1K3NA

Nmr structure of the fha1 domain of rad53 in complex with a rad9-derived phosphothreonine (at t155) peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
151
structure length
151
Chain Sequence
b'ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Kinase SPK1
publication title Solution structures of two FHA1-phosphothreonine peptide complexes provide insight into the structural basis of the ligand specificity of FHA1 from yeast Rad53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/cell cycle
total genus 21
structure length 151
sequence length 151
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1k3nA00
1J4QA 1K3JA 1J4OA 4EJQA 1LGQA 3I0MA 3UNMA 2JKDA 3UV0A 1J4PA 3HUFA 1YJMA 1J4LA 2XT9B 2FEZA 1WV3A 1UHTA 1YJ5C 3I6WA 3UOTA 3PO8A 4G2SA 3UN0A 2PIEA 4EGXA 1G6GA 1UJXA 1LGPA 3HX1A 2FF4A 3GQSA 4H87A 5DJOA 3VPYA 3UNNA 2JQIA 4QCJA 2LC1A 3HUEA 4A0EA 1MZKA 1K3NA 2A0TA 3FM8A 3I0NA 1K2MA 3I6UA 2JPEA 2JQLA 1K3QA 1FHQA 2W3OA 1G3GA 3ELVA 2EH0A 2CSWA 1R21A 2KKLA 1GXCA 3MDBA 1J4KA 1WLNA 3VA1A 1DMZA 2KB3A 4D9VA 5E50A 2G1LA 1K2NA 2JQJA 3UMZA 2KFUA 3OUNA 5A8IA 3ELSA 3POAA 3VA4A 3KT9A 2AFFA 2KB4A 2BRFA 4JONA 1QU5A 1FHRA
chains in the Genus database with same CATH superfamily
1J4QA 3V8RA 1K3JA 5C4VA 2I2FA 1J4OA 1DEVA 1LGQA 1U7FA 3I0MA 3UNMA 4EJQA 2JKDA 4DY6A 3UV0A 1J4PA 3DSHA 3HUFA 1YJMA 1Y3HA 1J4LA 5EJIA 2XT9B 2FEZA 2I2AA 1WV3A 3V80A 5EJGA 3V7YA 1U7VB 2I2CA 3VZDA 1MJSA 1UHTA 1YJ5C 3I6WA 4KU0D 3UOTA 2I2DA 3PO8A 2I29A 5JEMA 4G2SA 3V8MA 3UN0A 2QVLA 2PIEA 3V8NA 4EGXA 1G6GA 4WERA 5JERA 1UJXA 2P1RA 1LGPA 3V8PA 2AN1A 1YGSA 1MK2A 5JEJA 4A4YA 3HX1A 1Z0UA 2FF4A 1J2FA 5DHTA 3V8QA 3GQSA 4H87A 5DJOA 3PFNA 3VPYA 3V7UA 1ZOQA 3UNNA 2JQIA 4QCJA 1QWTA 5JEKA 1KHXA 2LC1A 4L02A 3HUEA 5DHQA 1G88A 5BVIA 4A0EA 1MZKA 1Z0ZA 3DITA 4JIWD 1K3NA 1Y3IA 4WRRA 2A0TA 3FM8A 5JEOA 1U0RA 4JIVD 2I2BA 1U7FB 2BONA 3I0NA 1K2MA 2Q5FA 3I6UA 1Z0SA 2JPEA 2JQLA 1K3QA 1U7VA 2JGRA 1DD1A 1FHQA 2W3OA 1G3GA 5DHRA 3ELVA 2EH0A 1SUWA 2CSWA 1R21A 2KKLA 4R9PA 1GXCA 3MDBA 5DHUA 1J4KA 5JELA 3T5PA 1WLNA 3VA1A 3VZCA 2KB3A 3VZBA 4D9VA 1DMZA 5E50A 2G1LA 1K2NA 3AFOA 2JQJA 2QV7A 3S40A 3A77A 2I1WA 1KHUA 4HAOA 3UMZA 2KFUA 2XXSA 3OUNA 5A8IA 3ELSA 5DHPA 1YT5A 3GMJA 3POAA 3V7WA 3VA4A 3KT9A 5EJFA 5DHSA 2AFFA 2KB4A 1MR1A 1U0TA 2BRFA 5EJHA 4V24A 4JONA 1QU5A 1FHRA
chains in the Genus database with same CATH topology
1J4QA 1K3JA 5C4VA 1J4OA 1DEVA 1LGQA 1U7FA 3I0MA 3UNMA 4EJQA 2JKDA 3UV0A 1J4PA 3DSHA 3HUFA 1YJMA 1J4LA 2XT9B 2FEZA 1WV3A 1U7VB 3VZDA 1MJSA 1UHTA 1YJ5C 3I6WA 4KU0D 3UOTA 3PO8A 5JEMA 4G2SA 3UN0A 2QVLA 2PIEA 4EGXA 1G6GA 4WERA 5JERA 1UJXA 2P1RA 1LGPA 1YGSA 1MK2A 5JEJA 4A4YA 3HX1A 2FF4A 1J2FA 3GQSA 4H87A 5DJOA 3VPYA 1ZOQA 3UNNA 2JQIA 4QCJA 1QWTA 5JEKA 1KHXA 2LC1A 4L02A 3HUEA 1G88A 5BVIA 4A0EA 1MZKA 3DITA 4JIWD 1K3NA 4WRRA 2A0TA 3FM8A 5JEOA 4JIVD 1U7FB 2BONA 3I0NA 1K2MA 3I6UA 2JPEA 2JQLA 1K3QA 1U7VA 2JGRA 1DD1A 1FHQA 2W3OA 1G3GA 3ELVA 2EH0A 2CSWA 1R21A 2KKLA 4R9PA 1GXCA 3MDBA 1J4KA 5JELA 3T5PA 1WLNA 3VA1A 3VZCA 2KB3A 3VZBA 4D9VA 1DMZA 5E50A 2G1LA 1K2NA 2JQJA 2QV7A 3S40A 3A77A 1KHUA 3UMZA 2KFUA 2XXSA 3OUNA 5A8IA 3ELSA 3GMJA 3POAA 3VA4A 3KT9A 2AFFA 2KB4A 1MR1A 2BRFA 4V24A 4JONA 1QU5A 1FHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4Q A;  1K3J A;  1J4O A;  4EJQ A;  1LGQ A;  3I0M A;  3UNM A;  2JKD A;  3UV0 A;  1J4P A;  3HUF A;  1YJM A;  1J4L A;  2XT9 B;  2FEZ A;  1WV3 A;  1UHT A;  1YJ5 C;  3I6W A;  3UOT A;  3PO8 A;  4G2S A;  3UN0 A;  2PIE A;  4EGX A;  1G6G A;  1UJX A;  1LGP A;  3HX1 A;  2FF4 A;  3GQS A;  4H87 A;  5DJO A;  3VPY A;  3UNN A;  2JQI A;  4QCJ A;  2LC1 A;  3HUE A;  4A0E A;  1MZK A;  1K3N A;  2A0T A;  3FM8 A;  3I0N A;  1K2M A;  3I6U A;  2JPE A;  2JQL A;  1K3Q A;  1FHQ A;  2W3O A;  1G3G A;  3ELV A;  2EH0 A;  2CSW A;  1R21 A;  2KKL A;  1GXC A;  3MDB A;  1J4K A;  1WLN A;  3VA1 A;  1DMZ A;  2KB3 A;  4D9V A;  5E50 A;  2G1L A;  1K2N A;  2JQJ A;  3UMZ A;  2KFU A;  3OUN A;  5A8I A;  3ELS A;  3POA A;  3VA4 A;  3KT9 A;  2AFF A;  2KB4 A;  2BRF A;  4JON A;  1QU5 A;  1FHR A; 
#chains in the Genus database with same CATH topology
 1J4Q A;  3V8R A;  1K3J A;  5C4V A;  2I2F A;  1J4O A;  1DEV A;  1LGQ A;  1U7F A;  3I0M A;  3UNM A;  4EJQ A;  2JKD A;  4DY6 A;  3UV0 A;  1J4P A;  3DSH A;  3HUF A;  1YJM A;  1Y3H A;  1J4L A;  5EJI A;  2XT9 B;  2FEZ A;  2I2A A;  1WV3 A;  3V80 A;  5EJG A;  3V7Y A;  1U7V B;  2I2C A;  3VZD A;  1MJS A;  1UHT A;  1YJ5 C;  3I6W A;  4KU0 D;  3UOT A;  2I2D A;  3PO8 A;  2I29 A;  5JEM A;  4G2S A;  3V8M A;  3UN0 A;  2QVL A;  2PIE A;  3V8N A;  4EGX A;  1G6G A;  4WER A;  5JER A;  1UJX A;  2P1R A;  1LGP A;  3V8P A;  2AN1 A;  1YGS A;  1MK2 A;  5JEJ A;  4A4Y A;  3HX1 A;  1Z0U A;  2FF4 A;  1J2F A;  5DHT A;  3V8Q A;  3GQS A;  4H87 A;  5DJO A;  3PFN A;  3VPY A;  3V7U A;  1ZOQ A;  3UNN A;  2JQI A;  4QCJ A;  1QWT A;  5JEK A;  1KHX A;  2LC1 A;  4L02 A;  3HUE A;  5DHQ A;  1G88 A;  5BVI A;  4A0E A;  1MZK A;  1Z0Z A;  3DIT A;  4JIW D;  1K3N A;  1Y3I A;  4WRR A;  2A0T A;  3FM8 A;  5JEO A;  1U0R A;  4JIV D;  2I2B A;  1U7F B;  2BON A;  3I0N A;  1K2M A;  2Q5F A;  3I6U A;  1Z0S A;  2JPE A;  2JQL A;  1K3Q A;  1U7V A;  2JGR A;  1DD1 A;  1FHQ A;  2W3O A;  1G3G A;  5DHR A;  3ELV A;  2EH0 A;  1SUW A;  2CSW A;  1R21 A;  2KKL A;  4R9P A;  1GXC A;  3MDB A;  5DHU A;  1J4K A;  5JEL A;  3T5P A;  1WLN A;  3VA1 A;  3VZC A;  2KB3 A;  3VZB A;  4D9V A;  1DMZ A;  5E50 A;  2G1L A;  1K2N A;  3AFO A;  2JQJ A;  2QV7 A;  3S40 A;  3A77 A;  2I1W A;  1KHU A;  4HAO A;  3UMZ A;  2KFU A;  2XXS A;  3OUN A;  5A8I A;  3ELS A;  5DHP A;  1YT5 A;  3GMJ A;  3POA A;  3V7W A;  3VA4 A;  3KT9 A;  5EJF A;  5DHS A;  2AFF A;  2KB4 A;  1MR1 A;  1U0T A;  2BRF A;  5EJH A;  4V24 A;  4JON A;  1QU5 A;  1FHR A; 
#chains in the Genus database with same CATH homology
 1J4Q A;  1K3J A;  5C4V A;  1J4O A;  1DEV A;  1LGQ A;  1U7F A;  3I0M A;  3UNM A;  4EJQ A;  2JKD A;  3UV0 A;  1J4P A;  3DSH A;  3HUF A;  1YJM A;  1J4L A;  2XT9 B;  2FEZ A;  1WV3 A;  1U7V B;  3VZD A;  1MJS A;  1UHT A;  1YJ5 C;  3I6W A;  4KU0 D;  3UOT A;  3PO8 A;  5JEM A;  4G2S A;  3UN0 A;  2QVL A;  2PIE A;  4EGX A;  1G6G A;  4WER A;  5JER A;  1UJX A;  2P1R A;  1LGP A;  1YGS A;  1MK2 A;  5JEJ A;  4A4Y A;  3HX1 A;  2FF4 A;  1J2F A;  3GQS A;  4H87 A;  5DJO A;  3VPY A;  1ZOQ A;  3UNN A;  2JQI A;  4QCJ A;  1QWT A;  5JEK A;  1KHX A;  2LC1 A;  4L02 A;  3HUE A;  1G88 A;  5BVI A;  4A0E A;  1MZK A;  3DIT A;  4JIW D;  1K3N A;  4WRR A;  2A0T A;  3FM8 A;  5JEO A;  4JIV D;  1U7F B;  2BON A;  3I0N A;  1K2M A;  3I6U A;  2JPE A;  2JQL A;  1K3Q A;  1U7V A;  2JGR A;  1DD1 A;  1FHQ A;  2W3O A;  1G3G A;  3ELV A;  2EH0 A;  2CSW A;  1R21 A;  2KKL A;  4R9P A;  1GXC A;  3MDB A;  1J4K A;  5JEL A;  3T5P A;  1WLN A;  3VA1 A;  3VZC A;  2KB3 A;  3VZB A;  4D9V A;  1DMZ A;  5E50 A;  2G1L A;  1K2N A;  2JQJ A;  2QV7 A;  3S40 A;  3A77 A;  1KHU A;  3UMZ A;  2KFU A;  2XXS A;  3OUN A;  5A8I A;  3ELS A;  3GMJ A;  3POA A;  3VA4 A;  3KT9 A;  2AFF A;  2KB4 A;  1MR1 A;  2BRF A;  4V24 A;  4JON A;  1QU5 A;  1FHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...