G1LA 4EGXA 2KFUA 2XXSA 2BONA 1KHXA 3ELSA 1K2MA 2JKDA 3KT9A 2P1RA 1KHUA 1UHTA 2JQJA 2FF4A 5JEMA 1U7VB 1MR1A 1MJSA 1MZKA 2JGRA 3I0NA 2JPEA 3VZBA 5JEKA 2XT9B 3UMZA 3MDBA 3VZDA 1U7VA 1U7FA 5JERA 1YJ5C 1G88A 5JEJA 3FM8A 4JIWD 4A0EA 4JIVD 1G3GA 2BRFA 4H87A 3HX1A 1G6GA 2LC1A 3I6UA 3UOTA 4G2SA 2EH0A 4WERA 1WV3A 5DJOA 3VA4A 2CSWA 2QV7A 3I0MA 3GQSA 1GXCA 4R9PA 3T5PA 2W3OA 1DD1A 1QWTA 2FEZA 5C4VA 5E50A 1K3NA 1LGQA 4D9VA 3I6WA 1ZOQA 4JONA 1K3QA 1J4LA 2JQLA 1J4OA 2PIEA 3UNNA 2KB3A 3HUEA 1FHRA 1K2NA 3UN0A 3PO8A 1YGSA 3A77A 4A4YA 2QVLA 1R21A 1J4QA 4QCJA 1K3JA 3GMJA 3UNMA 4V24A 3DSHA 5BVIA 3OUNA 2A0TA 3POAA 4EJQA 1MK2A 4L02A 1FHQA 1J4KA 4WRRA 5JELA 1UJXA 1YJMA 3VZCA 1U7FB 3DITA 5JEOA 1WLNA 3VPYA 5A8IA 1DMZA 2KKLA 3UV0A 2JQIA 4KU0D 1DEVA 2AFFA 1QU5A 3S40A 3HUFA 1J2FA 3ELVA 1J4PA 3VA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LGP A;  2KB4 A;  2G1L A;  4EGX A;  2KFU A;  3VA1 A;  3ELS A;  1K2M A;  2JKD A;  3KT9 A;  2JQJ A;  1UHT A;  2FF4 A;  1MZK A;  3I0N A;  2JPE A;  2XT9 B;  3UMZ A;  3MDB A;  1YJ5 C;  3FM8 A;  4A0E A;  1G3G A;  2BRF A;  4H87 A;  3HX1 A;  1G6G A;  2LC1 A;  3I6U A;  3UOT A;  4G2S A;  2EH0 A;  1WV3 A;  5DJO A;  3VA4 A;  2CSW A;  3I0M A;  3GQS A;  1GXC A;  2W3O A;  2FEZ A;  5E50 A;  1K3N A;  1LGQ A;  4D9V A;  3I6W A;  4JON A;  1K3Q A;  1J4L A;  2JQL A;  1J4O A;  2PIE A;  3UNN A;  2KB3 A;  3HUE A;  1FHR A;  1K2N A;  3UN0 A;  3PO8 A;  1R21 A;  1J4Q A;  4QCJ A;  1K3J A;  3UNM A;  3OUN A;  2A0T A;  3POA A;  1FHQ A;  1J4K A;  1UJX A;  1YJM A;  1WLN A;  3VPY A;  5A8I A;  1DMZ A;  2KKL A;  3UV0 A;  2JQI A;  2AFF A;  1QU5 A;  3HUF A;  3ELV A;  1J4P A;  4EJQ A; 
#chains in the Genus database with same CATH topology
 1LGP A;  2KB4 A;  2G1L A;  4EGX A;  2KFU A;  1SUW A;  2AN1 A;  2XXS A;  2BON A;  1KHX A;  3ELS A;  1K2M A;  2JKD A;  5DHU A;  3KT9 A;  2P1R A;  3V8Q A;  2I2F A;  1KHU A;  1UHT A;  2JQJ A;  2FF4 A;  5JEM A;  1U7V B;  5EJI A;  5EJF A;  1MR1 A;  1MJS A;  1MZK A;  2JGR A;  3I0N A;  2JPE A;  5EJH A;  3VZB A;  5EJG A;  5JEK A;  2XT9 B;  3UMZ A;  1U0T A;  3MDB A;  1U7V A;  1U7F A;  4HAO A;  3VZD A;  5JER A;  2I29 A;  1YJ5 C;  1G88 A;  5JEJ A;  2I2A A;  3FM8 A;  4JIW D;  4A0E A;  4JIV D;  5DHQ A;  1G3G A;  2BRF A;  4H87 A;  3HX1 A;  1G6G A;  2LC1 A;  3I6U A;  3UOT A;  4G2S A;  2EH0 A;  4WER A;  2Q5F A;  1WV3 A;  5DJO A;  3VA4 A;  1Z0Z A;  1U0R A;  2CSW A;  1YT5 A;  3V7Y A;  2QV7 A;  3I0M A;  3GQS A;  2I2B A;  1Y3H A;  1GXC A;  5DHR A;  4R9P A;  3T5P A;  2W3O A;  3V8P A;  1DD1 A;  1QWT A;  2FEZ A;  5C4V A;  5E50 A;  3V8N A;  1K3N A;  3V7W A;  1LGQ A;  2I1W A;  3AFO A;  3I6W A;  4D9V A;  1Y3I A;  1Z0S A;  1ZOQ A;  4JON A;  1K3Q A;  1J4L A;  2JQL A;  5DHP A;  5DHS A;  1J4O A;  2PIE A;  3UNN A;  1Z0U A;  2KB3 A;  5DHT A;  3HUE A;  4DY6 A;  1FHR A;  3PFN A;  1K2N A;  3UN0 A;  2I2C A;  3PO8 A;  1YGS A;  3A77 A;  4A4Y A;  2QVL A;  1R21 A;  1J4Q A;  4QCJ A;  1K3J A;  3GMJ A;  3UNM A;  4V24 A;  3DSH A;  5BVI A;  3OUN A;  2A0T A;  3POA A;  4EJQ A;  1MK2 A;  4L02 A;  3V80 A;  1FHQ A;  1J4K A;  4WRR A;  5JEL A;  1UJX A;  1YJM A;  3V8M A;  3VZC A;  1U7F B;  3DIT A;  2I2D A;  3V7U A;  5JEO A;  1WLN A;  3V8R A;  3VPY A;  5A8I A;  1DMZ A;  2KKL A;  3UV0 A;  2JQI A;  4KU0 D;  1DEV A;  2AFF A;  1QU5 A;  3S40 A;  3HUF A;  1J2F A;  3ELV A;  1J4P A;  3VA1 A; 
#chains in the Genus database with same CATH homology
 1LGP A;  2KB4 A;  2G1L A;  4EGX A;  2KFU A;  2XXS A;  2BON A;  1KHX A;  3ELS A;  1K2M A;  2JKD A;  3KT9 A;  2P1R A;  1KHU A;  1UHT A;  2JQJ A;  2FF4 A;  5JEM A;  1U7V B;  1MR1 A;  1MJS A;  1MZK A;  2JGR A;  3I0N A;  2JPE A;  3VZB A;  5JEK A;  2XT9 B;  3UMZ A;  3MDB A;  3VZD A;  1U7V A;  1U7F A;  5JER A;  1YJ5 C;  1G88 A;  5JEJ A;  3FM8 A;  4JIW D;  4A0E A;  4JIV D;  1G3G A;  2BRF A;  4H87 A;  3HX1 A;  1G6G A;  2LC1 A;  3I6U A;  3UOT A;  4G2S A;  2EH0 A;  4WER A;  1WV3 A;  5DJO A;  3VA4 A;  2CSW A;  2QV7 A;  3I0M A;  3GQS A;  1GXC A;  4R9P A;  3T5P A;  2W3O A;  1DD1 A;  1QWT A;  2FEZ A;  5C4V A;  5E50 A;  1K3N A;  1LGQ A;  4D9V A;  3I6W A;  1ZOQ A;  4JON A;  1K3Q A;  1J4L A;  2JQL A;  1J4O A;  2PIE A;  3UNN A;  2KB3 A;  3HUE A;  1FHR A;  1K2N A;  3UN0 A;  3PO8 A;  1YGS A;  3A77 A;  4A4Y A;  2QVL A;  1R21 A;  1J4Q A;  4QCJ A;  1K3J A;  3GMJ A;  3UNM A;  4V24 A;  3DSH A;  5BVI A;  3OUN A;  2A0T A;  3POA A;  4EJQ A;  1MK2 A;  4L02 A;  1FHQ A;  1J4K A;  4WRR A;  5JEL A;  1UJX A;  1YJM A;  3VZC A;  1U7F B;  3DIT A;  5JEO A;  1WLN A;  3VPY A;  5A8I A;  1DMZ A;  2KKL A;  3UV0 A;  2JQI A;  4KU0 D;  1DEV A;  2AFF A;  1QU5 A;  3S40 A;  3HUF A;  1J2F A;  3ELV A;  1J4P A;  3VA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...