1K4US

Solution structure of the c-terminal sh3 domain of p67phox complexed with the c-terminal tail region of p47phox
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
b'QLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGESKGKVGIFPKVFVEDSAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHAGOCYTE NADPH OXIDASE SUBUNIT P67PHOX
publication title Diverse recognition of non-PxxP peptide ligands by the SH3 domains from p67(phox), Grb2 and Pex13p.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k4uS00
1WX6A 3I9QA 3H41A 2DL7A 5L23A 1HJDA 5IXFA 4J9IA 2EYWA 2GBQA 4RTZA 1HSQA 5IXBA 3EG3A 1UJYA 4AFQC 2ESWA 3NPFA 2W10A 1BU1A 1XOVA 4Z88A 1MV0B 4OMPA 3EG0A 2RQVA 4WCIA 1E6HA 4CC4B 2KXCA 4LN2A 4J9CA 2O9SA 1E6GA 1H8KA 2JXBA 1AVZC 1PWTA 2AZSA 3NGPA 3H0FA 4HVWA 2CSQA 2BZYA 2DL5A 2KR3A 2DBMA 2CT3A 1A0NB 1TUCA 5I11A 3H0IA 2LZ6B 2CT4A 2K6DA 2YUQA 1JEGA 1PKTA 2ED1A 2KRNA 4RUGA 4OMOA 1UG1A 1M8MA 2KEAA 1B07A 1OPLA 3JV3A 1TUDA 2ROTA 2EYYA 3REBB 2HCKA 1I1JA 1MUZA 3UA7A 4ORZA 2K79A 2DJQA 1KSWA 4R0KA 1ABOA 1YCSB 1K4US 2J7IA 1VA7A 1RI9A 1RLQC 1QWEA 4HCKA 1CKAA 2DRKA 5FWBA 2M0YA 3R6NA 1ZX6A 4FSSA 4IIMA 1B3QA 2VVKA 5IHIA 1PRLC 1UFFA 1PRMC 4E6RA 2KE9A 1SRMA 1NLPC 3FJ5A 2LQWA 2FRWA 1SHFA 2ABLA 4Z8AA 1UE9A 1V1CA 3I35A 2KT1A 2BZ8A 2DBKA 3U23A 3I5RA 2DL3A 1M27C 3VS0A 1NYGA 3EHRA 3LH5A 3EHQA 2EYXA 1U06A 2D8JA 2J06A 2D0NA 1AZGB 2DE0X 2NWMA 4HXJA 1W1FA 4M4ZA 1AWXA 1GCQA 1UUEA 2PTKA 5ECAA 2LQNA 1X2KA 2DMOA 1FMKA 1X69A 3M0PA 2D8HA 1NLOC 5IH2A 2OAWA 1VYVA 4CC7A 2D1XA 4OMLA 4J9GA 1NEBA 3EG1A 2GQIA 1YWOA 3VRZA 2JS0A 4IIOA 3GBQA 2V1RA 2RQTA 2L0AA 1YN8A 2CH4A 2FG0A 1T0JA 2CSIA 1KIKA 2C0OA 1VYUA 3KFVA 1CSKA 3NMZC 2A37A 2FPDA 2HSPA 1UHCA 3VS2A 2JTEA 2X3XD 1MV3A 2O31A 2CDTA 4RTXA 2YUNA 2EVRA 1NYFA 2JW4A 3SHWA 1YP5A 2HBWA 2XMFA 1M3BA 4K11A 3SEMA 4DEYA 1K0SA 2RPNA 1OOTA 2BZXA 4J9HA 1EFNA 5FW9A 2K7AA 1JU5C 1SEMA 1YNZA 1ABQA 2X3WD 4LNPA 3H0HA 1OPKA 2IIMA 3THKA 2J6FA 2LJ0A 1AD5A 1SHGA 2JS2A 2PNIA 2LX7A 1WIEA 3VRYA 3REAB 1RUWA 2RQRA 1W70A 3I5SA 2HEQA 2YUOA 1OEBA 3IQLA 2MCNA 1AWOA 1SPKA 3EG2A 3TVTA 2F2VA 2DM1A 1BBZA 1IO6A 2F2XA 2DX1A 2O2OA 5GJVB 2DF6A 4J9BA 2AK5A 1Y0MA 2DILA 4LUDA 2F2WA 4JZ4A 2BTTA 2KNBB 1HD3A 1K0XA 2L3QA 3PE0A 2SRCA 1M30A 2LJ1A 3EGUA 2VKNA 2GNCA 1NM7A 4J9DA 1AWWA 4RTVA 2ROLA 5IHNA 2FPEA 3M0TA 1QWFA 1Z9QA 1WYXA 4JPBW 4F14A 1GCPA 2KXDA 2M51A 1K9AA 2EW3A 1KFZA 4OMMA 1U3OA 2I0NA 1U5SA 1LCKA 2A08A 2J6OA 1NEGA 5FWCA 2CREA 2LNHB 1M3AA 2CUDA 4GLMA 2L3SA 2LJ3A 5GJWB 1UJ0A 3TSZA 3ZL7C 2MIOA 2H8HA 1FYNA 4LUEA 3NHNA 4X1VA 2FO0A 3A98A 2L3PA 2G6FX 1BB9A 2GTJA 1G2BA 1QKWA 2AKLA 2RN8A 3UA6A 2O9VA 3TSWA 1PKSA 2EGCA 2V1QA 1I07A 2EQIA 1H3HA 1GL5A 1GFCA 4JJBA 2CH4W 1SRLA 1QKXA 4RTYA 1UDLA 2JMAA 2YUPA 1M3CA 1WI7A 4OMQA 2JM8A 1X27A 4ESRA 1YWPA 2VWFA 1I0CA 4F17A 2FEIA 4CC3A 4D8DA 2LMJA 4RTWA 1CKBA 2SEMA 2JM9A 2KGTA 2E5KA 1WXTA 2DVJA 5IHKA 2CUBA 2GGRA 2KRSA 4AFUC 2DL4A 3RNJA 1JQQA 3QWYA 3M0SA 1AOJA 1X2QA 1UHFA 2RQWA 1JXMA 2RMOA 2RQUA 2EPDA 1KJWA 1AZEA 1SSHA 1X43A 3VS4A 2RNAA 3M0RA 3VS3A 4A63B 2FPFA 2NUZA 1ZLMA 1PNJA 1JXOA 4AFSC 1GRIA 1WA7A 5HCKA 2K2MA 1S1NA 4Y92A 2P4RA 2B86A 1WLPB 2K9GA 4AG1C 3CQTA 2OJ2A 1Z9ZA 4KRTA 2LCSA 3ULRB 2PZ1A 2DRMA 2KRMA 2RF0A 1AEYA 3UF4A 2KBTA 1X6GA 2DNUA 5EC7A 1GBQA 4Z89A 2AZVA 2GTOA 1WXUA 1RLPC 4RTUA 1UECA 2A36A 2EYZA 1K1ZA 1N5ZA 1H92A 4GBQA 2DL8A 2K3BA 4J9EA 1NG2A 4CC2A 2C0IA 2EGEA 1AWJA 1T3LA 1WFWA 4JZ3A 4OMNA 4AFZC 1ARKA 4HVVA 2YSQA 4J9FA 3UATA 1PHTA 1ZUUA 1ZSGA 4DEXA 1X6BA 2KT8A 3PVLA 1ZUYA 1JO8A 1GBRA 2J6KA 2FRYA 2C0TA 3M0UA 3VS7A 1UGVA 2EKHA 2KROA 1WXBA 1TG0A 2DYBA 3O5ZA 5I22A 4JJCA 2O88A 4EIKA 1E7OA 1Y57A 3M0QA 1GFDA 2L2PA 3VS1A 2MOXA 4F16A 1QLYA 1T3SA 4ZNXA 2JT4A 2DA9A 2KYMA 2ENMA 2AKKA 1ZBJA 2HDAA 1QCFA 4JJDA 3VS6A 2J05A 2DLPA 3VS5A 1BK2A 1WDXA 2A28A 2YDLA 4D8KA 1ZUKA 1VYTA 1W6XA 2EGAA 3QWXX 4HVUA 3RBBB 3C0CA 2ED0A 2JMCA 1GCQC 4QT7A 4RTTA 2QDLA 2OI3A 2YT6A 4AG2C 1J3TA 2W0ZA 2EBPA 4LE9A 2LP5A 1UTIA 1G83A 1OV3A 2KYBA 1T0HA 3PVQA 2ECZA 1K76A
chains in the Genus database with same CATH superfamily
3I9QA 3H41A 1D1AA 2DL7A 2YRVA 5L23A 5IXFA 1HJDA 4BD3A 2GBQA 4C92A 2XIDA 4R55A 2IPOB 5IXBA 4OB1B 2PVDB 4HT9A 1XQHA 3NPFA 1XOVA 1MV0B 3QDRB 4OMPA 2M1HA 4DBRA 3F70A 1P92A 4CC4B 2KXCA 3MJXA 2QQRA 1VQ6A 2DKGA 1H8KA 3H0FA 3MEUA 4HVWA 5GAMf 3LGFA 3OMGA 8AT1B 1BYMA 3MP6A 3CBPA 5A0LA 3I55Q 3H0IA 1B7TA 4N4GA 2LZ6B 3L2UA 2YUQA 2VGNA 1D1BA 5GAN3 3CCST 1PKTA 4DA4A 3P8HA 1VQNT 4OMOA 1UG1A 5J26A 2KEAA 1OPLA 3CC4A 4M7DG 1TUDA 2EYYA 2HCKA 2MMPA 1WHMA 3DB4A 2DJQA 1YCSB 5I21A 4M77D 1RLQC 3PMIA 1D1CA 5CKDA 4FU6A 1MMDA 1CKAA 2DRKA 3JCMd 4Q5WA 4FSSA 3E1SA 4EMGA 2DTHA 3QJ6A 1UFFA 3I56Q 5LJ5j 2ZGWA 1KD1R 2E41A 2KE9A 1SRMA 4F7UG 4L6V5 2YLCA 5KE2A 3FJ5A 1WHKA 1V1CA 2KT1A 2XHCA 3RR6A 1LNXA 2JZ2A 4PJOE 4BY6C 1M27C 4C0GA 4MZPA 3LH5A 3EHQA 3UWNA 3JB9G 4M77C 5GAN6 1Q7YC 3QO3A 3L2VA 4LDUA 4FM4B 5ECAA 1VQ4Q 2D8HA 3RERA 3CPWP 4M75F 1NLOC 5IH2A 2QEXA 1K73U 4CC7A 1RAIB 1NEBA 3NTHA 3EG1A 2GQIA 2NUTB 5GAOn 2HQHA 1ZQ1A 2JS0A 5J3BA 4FYXB 2FZGB 2ZAEA 2V1RA 2L0AA 2AT1B 2BUDA 4Y28E 3CC2Q 2FG0A 4ELZC 2K3YA 2ZCFB 1MGQA 1F1BB 2C0OA 2Y4XA 3BDLA 1UHCA 3VS2A 2JTEA 1R77A 1YJNA 4M7AD 4B6MA 3QKJA 3OSSC 2CDTA 2BKDN 2JNGA 1NYFA 1G3TA 2JW4A 1BIBA 2CS7A 1Q82C 5DLQE 4C5GA 2VXEA 3CC7A 1M3BA 4K11A 4M7AG 3EFOB 4J6YA 5LJ5f 1YI2A 5FU7C 1OOTA 2K7AA 3QJYA 4J8OA 1YNZA 1ABQA 2X3WD 5CK9A 4LNPA 3H0HA 4LD6A 2MF2A 1YHQQ 3THKA 3CCJT 3G4SQ 5GAN5 3P8DA 4JJNK 3CBOA 1YJWQ 2P0QA 3CCMA 1WIEA 3SD4A 3I5SA 1OEBA 1NE8A 2E3HA 4RG8A 4M7AC 4X34A 1VQLA 2F2VA 4M75B 3JCMg 4XTUA 1VQ9Q 1BBZA 1IO6A 1EIFA 2RHUA 2B8AA 4XTXA 5LJ5h 1WHJA 4PLIA 2BE9B 1OX8A 4ZN1A 4GLKA 4BE2A 2DILA 3ZEHA 4JZ4A 3OYGA 2X51A 2E4HA 2OTLQ 1K0XA 3PE0A 1M30A 2LJ1A 3EGUA 3V8KA 3L2WA 2NYSA 5D6WA 2RB6A 4B9XA 1M2VB 1Z9QA 5IN1A 4F14A 4KUDK 1JRIA 4E7ZA 2KXDA 2M51A 1K9AA 2EW3A 1VQOT 1KC8U 1KFZA 1U3OA 2FZKB 2A08A 2HD0A 2J6OA 3A8LB 5FWCA 2LNHB 1SSFA 4GLMA 3A1PA 3CCRQ 3JCMW 2MIOA 2H8HA 3LYIA 2PVOB 1LVKA 4X1VA 2FO0A 3A98A 1W2BA 1V29B 2EAYA 2O9VA 4PJOA 1PKSA 3CXCA 2RI3A 1H3HA 2L3RA 2DTIA 1X01A 2CH4W 2P4TA 4XTVA 5CAIA 4OMQA 3NTKA 4IURA 1X27A 1Y96B 3OYMA 4LDXA 2VWFA 3EGDB 2HQEA 1FMWA 4MZTA 3M58A 3QZ9B 1VQ6Q 2GFAA 4OF1A 1NJIC 3LW5E 2LMJA 2DXUA 2NLUA 1BIAA 1M1KC 1G3WA 4IUUA 2CUBA 2DL4A 2MAMA 1JQQA 1KG1A 2RQWA 3CCQA 5LJ5e 2EQKA 1RAFB 1I4K1 2EPDA 4KT0E 1SSHA 1Q81U 2NUPB 4ZTFA 1ZLMA 1PNJA 1IGUA 3JB9I 3CC4Q 2DYIA 2VC8A 2K2MA 2P4RA 3A5ZB 1OU9A 3META 4AG1C 1U1SA 2CZ7B 4KULA 1VQPT 3CCVT 5C6SA 2QA4T 4XU1A 3EGXB 1WZOA 1Z9ZA 2LCSA 4D6WA 2DRMA 2KRMA 2RF0A 1AEYA 3UF4A 1M1FA 4N4IA 2L5QA 1D3BA 2JN0A 1C1AA 4M77F 3V8JA 1WXUA 3JCMh 4RTUA 1U1TA 4FW1A 3G6EA 4BDZA 2KK4A 2A36A 4A4KA 4M78E 2COYA 4KGVB 3CD6T 1G5VA 2K3BA 3TU4K 1VQ7A 2C0IA 4FIBA 1X75C 4C5EA 4JRPA 4OMNA 4QW2A 1I8FA 2YSQA 4KGXB 1KQSS 1X6BA 2KT8A 2DK3A 1JBMA 2C0TA 2P0PA 1VQ5A 1OULA 3M0UA 3VS7A 2QEXQ 2QXFA 2KROA 5I22A 4JJCA 3LWHA 3VJPA 2IVWA 3L2ZA 3M0QA 1GFDA 2L2PA 3QYHB 4A4FA 4PJJA 2KSSA 5KYYB 2QGGA 2QQ9A 3G1JA 4E7SA 1TOVA 1TSFA 1G3YA 1OU8A 2ENMA 3CBMA 4BI8B 1IHVA 4C0DB 1B34B 1YIJA 1BK2A 3H6ZA 2MI6A 1IXDA 2AHJB 2CZ1B 1VYTA 4ZTJA 1YJNQ 4J6WA 4M77B 1SG5A 4HCCA 4C92E 1K9MU 1QCOA 3OYEA 1RAEB 4DBFA 2V26A 3CC7Q 2JMCA 2ZZDA 1Q81R 4RTTA 2QDLA 4BDYA 1YI2Q 2EBPA 1W2BP 1S72A 3HP9A 4M7AF 1UTIA 5L8RE 1OV3A 5J39A 1JJ2S 2HL3A 2DPPB 3CXCP 5GANj 4DBQA 1VQ8T 3OYDA 4M75G 5CKBA 1IGQA 2CP6A 2HKNA 3CCEA 2Y90A 4J9IA 1VQ4A 2H3EB 4RTZA 3CCMQ 3EG3A 1UJYA 3CMAT 6AT1B 3OW2A 4E47A 3QBYA 1VQLQ 2LCCA 3JCMV 2O4XB 4DOWA 5LJ3j 2ZPHB 2JXBA 1AVZC 1PWTA 4PFPA 2YRDA 1Q86C 5C0MA 4PFZA 5M9OA 3FDRA 3CCUQ 1RACB 4HA8A 2BZYA 1K8AC 2KR3A 1UGRB 2DBMA 2CT3A 1A0NB 4PK4A 4X9CA 1K73C 4HT8A 5I11A 5FU6B 2CT4A 2K6DA 2RHIA 2XDDA 2ED1A 2KRNA 4FYVB 1OX9A 1FWZA 1M8MA 5GAMg 2XU8A 1QVFS 3G7ZA 3JV3A 3EH2A 3QXEB 2E1HA 4M7AB 3GLXA 4CRIA 3I55T 4R0KA 3ZFJA 1VA7A 3CCSA 4LXCA 5LJ5d 1VQNA 1QWEA 5GANf 4MDWA 2CYZB 4M78A 3QSUA 4J7IA 2VVKA 3A8MB 1IRXA 5I2MA 4E6RA 2I2LA 2PVGB 5GAMj 3MP1A 4NOYA 2LQWA 4Z8AA 3FJPA 4PJOD 1HXDA 3HRSA 2X35A 1WPYA 1W4SA 3U23A 4JDSA 1NYGA 3EHRA 5LJ3f 1KD1U 1U06A 2D8JA 1AZGB 2NWMA 5GANh 1YITT 3M5AA 4OB3B 3CCQQ 1UUEA 3GF5A 2LQNA 1X2KA 2HKQB 1FMKA 3M0PA 2OTJQ 3H8ZA 1EX4A 1UGQB 4J9GA 1PSFA 3LGLA 3V7RA 1YWOA 2RHXA 3VRZA 3JSCA 4PJOC 5KYXA 4IIOA 3Q1JA 3GBQA 2RQTA 2LX9A 5LJ3h 4ATOA 2CH4A 2BE7D 1BKBA 3HFOA 1N8RU 4RCBA 2FPDA 3BW1A 3DLLA 3E9FA 3RESA 4NL2A 2LRQA 3KUFA 3SHWA 2X4XA 2HBWA 3OYAA 3CPFA 4DEYA 4Z02A 3G6EQ 1K0SA 1MHNA 4J9HA 2XICA 4XK8E 1VQMT 5CIUA 3OW2P 3TQ7P 3OYFA 2DO3A 3H9NA 5D6XA 1VQ7Q 5D6YA 2KMTA 4C92B 3OS0A 3X24B 2EWNA 1TXQA 2PNIA 1TU0B 5GMKm 2KQWA 2LX7A 2OAUA 5LJ5g 4JRKA 1W70A 5CCAA 3E9GA 3IQLA 1AWOA 3RKXA 3OS1A 1N9SA 4E7JA 1VQ5Q 2F2XA 3CCJA 1YHQT 2DX1A 2O2OA 4PL6A 3G4ST 1TS9A 4A54A 4RMOA 4A53A 4E7KA 1M90C 5GAMh 5GANe 3OYJA 2BTTA 4EMHA 4JLIA 3OBWA 3X20B 3S3OA 3GOXA 4OGCA 2SRCA 1VQ9T 4M77G 3RIRA 2VKNA 2GNCA 1BI2A 4J9DA 1YIJQ 1SF9A 2FPEA 1YJ9T 2X4YA 5CKEA 3M59A 3RKWA 1EZZB 5GMKl 5GAOm 2ATCB 2FL7A 4C0DC 4C8QE 1RI0A 3E19A 5LJ3e 3UDCA 3KXTA 1LCKA 2CP2A 3LLRA 1NEGA 3CEYA 1S72Q 2CREA 2JTFA 3PMTA 3OA6A 5GJWB 1UJ0A 4R56A 3TSZA 3ZL7C 3JCMX 3CCEQ 3C94A 1VQOA 2G6FX 1BB9A 2GF7A 3M56A 2GTJA 4N0AA 1N8RR 2RJCA 2AKLA 2Z0WA 2EFIA 1V76A 4JJBA 2QGFB 1DJ7B 4RTYA 2JMAA 2D0QB 2F69A 5GAOl 4JLGA 2A0FB 1YWPA 1I0CA 3BFMA 4FYYB 5GAN8 3VUZA 4RTWA 1Y07A 3JCMP 2JM9A 3OBYA 2LC4A 4XTWA 2M02A 2GGRA 4AMCA 3OYHA 1PCXA 4HKEA 3CPWS 3M0SA 1XNIA 4PFOA 2KDSA 4L5GA 3NTIA 2DIGA 2DETA 2KY9A 5GAMe 2DXCA 3M0RA 3VS3A 2R57A 1KQ1A 1M5Q1 1WA7A 4J5YA 5FU6C 1MMNA 5CO7A 5CQYA 2Y4YA 4Y92A 1MNEA 5LL6S 4PJLA 4BB7A 2K9GA 2WSCE 1XJWB 2HAXA 3CCSQ 3C4SA 4BI3A 1VQNQ 2K5IA 1RADB 2HQXA 3ULRB 1WNLA 3S3MA 1K9MC 5GAN7 1X6GA 2DNUA 4IUQA 3SWNA 3MEVA 2EJFA 2GTOA 1RLPC 4M78D 1VQPA 1UECA 3M54A 1K1ZA 4M7DE 2JJ9A 4GBQA 4MMLA 5GMKe 3CCUA 2DL8A 1YCYA 4M78G 2CZ6B 4XTYA 2WACA 3JCMJ 5IT9E 2D9TA 4MDXA 2H3JA 1ARKA 3UATA 1PHTA 2EQMA 4PJOF 4OB0B 4FT4A 2LQ8A 2J6KA 2FRYA 3OS2A 3J80E 3CCLT 2PUKB 3JCMQ 2DD5A 2EKHA 1WXBA 2DYBA 4F7UE 4M78C 3RMQA 1E7OA 3PIOA 3VS1A 2MOXA 2RA2A 2EJGA 2VYTA 5CKHA 5CKFA 1T3SA 1JJ2A 3OYNA 4MMKA 1C0MA 2JT4A 2DA9A 2KYMA 5GMKi 4FT2A 2MYSA 4C5IA 1ZBJA 1QCFA 5CVIA 4C8QA 2DLPA 3VS5A 2QEXT 3R6OA 4EMKC 2A28A 3FB9A 3SFMA 2E5QA 4GY5A 2A7YA 2PUOB 4C92D 3A8OB 1QP2A 1D09B 3PIPA 4HVUA 2DTOA 5EG2A 5GANd 3RBBB 2EQUA 4C92G 4QT7A 2C06A 2OI3A 1N9RA 2QQBA 2YT6A 3GIBA 1RAAB 1I81A 2LP5A 1G83A 5I2SA 2LVMA 2ECZA 1M1GA 4XAXB 2QG9B 1QVGA 1FXXA 2EYWA 4PJOB 3MO8A 2PU9B 2OTJA 2R5MA 4RKUE 2EIFA 5LJ3d 4C92C 2ESWA 1RAHB 1PG5B 1BU1A 2W10A 3S3NA 1VQ8A 3CCJQ 1QVFA 1UGSB 2RQVA 4WCIA 1E6HA 4OGEA 3L1AA 1KD1C 3E2UA 4J9CA 4Y91A 5KYWA 2QASA 3INZA 2RHZA 3CMAA 1Y71A 2GFUA 2XD0A 3LX7A 2DL5A 2K4YA 5DM7R 1TUCA 1JEGA 2E6ZA 1B07A 2WSFE 1PD0A 2ROTA 1I1JA 1BCOA 3UA7A 3G71A 5HY6A 4ORZA 2YXYA 1BI0A 1KSWA 1NPPA 3ZBDA 2J7IA 4JS4A 3HL8A 4ANJA 5GAMd 1O75A 2ZPBB 4HCZA 2M0YA 1D3BB 3R6NA 1VQOQ 4M7DA 3KBGA 1WHHA 1PRLC 5HK0A 1NZ9A 3CMEA 2VB6A 5A0GA 1UE9A 5GANg 4PNOA 3RUXA 2DEUA 2DBKA 2DL3A 1Q82U 3VS0A 2LQKA 2CP3A 2J06A 2D0NA 4J6XA 4F7UA 3M53A 4IUPA 4M4ZA 1GCQA 1MMAA 2FVUA 1UGPB 2RHYA 2OAWA 1VYVA 3M55A 2D1XA 5LJ3g 5A0DA 2LT4A 1M90R 2CGHA 4N0AC 1PM3A 2YHTA 2R58A 4QQ6A 1YITA 2L8DA 3FEOA 2JUFA 4QQGA 1VQKT 3L2RA 1T0JA 4O6JA 2DZCA 1RABB 3KFVA 3NMZC 2A37A 2ZPFB 2CKKA 1YBYA 3VYHB 1ZA2B 4J7FA 2EJ9A 2RJFA 3TREA 1AT1B 3OYKA 2EVRA 2HBPA 1Q95G 1ZA1B 1MMGA 1W2BS 2CP0A 2QDYB 3SEMA 1QVGP 1VQPQ 3CXCS 2RPNA 3BDUA 3EFRA 5FW9A 2QA4Q 1JU5C 1SEMA 3ER0A 1Q7YR 5FRNA 1QCNA 4OMFB 1FMVA 2DZ9A 2JS2A 4M78F 3OYIA 1WGSA 2HEQA 3P8BB 3OYYA 5FLXE 2RJDA 4YTLA 1ZSZA 2HL5C 1LOJA 8ATCB 1VQMA 3CD6Q 3O8VA 2DM1A 4N4HA 3HPWA 2MPXC 2DF6A 2AIRB 2LTOA 1Y0MA 3SWNC 4LUDA 4FCYA 4IUVA 3SB2A 2KNBB 1HD3A 4NS5A 4X9DA 3X25B 3S6WA 4E7HA 1I5OB 5FROA 1VQ5T 2IG0A 2QAZA 1M8VA 1AWWA 1Q82R 4RTVA 3TCJA 5IHNA 2VUBA 2E65A 3BY7A 1BI3A 4FL6A 2WSEE 3M0TA 1D0YA 3WVDB 4C8QD 1M1KU 1QWFA 4JPBW 1WYXA 2EYQA 1GCPA 4WF2A 3VUBA 3QZ5B 2MWOA 2LT1A 4C8QG 2DEQA 4OMMA 5KYUA 4RG2A 2I0NA 3I56T 4PJOG 4C92F 4J83A 3MEAA 3EG9A 1M3AA 2CUDA 2L3SA 4NL3A 2LJ3A 2M16A 4M78B 3MCAB 1FYNA 5KYNA 4IKFA 5CR2A 3EFSA 3NHNA 4V2SA 1LJOA 4A4GA 3OS5A 2XG8D 3TSWA 2EGCA 4C8QC 1BI1A 2E70A 2QI2A 1GL5A 3UPUA 2E12A 1QKXA 4EMKB 2YUPA 1VQ8Q 2ZPEB 2XDPA 2JM8A 4ESRA 1R0CB 4XU0A 5GMKj 1OI1A 1VQ4T 4F17A 4BI4A 4D8DA 4FW2A 1CKBA 2P0KA 3CMAQ 2KGTA 2QK0A 2E5KA 2VXFA 5IHKA 2KRSA 4AFUC 2HSEB 4M75E 3RNJA 3QWYA 1AOJA 1X2QA 1KC8C 4DQ2A 4JRQA 1KJWA 1N27A 2YRCA 1X43A 3CC2T 1BCMA 4A63B 2EQJA 5AYFA 1JXOA 3HTRA 4AFSC 4EPCA 4WTOB 2V8KA 5KYXB 1GRIA 2GQVA 3AT1B 3JCMc 2JOYA 3G71Q 1RAGB 1WLPB 5HK3A 2FB7A 4KUIA 3CQTA 4FSXA 2OJ2A 3N5BB 2PZ1A 3JCMb 5EC7A 5KE3A 3L2QA 2RI5A 3HRUA 5GAN4 1GXIE 2COWA 1NJIR 1KHCA 1YJWT 3CMEQ 4M7DD 3EH1A 3OW2S 2EYZA 1M1KR 1OYXA 4XU2A 1N5ZA 1H92A 2LDMA 1Q81C 1ACMB 1M4ZA 2EGEA 1WFWA 4JZ3A 3JB9J 4QVDA 4AFZC 4HVVA 4J9FA 2V8IA 4TVRA 1ZSGA 4C0ZA 3TEEA 4UC4A 3OY9A 1JO8A 3RMSA 3SDZA 1GBRA 2OTLT 2XI9A 3OMCA 1R8OB 1UGVA 1D0ZA 3O5ZA 4QKUA 3AHUA 3QG1A 4EIKA 4M7DC 4LDVA 3JAME 1YITQ 4F16A 1WJSA 4KH1B 1QLYA 4ZNXA 2NUTA 2F5TX 5GMKh 3JB9D 4L59A 3CCLA 2A3LA 5GAOr 4PJNA 3VS6A 2J05A 1WDXA 1KK7A 2YDLA 1HK9A 1LPLA 2DXTA 1ZUKA 2RD1A 2XKOC 1Q86U 3CCRT 4II1A 1W6XA 5A2QE 5FRMA 2EGAA 3RDVA 3HKSA 1R0BG 1O9SA 3C0CA 1K8AU 4IUTA 1GCQC 3X28B 4AG2C 1J3TA 3QHSA 4DBHA 3EFOA 2KYBA 1OZ2A 1G3SA 2LCLA 2HNIA 1JB0E 1WX6A 1VQ6T 1HSQA 3GP8A 4AFQC 4JRIA 3A8GB 3M57A 4Z88A 1VQMQ 2PQWA 1PSEA 3V7SA 4M75A 2F1LA 3EG0A 3C12A 1WHLA 1HYOA 1KQ2A 2ZPGB 4LN2A 2O9SA 1E6GA 2AZSA 4ZGEB 3HSBA 3NGPA 2DJZA 1KQSA 2CSQA 3CC4T 5DLOA 3OB9A 2D6FA 3OSVA 3CCVA 2XK0A 4RUGA 3UT1A 2QA4A 1IHWA 2JVVA 4DOVA 2DIQA 3GPLA 1WQ7A 1M2VA 4KBMB 1VIFA 3REBB 1ZSZC 1MUZA 2RO0A 2YWWA 4LDYA 2K79A 1YJ9Q 4C8QF 1ABOA 2L89A 1K4US 4PJMA 1RI9A 4EDUA 1IB8A 4HCKA 4M77E 5FWBA 3CD6A 3SWNB 1ZX6A 1WJQA 1WJRA 4IIMA 1B3QA 4OP0A 2E6NA 3PNWC 5IHIA 2K5LA 1PRMC 1NLPC 3QDFA 4XU3A 3RKYA 2OX7A 1Q86R 2X9HA 1KHIA 2FRWA 1SHFA 2ABLA 2P84A 3OQ5A 4XQ3A 2K5FA 2BIVA 3I35A 4QVZA 3V7CA 5DY9A 1K8AR 2CP5A 2BZ8A 1YFNA 1Y96A 1M2OA 3I5RA 1RL2A 4JUVA 1K73R 3EGDA 1AHJB 2KAFA 2EYXA 2E64A 3C95A 3MP8A 1H3ZA 2DE0X 4HXJA 1W1FA 1AWXA 1WQWA 2PTKA 2DMOA 1X69A 2MWPA 2FYKA 4OMLA 1OZ3A 2NUPA 2KVQG 1C6VX 2QQAA 3HHTB 1YJNT 2K2VA 4C8QB 3PT9A 3WVEB 1M9SA 1YN8A 3CC7T 1WHGA 1OQKA 2GCXA 2CSIA 1KIKA 1G8XA 1YI2T 1VYUA 1M90U 1CSKA 1MNDA 2FZCB 5AT1B 2DERA 2HSPA 7AT1B 4RCCA 3FIFA 2X3XD 1UEBA 1TH7A 5CQXA 1MV3A 2O31A 1D0XA 2DAQA 3EGXA 4RTXA 2YUNA 4KH0B 9ATCB 1YP5A 1VQKA 4M7AE 2XMFA 1QW1A 1H641 3CCMT 1TUGB 2CZ0B 2HZYA 2BZXA 3DB3A 1EFNA 3JCMf 1VQLT 2HMAA 1OPKA 2IIMA 2J6FA 2LJ0A 1AD5A 1ZBXA 1SHGA 4QQDA 4C5HA 3DKMA 4M7DF 4ZN3A 3JB9H 3VRYA 3ME9A 3REAB 1RUWA 2RQRA 1UB4A 3JRZA 2YUOA 1Q7YU 1I5LA 3FLGA 2MCNA 4A4EA 1SPKA 3EG2A 3TVTA 3CCUT 1KQSP 4OVAA 2RK1A 5GJVB 5HKCA 5KYWB 1N8RC 4J9BA 1NBEB 2DXBA 2AK5A 1FX7A 3NFCA 1ZHIA 5GAN2 2F5KA 2QTXA 2DVEA 3VV0A 2F2WA 2G3RA 4F7UF 2RI2A 5KYYA 2L3QA 3CCLQ 3VKIA 1NM7A 1KC8R 5D7UA 3QYGB 3I55A 2ROLA 4FYWB 3DLMA 1B34A 5KCOA 2FHDA 1IZ6A 2DFUA 3JB9F 4ZGJB 3QUIA 4PLLA 4BACA 4MZMA 4M77A 2DD4A 3OYBA 1U5SA 2QYZA 2M9UA 1Y7XA 3BE3A 3GNGA 4QVCA 4M7DB 2VV5A 3D7SB 1SKUB 2X4JA 4LDWA 1JJ2P 4LUEA 2L3PA 2RH2A 1G2BA 1QKWA 2MK5A 2RN8A 3I56A 3UA6A 2QQSA 2COZA 2V1QA 1I07A 2EQIA 1GFCA 2RJEA 3EAEA 1SRLA 4BY6B 4C0FA 1UDLA 1M3CA 1WI7A 3CCQT 4P5NA 2FEIA 3MEWA 2O4XA 4CC3A 3OYCA 4BE1A 4F7UB 2OTJT 2SEMA 4M75D 1TTHB 4O5VA 2CP7A 1WXTA 2DVJA 4XTZA 4F04B 3MKDA 1UHFA 4A4HA 1JXMA 2RMOA 2RQUA 5IAYA 4ELYC 4VUBA 1AZEA 3VS4A 2RNAA 3CCVQ 3JCMe 2FPFA 4ME7A 2NUZA 3PFSA 3WXMB 3MHXA 3V8LA 1VIEA 3M4YA 5HCKA 2EKOA 5GAOp 2VASA 1S1NA 1QVFP 2JTMA 2B86A 1X6OA 3X26B 5KCHA 3CC2A 1VUBA 4M75C 4M7AA 3G6ET 1XTDA 2K57A 4PKCC 1PD1A 4AT1B 4KRTA 3VU3C 2KBTA 5FU7B 1QVGS 4E7IA 2RK2A 1GBQA 1VQ7T 2V8JA 3PTAA 3G71T 4Z89A 2AZVA 4JS5A 2RM4A 4ZGDB 2ZPIB 1QMCA 1YHQA 4J9EA 1NG2A 4CC2A 1TWBA 1VOMA 3G4SA 3GNFB 4OB2B 2VGMA 3VYGA 3HRTA 3URGA 1NJIU 1AWJA 1T3LA 3A8HB 1YJWA 5GAOq 1ZSZB 3CMET 1ZUUA 4DEXA 3PVLA 2R5AA 1ZUYA 1VQ9A 3LH0A 2XDBA 1QQJA 3QIIA 1YIJT 1TG0A 2K3XA 2O88A 4BE0A 1YJ9A 3L42A 1Y57A 2X4WA 4HCBA 2E3IA 4KGZB 1IREB 3J81E 3CPWA 2OTLA 2M0OA 1K9MR 4EMKA 1QP3A 2AKKA 3QPHA 2HDAA 4JJDA 3HFNA 4E2FB 3M4GA 2LNVA 2O01E 4E7LA 4BUGA 1S72T 4B9WA 3J7AF 1N6AA 2YLBA 4D8KA 2E10A 4CI0C 3QWXX 5KYUB 3LWIA 4LD9K 3ASKA 2KI7A 5KH6A 1VQKQ 3CCET 3M9QA 2ED0A 1QVPA 3FC3A 1U8RA 3EG9B 1NPRA 1PC0A 2QTVA 3T9NA 2W0ZA 4LE9A 3PGGA 3MPUB 3OYLA 3FRNA 3CCRA 1T0HA 3PVQA 1K76A
chains in the Genus database with same CATH topology
1WX6A 3I9QA 3H41A 2DL7A 5L23A 1HJDA 5IXFA 4J9IA 2EYWA 2GBQA 4RTZA 1HSQA 5IXBA 3EG3A 1UJYA 4AFQC 2ESWA 3NPFA 2W10A 1BU1A 1XOVA 4Z88A 1MV0B 4OMPA 3EG0A 2RQVA 4WCIA 1E6HA 4CC4B 2KXCA 4LN2A 4J9CA 2O9SA 1E6GA 1H8KA 2JXBA 1AVZC 1PWTA 2AZSA 3NGPA 3H0FA 4HVWA 2CSQA 2BZYA 2DL5A 2KR3A 2DBMA 2CT3A 1A0NB 1TUCA 5I11A 3H0IA 2LZ6B 2CT4A 2K6DA 2YUQA 1JEGA 1PKTA 2ED1A 2KRNA 4RUGA 4OMOA 1UG1A 1M8MA 2KEAA 1B07A 1OPLA 3JV3A 1TUDA 2ROTA 2EYYA 3REBB 2HCKA 1I1JA 1MUZA 3UA7A 4ORZA 2K79A 2DJQA 1KSWA 4R0KA 1ABOA 1YCSB 1K4US 2J7IA 1VA7A 1RI9A 1RLQC 1QWEA 4HCKA 1CKAA 2DRKA 5FWBA 2M0YA 3R6NA 1ZX6A 4FSSA 4IIMA 1B3QA 2VVKA 5IHIA 1PRLC 1UFFA 1PRMC 4E6RA 2KE9A 1SRMA 1NLPC 3FJ5A 2LQWA 2FRWA 1SHFA 2ABLA 4Z8AA 1UE9A 1V1CA 3I35A 2KT1A 2BZ8A 2DBKA 3U23A 3I5RA 2DL3A 1M27C 3VS0A 1NYGA 3EHRA 3LH5A 3EHQA 2EYXA 1U06A 2D8JA 2J06A 2D0NA 1AZGB 2DE0X 2NWMA 4HXJA 1W1FA 4M4ZA 1AWXA 1GCQA 1UUEA 2PTKA 5ECAA 2LQNA 1X2KA 2DMOA 1FMKA 1X69A 3M0PA 2D8HA 1NLOC 5IH2A 2OAWA 1VYVA 4CC7A 2D1XA 4OMLA 4J9GA 1NEBA 3EG1A 2GQIA 1YWOA 3VRZA 2JS0A 4IIOA 3GBQA 2V1RA 2RQTA 2L0AA 1YN8A 2CH4A 2FG0A 1T0JA 2CSIA 1KIKA 2C0OA 1VYUA 3KFVA 1CSKA 3NMZC 2A37A 2FPDA 2HSPA 1UHCA 3VS2A 2JTEA 2X3XD 1MV3A 2O31A 2CDTA 4RTXA 2YUNA 2EVRA 1NYFA 2JW4A 3SHWA 1YP5A 2HBWA 2XMFA 1M3BA 4K11A 3SEMA 4DEYA 1K0SA 2RPNA 1OOTA 2BZXA 4J9HA 1EFNA 5FW9A 2K7AA 1JU5C 1SEMA 1YNZA 1ABQA 2X3WD 4LNPA 3H0HA 1OPKA 2IIMA 3THKA 2J6FA 2LJ0A 1AD5A 1SHGA 2JS2A 2PNIA 2LX7A 1WIEA 3VRYA 3REAB 1RUWA 2RQRA 1W70A 3I5SA 2HEQA 2YUOA 1OEBA 3IQLA 2MCNA 1AWOA 1SPKA 3EG2A 3TVTA 2F2VA 2DM1A 1BBZA 1IO6A 2F2XA 2DX1A 2O2OA 5GJVB 2DF6A 4J9BA 2AK5A 1Y0MA 2DILA 4LUDA 2F2WA 4JZ4A 2BTTA 2KNBB 1HD3A 1K0XA 2L3QA 3PE0A 2SRCA 1M30A 2LJ1A 3EGUA 2VKNA 2GNCA 1NM7A 4J9DA 1AWWA 4RTVA 2ROLA 5IHNA 2FPEA 3M0TA 1QWFA 1Z9QA 1WYXA 4JPBW 4F14A 1GCPA 2KXDA 2M51A 1K9AA 2EW3A 1KFZA 4OMMA 1U3OA 2I0NA 1U5SA 1LCKA 2A08A 2J6OA 1NEGA 5FWCA 2CREA 2LNHB 1M3AA 2CUDA 4GLMA 2L3SA 2LJ3A 5GJWB 1UJ0A 3TSZA 3ZL7C 2MIOA 2H8HA 1FYNA 4LUEA 3NHNA 4X1VA 2FO0A 3A98A 2L3PA 2G6FX 1BB9A 2GTJA 1G2BA 1QKWA 2AKLA 2RN8A 3UA6A 2O9VA 3TSWA 1PKSA 2EGCA 2V1QA 1I07A 2EQIA 1H3HA 1GL5A 1GFCA 4JJBA 2CH4W 1SRLA 1QKXA 4RTYA 1UDLA 2JMAA 2YUPA 1M3CA 1WI7A 4OMQA 2JM8A 1X27A 4ESRA 1YWPA 2VWFA 1I0CA 4F17A 2FEIA 4CC3A 4D8DA 2LMJA 4RTWA 1CKBA 2SEMA 2JM9A 2KGTA 2E5KA 1WXTA 2DVJA 5IHKA 2CUBA 2GGRA 2KRSA 4AFUC 2DL4A 3RNJA 1JQQA 3QWYA 3M0SA 1AOJA 1X2QA 1UHFA 2RQWA 1JXMA 2RMOA 2RQUA 2EPDA 1KJWA 1AZEA 1SSHA 1X43A 3VS4A 2RNAA 3M0RA 3VS3A 4A63B 2FPFA 2NUZA 1ZLMA 1PNJA 1JXOA 4AFSC 1GRIA 1WA7A 5HCKA 2K2MA 1S1NA 4Y92A 2P4RA 2B86A 1WLPB 2K9GA 4AG1C 3CQTA 2OJ2A 1Z9ZA 4KRTA 2LCSA 3ULRB 2PZ1A 2DRMA 2KRMA 2RF0A 1AEYA 3UF4A 2KBTA 1X6GA 2DNUA 5EC7A 1GBQA 4Z89A 2AZVA 2GTOA 1WXUA 1RLPC 4RTUA 1UECA 2A36A 2EYZA 1K1ZA 1N5ZA 1H92A 4GBQA 2DL8A 2K3BA 4J9EA 1NG2A 4CC2A 2C0IA 2EGEA 1AWJA 1T3LA 1WFWA 4JZ3A 4OMNA 4AFZC 1ARKA 4HVVA 2YSQA 4J9FA 3UATA 1PHTA 1ZUUA 1ZSGA 4DEXA 1X6BA 2KT8A 3PVLA 1ZUYA 1JO8A 1GBRA 2J6KA 2FRYA 2C0TA 3M0UA 3VS7A 1UGVA 2EKHA 2KROA 1WXBA 1TG0A 2DYBA 3O5ZA 5I22A 4JJCA 2O88A 4EIKA 1E7OA 1Y57A 3M0QA 1GFDA 2L2PA 3VS1A 2MOXA 4F16A 1QLYA 1T3SA 4ZNXA 2JT4A 2DA9A 2KYMA 2ENMA 2AKKA 1ZBJA 2HDAA 1QCFA 4JJDA 3VS6A 2J05A 2DLPA 3VS5A 1BK2A 1WDXA 2A28A 2YDLA 4D8KA 1ZUKA 1VYTA 1W6XA 2EGAA 3QWXX 4HVUA 3RBBB 3C0CA 2ED0A 2JMCA 1GCQC 4QT7A 4RTTA 2QDLA 2OI3A 2YT6A 4AG2C 1J3TA 2W0ZA 2EBPA 4LE9A 2LP5A 1UTIA 1G83A 1OV3A 2KYBA 1T0HA 3PVQA 2ECZA 1K76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX6 A;  3I9Q A;  3H41 A;  2DL7 A;  5L23 A;  1HJD A;  5IXF A;  4J9I A;  2EYW A;  2GBQ A;  4RTZ A;  1HSQ A;  5IXB A;  3EG3 A;  1UJY A;  4AFQ C;  2ESW A;  3NPF A;  2W10 A;  1BU1 A;  1XOV A;  4Z88 A;  1MV0 B;  4OMP A;  3EG0 A;  2RQV A;  4WCI A;  1E6H A;  4CC4 B;  2KXC A;  4LN2 A;  4J9C A;  2O9S A;  1E6G A;  1H8K A;  2JXB A;  1AVZ C;  1PWT A;  2AZS A;  3NGP A;  3H0F A;  4HVW A;  2CSQ A;  2BZY A;  2DL5 A;  2KR3 A;  2DBM A;  2CT3 A;  1A0N B;  1TUC A;  5I11 A;  3H0I A;  2LZ6 B;  2CT4 A;  2K6D A;  2YUQ A;  1JEG A;  1PKT A;  2ED1 A;  2KRN A;  4RUG A;  4OMO A;  1UG1 A;  1M8M A;  2KEA A;  1B07 A;  1OPL A;  3JV3 A;  1TUD A;  2ROT A;  2EYY A;  3REB B;  2HCK A;  1I1J A;  1MUZ A;  3UA7 A;  4ORZ A;  2K79 A;  2DJQ A;  1KSW A;  4R0K A;  1ABO A;  1YCS B;  1K4U S;  2J7I A;  1VA7 A;  1RI9 A;  1RLQ C;  1QWE A;  4HCK A;  1CKA A;  2DRK A;  5FWB A;  2M0Y A;  3R6N A;  1ZX6 A;  4FSS A;  4IIM A;  1B3Q A;  2VVK A;  5IHI A;  1PRL C;  1UFF A;  1PRM C;  4E6R A;  2KE9 A;  1SRM A;  1NLP C;  3FJ5 A;  2LQW A;  2FRW A;  1SHF A;  2ABL A;  4Z8A A;  1UE9 A;  1V1C A;  3I35 A;  2KT1 A;  2BZ8 A;  2DBK A;  3U23 A;  3I5R A;  2DL3 A;  1M27 C;  3VS0 A;  1NYG A;  3EHR A;  3LH5 A;  3EHQ A;  2EYX A;  1U06 A;  2D8J A;  2J06 A;  2D0N A;  1AZG B;  2DE0 X;  2NWM A;  4HXJ A;  1W1F A;  4M4Z A;  1AWX A;  1GCQ A;  1UUE A;  2PTK A;  5ECA A;  2LQN A;  1X2K A;  2DMO A;  1FMK A;  1X69 A;  3M0P A;  2D8H A;  1NLO C;  5IH2 A;  2OAW A;  1VYV A;  4CC7 A;  2D1X A;  4OML A;  4J9G A;  1NEB A;  3EG1 A;  2GQI A;  1YWO A;  3VRZ A;  2JS0 A;  4IIO A;  3GBQ A;  2V1R A;  2RQT A;  2L0A A;  1YN8 A;  2CH4 A;  2FG0 A;  1T0J A;  2CSI A;  1KIK A;  2C0O A;  1VYU A;  3KFV A;  1CSK A;  3NMZ C;  2A37 A;  2FPD A;  2HSP A;  1UHC A;  3VS2 A;  2JTE A;  2X3X D;  1MV3 A;  2O31 A;  2CDT A;  4RTX A;  2YUN A;  2EVR A;  1NYF A;  2JW4 A;  3SHW A;  1YP5 A;  2HBW A;  2XMF A;  1M3B A;  4K11 A;  3SEM A;  4DEY A;  1K0S A;  2RPN A;  1OOT A;  2BZX A;  4J9H A;  1EFN A;  5FW9 A;  2K7A A;  1JU5 C;  1SEM A;  1YNZ A;  1ABQ A;  2X3W D;  4LNP A;  3H0H A;  1OPK A;  2IIM A;  3THK A;  2J6F A;  2LJ0 A;  1AD5 A;  1SHG A;  2JS2 A;  2PNI A;  2LX7 A;  1WIE A;  3VRY A;  3REA B;  1RUW A;  2RQR A;  1W70 A;  3I5S A;  2HEQ A;  2YUO A;  1OEB A;  3IQL A;  2MCN A;  1AWO A;  1SPK A;  3EG2 A;  3TVT A;  2F2V A;  2DM1 A;  1BBZ A;  1IO6 A;  2F2X A;  2DX1 A;  2O2O A;  5GJV B;  2DF6 A;  4J9B A;  2AK5 A;  1Y0M A;  2DIL A;  4LUD A;  2F2W A;  4JZ4 A;  2BTT A;  2KNB B;  1HD3 A;  1K0X A;  2L3Q A;  3PE0 A;  2SRC A;  1M30 A;  2LJ1 A;  3EGU A;  2VKN A;  2GNC A;  1NM7 A;  4J9D A;  1AWW A;  4RTV A;  2ROL A;  5IHN A;  2FPE A;  3M0T A;  1QWF A;  1Z9Q A;  1WYX A;  4JPB W;  4F14 A;  1GCP A;  2KXD A;  2M51 A;  1K9A A;  2EW3 A;  1KFZ A;  4OMM A;  1U3O A;  2I0N A;  1U5S A;  1LCK A;  2A08 A;  2J6O A;  1NEG A;  5FWC A;  2CRE A;  2LNH B;  1M3A A;  2CUD A;  4GLM A;  2L3S A;  2LJ3 A;  5GJW B;  1UJ0 A;  3TSZ A;  3ZL7 C;  2MIO A;  2H8H A;  1FYN A;  4LUE A;  3NHN A;  4X1V A;  2FO0 A;  3A98 A;  2L3P A;  2G6F X;  1BB9 A;  2GTJ A;  1G2B A;  1QKW A;  2AKL A;  2RN8 A;  3UA6 A;  2O9V A;  3TSW A;  1PKS A;  2EGC A;  2V1Q A;  1I07 A;  2EQI A;  1H3H A;  1GL5 A;  1GFC A;  4JJB A;  2CH4 W;  1SRL A;  1QKX A;  4RTY A;  1UDL A;  2JMA A;  2YUP A;  1M3C A;  1WI7 A;  4OMQ A;  2JM8 A;  1X27 A;  4ESR A;  1YWP A;  2VWF A;  1I0C A;  4F17 A;  2FEI A;  4CC3 A;  4D8D A;  2LMJ A;  4RTW A;  1CKB A;  2SEM A;  2JM9 A;  2KGT A;  2E5K A;  1WXT A;  2DVJ A;  5IHK A;  2CUB A;  2GGR A;  2KRS A;  4AFU C;  2DL4 A;  3RNJ A;  1JQQ A;  3QWY A;  3M0S A;  1AOJ A;  1X2Q A;  1UHF A;  2RQW A;  1JXM A;  2RMO A;  2RQU A;  2EPD A;  1KJW A;  1AZE A;  1SSH A;  1X43 A;  3VS4 A;  2RNA A;  3M0R A;  3VS3 A;  4A63 B;  2FPF A;  2NUZ A;  1ZLM A;  1PNJ A;  1JXO A;  4AFS C;  1GRI A;  1WA7 A;  5HCK A;  2K2M A;  1S1N A;  4Y92 A;  2P4R A;  2B86 A;  1WLP B;  2K9G A;  4AG1 C;  3CQT A;  2OJ2 A;  1Z9Z A;  4KRT A;  2LCS A;  3ULR B;  2PZ1 A;  2DRM A;  2KRM A;  2RF0 A;  1AEY A;  3UF4 A;  2KBT A;  1X6G A;  2DNU A;  5EC7 A;  1GBQ A;  4Z89 A;  2AZV A;  2GTO A;  1WXU A;  1RLP C;  4RTU A;  1UEC A;  2A36 A;  2EYZ A;  1K1Z A;  1N5Z A;  1H92 A;  4GBQ A;  2DL8 A;  2K3B A;  4J9E A;  1NG2 A;  4CC2 A;  2C0I A;  2EGE A;  1AWJ A;  1T3L A;  1WFW A;  4JZ3 A;  4OMN A;  4AFZ C;  1ARK A;  4HVV A;  2YSQ A;  4J9F A;  3UAT A;  1PHT A;  1ZUU A;  1ZSG A;  4DEX A;  1X6B A;  2KT8 A;  3PVL A;  1ZUY A;  1JO8 A;  1GBR A;  2J6K A;  2FRY A;  2C0T A;  3M0U A;  3VS7 A;  1UGV A;  2EKH A;  2KRO A;  1WXB A;  1TG0 A;  2DYB A;  3O5Z A;  5I22 A;  4JJC A;  2O88 A;  4EIK A;  1E7O A;  1Y57 A;  3M0Q A;  1GFD A;  2L2P A;  3VS1 A;  2MOX A;  4F16 A;  1QLY A;  1T3S A;  4ZNX A;  2JT4 A;  2DA9 A;  2KYM A;  2ENM A;  2AKK A;  1ZBJ A;  2HDA A;  1QCF A;  4JJD A;  3VS6 A;  2J05 A;  2DLP A;  3VS5 A;  1BK2 A;  1WDX A;  2A28 A;  2YDL A;  4D8K A;  1ZUK A;  1VYT A;  1W6X A;  2EGA A;  3QWX X;  4HVU A;  3RBB B;  3C0C A;  2ED0 A;  2JMC A;  1GCQ C;  4QT7 A;  4RTT A;  2QDL A;  2OI3 A;  2YT6 A;  4AG2 C;  1J3T A;  2W0Z A;  2EBP A;  4LE9 A;  2LP5 A;  1UTI A;  1G83 A;  1OV3 A;  2KYB A;  1T0H A;  3PVQ A;  2ECZ A;  1K76 A; 
#chains in the Genus database with same CATH topology
 3I9Q A;  3H41 A;  1D1A A;  2DL7 A;  2YRV A;  5L23 A;  5IXF A;  1HJD A;  4BD3 A;  2GBQ A;  4C92 A;  2XID A;  4R55 A;  2IPO B;  5IXB A;  4OB1 B;  2PVD B;  4HT9 A;  1XQH A;  3NPF A;  1XOV A;  1MV0 B;  3QDR B;  4OMP A;  2M1H A;  4DBR A;  3F70 A;  1P92 A;  4CC4 B;  2KXC A;  3MJX A;  2QQR A;  1VQ6 A;  2DKG A;  1H8K A;  3H0F A;  3MEU A;  4HVW A;  5GAM f;  3LGF A;  3OMG A;  8AT1 B;  1BYM A;  3MP6 A;  3CBP A;  5A0L A;  3I55 Q;  3H0I A;  1B7T A;  4N4G A;  2LZ6 B;  3L2U A;  2YUQ A;  2VGN A;  1D1B A;  5GAN 3;  3CCS T;  1PKT A;  4DA4 A;  3P8H A;  1VQN T;  4OMO A;  1UG1 A;  5J26 A;  2KEA A;  1OPL A;  3CC4 A;  4M7D G;  1TUD A;  2EYY A;  2HCK A;  2MMP A;  1WHM A;  3DB4 A;  2DJQ A;  1YCS B;  5I21 A;  4M77 D;  1RLQ C;  3PMI A;  1D1C A;  5CKD A;  4FU6 A;  1MMD A;  1CKA A;  2DRK A;  3JCM d;  4Q5W A;  4FSS A;  3E1S A;  4EMG A;  2DTH A;  3QJ6 A;  1UFF A;  3I56 Q;  5LJ5 j;  2ZGW A;  1KD1 R;  2E41 A;  2KE9 A;  1SRM A;  4F7U G;  4L6V 5;  2YLC A;  5KE2 A;  3FJ5 A;  1WHK A;  1V1C A;  2KT1 A;  2XHC A;  3RR6 A;  1LNX A;  2JZ2 A;  4PJO E;  4BY6 C;  1M27 C;  4C0G A;  4MZP A;  3LH5 A;  3EHQ A;  3UWN A;  3JB9 G;  4M77 C;  5GAN 6;  1Q7Y C;  3QO3 A;  3L2V A;  4LDU A;  4FM4 B;  5ECA A;  1VQ4 Q;  2D8H A;  3RER A;  3CPW P;  4M75 F;  1NLO C;  5IH2 A;  2QEX A;  1K73 U;  4CC7 A;  1RAI B;  1NEB A;  3NTH A;  3EG1 A;  2GQI A;  2NUT B;  5GAO n;  2HQH A;  1ZQ1 A;  2JS0 A;  5J3B A;  4FYX B;  2FZG B;  2ZAE A;  2V1R A;  2L0A A;  2AT1 B;  2BUD A;  4Y28 E;  3CC2 Q;  2FG0 A;  4ELZ C;  2K3Y A;  2ZCF B;  1MGQ A;  1F1B B;  2C0O A;  2Y4X A;  3BDL A;  1UHC A;  3VS2 A;  2JTE A;  1R77 A;  1YJN A;  4M7A D;  4B6M A;  3QKJ A;  3OSS C;  2CDT A;  2BKD N;  2JNG A;  1NYF A;  1G3T A;  2JW4 A;  1BIB A;  2CS7 A;  1Q82 C;  5DLQ E;  4C5G A;  2VXE A;  3CC7 A;  1M3B A;  4K11 A;  4M7A G;  3EFO B;  4J6Y A;  5LJ5 f;  1YI2 A;  5FU7 C;  1OOT A;  2K7A A;  3QJY A;  4J8O A;  1YNZ A;  1ABQ A;  2X3W D;  5CK9 A;  4LNP A;  3H0H A;  4LD6 A;  2MF2 A;  1YHQ Q;  3THK A;  3CCJ T;  3G4S Q;  5GAN 5;  3P8D A;  4JJN K;  3CBO A;  1YJW Q;  2P0Q A;  3CCM A;  1WIE A;  3SD4 A;  3I5S A;  1OEB A;  1NE8 A;  2E3H A;  4RG8 A;  4M7A C;  4X34 A;  1VQL A;  2F2V A;  4M75 B;  3JCM g;  4XTU A;  1VQ9 Q;  1BBZ A;  1IO6 A;  1EIF A;  2RHU A;  2B8A A;  4XTX A;  5LJ5 h;  1WHJ A;  4PLI A;  2BE9 B;  1OX8 A;  4ZN1 A;  4GLK A;  4BE2 A;  2DIL A;  3ZEH A;  4JZ4 A;  3OYG A;  2X51 A;  2E4H A;  2OTL Q;  1K0X A;  3PE0 A;  1M30 A;  2LJ1 A;  3EGU A;  3V8K A;  3L2W A;  2NYS A;  5D6W A;  2RB6 A;  4B9X A;  1M2V B;  1Z9Q A;  5IN1 A;  4F14 A;  4KUD K;  1JRI A;  4E7Z A;  2KXD A;  2M51 A;  1K9A A;  2EW3 A;  1VQO T;  1KC8 U;  1KFZ A;  1U3O A;  2FZK B;  2A08 A;  2HD0 A;  2J6O A;  3A8L B;  5FWC A;  2LNH B;  1SSF A;  4GLM A;  3A1P A;  3CCR Q;  3JCM W;  2MIO A;  2H8H A;  3LYI A;  2PVO B;  1LVK A;  4X1V A;  2FO0 A;  3A98 A;  1W2B A;  1V29 B;  2EAY A;  2O9V A;  4PJO A;  1PKS A;  3CXC A;  2RI3 A;  1H3H A;  2L3R A;  2DTI A;  1X01 A;  2CH4 W;  2P4T A;  4XTV A;  5CAI A;  4OMQ A;  3NTK A;  4IUR A;  1X27 A;  1Y96 B;  3OYM A;  4LDX A;  2VWF A;  3EGD B;  2HQE A;  1FMW A;  4MZT A;  3M58 A;  3QZ9 B;  1VQ6 Q;  2GFA A;  4OF1 A;  1NJI C;  3LW5 E;  2LMJ A;  2DXU A;  2NLU A;  1BIA A;  1M1K C;  1G3W A;  4IUU A;  2CUB A;  2DL4 A;  2MAM A;  1JQQ A;  1KG1 A;  2RQW A;  3CCQ A;  5LJ5 e;  2EQK A;  1RAF B;  1I4K 1;  2EPD A;  4KT0 E;  1SSH A;  1Q81 U;  2NUP B;  4ZTF A;  1ZLM A;  1PNJ A;  1IGU A;  3JB9 I;  3CC4 Q;  2DYI A;  2VC8 A;  2K2M A;  2P4R A;  3A5Z B;  1OU9 A;  3MET A;  4AG1 C;  1U1S A;  2CZ7 B;  4KUL A;  1VQP T;  3CCV T;  5C6S A;  2QA4 T;  4XU1 A;  3EGX B;  1WZO A;  1Z9Z A;  2LCS A;  4D6W A;  2DRM A;  2KRM A;  2RF0 A;  1AEY A;  3UF4 A;  1M1F A;  4N4I A;  2L5Q A;  1D3B A;  2JN0 A;  1C1A A;  4M77 F;  3V8J A;  1WXU A;  3JCM h;  4RTU A;  1U1T A;  4FW1 A;  3G6E A;  4BDZ A;  2KK4 A;  2A36 A;  4A4K A;  4M78 E;  2COY A;  4KGV B;  3CD6 T;  1G5V A;  2K3B A;  3TU4 K;  1VQ7 A;  2C0I A;  4FIB A;  1X75 C;  4C5E A;  4JRP A;  4OMN A;  4QW2 A;  1I8F A;  2YSQ A;  4KGX B;  1KQS S;  1X6B A;  2KT8 A;  2DK3 A;  1JBM A;  2C0T A;  2P0P A;  1VQ5 A;  1OUL A;  3M0U A;  3VS7 A;  2QEX Q;  2QXF A;  2KRO A;  5I22 A;  4JJC A;  3LWH A;  3VJP A;  2IVW A;  3L2Z A;  3M0Q A;  1GFD A;  2L2P A;  3QYH B;  4A4F A;  4PJJ A;  2KSS A;  5KYY B;  2QGG A;  2QQ9 A;  3G1J A;  4E7S A;  1TOV A;  1TSF A;  1G3Y A;  1OU8 A;  2ENM A;  3CBM A;  4BI8 B;  1IHV A;  4C0D B;  1B34 B;  1YIJ A;  1BK2 A;  3H6Z A;  2MI6 A;  1IXD A;  2AHJ B;  2CZ1 B;  1VYT A;  4ZTJ A;  1YJN Q;  4J6W A;  4M77 B;  1SG5 A;  4HCC A;  4C92 E;  1K9M U;  1QCO A;  3OYE A;  1RAE B;  4DBF A;  2V26 A;  3CC7 Q;  2JMC A;  2ZZD A;  1Q81 R;  4RTT A;  2QDL A;  4BDY A;  1YI2 Q;  2EBP A;  1W2B P;  1S72 A;  3HP9 A;  4M7A F;  1UTI A;  5L8R E;  1OV3 A;  5J39 A;  1JJ2 S;  2HL3 A;  2DPP B;  3CXC P;  5GAN j;  4DBQ A;  1VQ8 T;  3OYD A;  4M75 G;  5CKB A;  1IGQ A;  2CP6 A;  2HKN A;  3CCE A;  2Y90 A;  4J9I A;  1VQ4 A;  2H3E B;  4RTZ A;  3CCM Q;  3EG3 A;  1UJY A;  3CMA T;  6AT1 B;  3OW2 A;  4E47 A;  3QBY A;  1VQL Q;  2LCC A;  3JCM V;  2O4X B;  4DOW A;  5LJ3 j;  2ZPH B;  2JXB A;  1AVZ C;  1PWT A;  4PFP A;  2YRD A;  1Q86 C;  5C0M A;  4PFZ A;  5M9O A;  3FDR A;  3CCU Q;  1RAC B;  4HA8 A;  2BZY A;  1K8A C;  2KR3 A;  1UGR B;  2DBM A;  2CT3 A;  1A0N B;  4PK4 A;  4X9C A;  1K73 C;  4HT8 A;  5I11 A;  5FU6 B;  2CT4 A;  2K6D A;  2RHI A;  2XDD A;  2ED1 A;  2KRN A;  4FYV B;  1OX9 A;  1FWZ A;  1M8M A;  5GAM g;  2XU8 A;  1QVF S;  3G7Z A;  3JV3 A;  3EH2 A;  3QXE B;  2E1H A;  4M7A B;  3GLX A;  4CRI A;  3I55 T;  4R0K A;  3ZFJ A;  1VA7 A;  3CCS A;  4LXC A;  5LJ5 d;  1VQN A;  1QWE A;  5GAN f;  4MDW A;  2CYZ B;  4M78 A;  3QSU A;  4J7I A;  2VVK A;  3A8M B;  1IRX A;  5I2M A;  4E6R A;  2I2L A;  2PVG B;  5GAM j;  3MP1 A;  4NOY A;  2LQW A;  4Z8A A;  3FJP A;  4PJO D;  1HXD A;  3HRS A;  2X35 A;  1WPY A;  1W4S A;  3U23 A;  4JDS A;  1NYG A;  3EHR A;  5LJ3 f;  1KD1 U;  1U06 A;  2D8J A;  1AZG B;  2NWM A;  5GAN h;  1YIT T;  3M5A A;  4OB3 B;  3CCQ Q;  1UUE A;  3GF5 A;  2LQN A;  1X2K A;  2HKQ B;  1FMK A;  3M0P A;  2OTJ Q;  3H8Z A;  1EX4 A;  1UGQ B;  4J9G A;  1PSF A;  3LGL A;  3V7R A;  1YWO A;  2RHX A;  3VRZ A;  3JSC A;  4PJO C;  5KYX A;  4IIO A;  3Q1J A;  3GBQ A;  2RQT A;  2LX9 A;  5LJ3 h;  4ATO A;  2CH4 A;  2BE7 D;  1BKB A;  3HFO A;  1N8R U;  4RCB A;  2FPD A;  3BW1 A;  3DLL A;  3E9F A;  3RES A;  4NL2 A;  2LRQ A;  3KUF A;  3SHW A;  2X4X A;  2HBW A;  3OYA A;  3CPF A;  4DEY A;  4Z02 A;  3G6E Q;  1K0S A;  1MHN A;  4J9H A;  2XIC A;  4XK8 E;  1VQM T;  5CIU A;  3OW2 P;  3TQ7 P;  3OYF A;  2DO3 A;  3H9N A;  5D6X A;  1VQ7 Q;  5D6Y A;  2KMT A;  4C92 B;  3OS0 A;  3X24 B;  2EWN A;  1TXQ A;  2PNI A;  1TU0 B;  5GMK m;  2KQW A;  2LX7 A;  2OAU A;  5LJ5 g;  4JRK A;  1W70 A;  5CCA A;  3E9G A;  3IQL A;  1AWO A;  3RKX A;  3OS1 A;  1N9S A;  4E7J A;  1VQ5 Q;  2F2X A;  3CCJ A;  1YHQ T;  2DX1 A;  2O2O A;  4PL6 A;  3G4S T;  1TS9 A;  4A54 A;  4RMO A;  4A53 A;  4E7K A;  1M90 C;  5GAM h;  5GAN e;  3OYJ A;  2BTT A;  4EMH A;  4JLI A;  3OBW A;  3X20 B;  3S3O A;  3GOX A;  4OGC A;  2SRC A;  1VQ9 T;  4M77 G;  3RIR A;  2VKN A;  2GNC A;  1BI2 A;  4J9D A;  1YIJ Q;  1SF9 A;  2FPE A;  1YJ9 T;  2X4Y A;  5CKE A;  3M59 A;  3RKW A;  1EZZ B;  5GMK l;  5GAO m;  2ATC B;  2FL7 A;  4C0D C;  4C8Q E;  1RI0 A;  3E19 A;  5LJ3 e;  3UDC A;  3KXT A;  1LCK A;  2CP2 A;  3LLR A;  1NEG A;  3CEY A;  1S72 Q;  2CRE A;  2JTF A;  3PMT A;  3OA6 A;  5GJW B;  1UJ0 A;  4R56 A;  3TSZ A;  3ZL7 C;  3JCM X;  3CCE Q;  3C94 A;  1VQO A;  2G6F X;  1BB9 A;  2GF7 A;  3M56 A;  2GTJ A;  4N0A A;  1N8R R;  2RJC A;  2AKL A;  2Z0W A;  2EFI A;  1V76 A;  4JJB A;  2QGF B;  1DJ7 B;  4RTY A;  2JMA A;  2D0Q B;  2F69 A;  5GAO l;  4JLG A;  2A0F B;  1YWP A;  1I0C A;  3BFM A;  4FYY B;  5GAN 8;  3VUZ A;  4RTW A;  1Y07 A;  3JCM P;  2JM9 A;  3OBY A;  2LC4 A;  4XTW A;  2M02 A;  2GGR A;  4AMC A;  3OYH A;  1PCX A;  4HKE A;  3CPW S;  3M0S A;  1XNI A;  4PFO A;  2KDS A;  4L5G A;  3NTI A;  2DIG A;  2DET A;  2KY9 A;  5GAM e;  2DXC A;  3M0R A;  3VS3 A;  2R57 A;  1KQ1 A;  1M5Q 1;  1WA7 A;  4J5Y A;  5FU6 C;  1MMN A;  5CO7 A;  5CQY A;  2Y4Y A;  4Y92 A;  1MNE A;  5LL6 S;  4PJL A;  4BB7 A;  2K9G A;  2WSC E;  1XJW B;  2HAX A;  3CCS Q;  3C4S A;  4BI3 A;  1VQN Q;  2K5I A;  1RAD B;  2HQX A;  3ULR B;  1WNL A;  3S3M A;  1K9M C;  5GAN 7;  1X6G A;  2DNU A;  4IUQ A;  3SWN A;  3MEV A;  2EJF A;  2GTO A;  1RLP C;  4M78 D;  1VQP A;  1UEC A;  3M54 A;  1K1Z A;  4M7D E;  2JJ9 A;  4GBQ A;  4MML A;  5GMK e;  3CCU A;  2DL8 A;  1YCY A;  4M78 G;  2CZ6 B;  4XTY A;  2WAC A;  3JCM J;  5IT9 E;  2D9T A;  4MDX A;  2H3J A;  1ARK A;  3UAT A;  1PHT A;  2EQM A;  4PJO F;  4OB0 B;  4FT4 A;  2LQ8 A;  2J6K A;  2FRY A;  3OS2 A;  3J80 E;  3CCL T;  2PUK B;  3JCM Q;  2DD5 A;  2EKH A;  1WXB A;  2DYB A;  4F7U E;  4M78 C;  3RMQ A;  1E7O A;  3PIO A;  3VS1 A;  2MOX A;  2RA2 A;  2EJG A;  2VYT A;  5CKH A;  5CKF A;  1T3S A;  1JJ2 A;  3OYN A;  4MMK A;  1C0M A;  2JT4 A;  2DA9 A;  2KYM A;  5GMK i;  4FT2 A;  2MYS A;  4C5I A;  1ZBJ A;  1QCF A;  5CVI A;  4C8Q A;  2DLP A;  3VS5 A;  2QEX T;  3R6O A;  4EMK C;  2A28 A;  3FB9 A;  3SFM A;  2E5Q A;  4GY5 A;  2A7Y A;  2PUO B;  4C92 D;  3A8O B;  1QP2 A;  1D09 B;  3PIP A;  4HVU A;  2DTO A;  5EG2 A;  5GAN d;  3RBB B;  2EQU A;  4C92 G;  4QT7 A;  2C06 A;  2OI3 A;  1N9R A;  2QQB A;  2YT6 A;  3GIB A;  1RAA B;  1I81 A;  2LP5 A;  1G83 A;  5I2S A;  2LVM A;  2ECZ A;  1M1G A;  4XAX B;  2QG9 B;  1QVG A;  1FXX A;  2EYW A;  4PJO B;  3MO8 A;  2PU9 B;  2OTJ A;  2R5M A;  4RKU E;  2EIF A;  5LJ3 d;  4C92 C;  2ESW A;  1RAH B;  1PG5 B;  1BU1 A;  2W10 A;  3S3N A;  1VQ8 A;  3CCJ Q;  1QVF A;  1UGS B;  2RQV A;  4WCI A;  1E6H A;  4OGE A;  3L1A A;  1KD1 C;  3E2U A;  4J9C A;  4Y91 A;  5KYW A;  2QAS A;  3INZ A;  2RHZ A;  3CMA A;  1Y71 A;  2GFU A;  2XD0 A;  3LX7 A;  2DL5 A;  2K4Y A;  5DM7 R;  1TUC A;  1JEG A;  2E6Z A;  1B07 A;  2WSF E;  1PD0 A;  2ROT A;  1I1J A;  1BCO A;  3UA7 A;  3G71 A;  5HY6 A;  4ORZ A;  2YXY A;  1BI0 A;  1KSW A;  1NPP A;  3ZBD A;  2J7I A;  4JS4 A;  3HL8 A;  4ANJ A;  5GAM d;  1O75 A;  2ZPB B;  4HCZ A;  2M0Y A;  1D3B B;  3R6N A;  1VQO Q;  4M7D A;  3KBG A;  1WHH A;  1PRL C;  5HK0 A;  1NZ9 A;  3CME A;  2VB6 A;  5A0G A;  1UE9 A;  5GAN g;  4PNO A;  3RUX A;  2DEU A;  2DBK A;  2DL3 A;  1Q82 U;  3VS0 A;  2LQK A;  2CP3 A;  2J06 A;  2D0N A;  4J6X A;  4F7U A;  3M53 A;  4IUP A;  4M4Z A;  1GCQ A;  1MMA A;  2FVU A;  1UGP B;  2RHY A;  2OAW A;  1VYV A;  3M55 A;  2D1X A;  5LJ3 g;  5A0D A;  2LT4 A;  1M90 R;  2CGH A;  4N0A C;  1PM3 A;  2YHT A;  2R58 A;  4QQ6 A;  1YIT A;  2L8D A;  3FEO A;  2JUF A;  4QQG A;  1VQK T;  3L2R A;  1T0J A;  4O6J A;  2DZC A;  1RAB B;  3KFV A;  3NMZ C;  2A37 A;  2ZPF B;  2CKK A;  1YBY A;  3VYH B;  1ZA2 B;  4J7F A;  2EJ9 A;  2RJF A;  3TRE A;  1AT1 B;  3OYK A;  2EVR A;  2HBP A;  1Q95 G;  1ZA1 B;  1MMG A;  1W2B S;  2CP0 A;  2QDY B;  3SEM A;  1QVG P;  1VQP Q;  3CXC S;  2RPN A;  3BDU A;  3EFR A;  5FW9 A;  2QA4 Q;  1JU5 C;  1SEM A;  3ER0 A;  1Q7Y R;  5FRN A;  1QCN A;  4OMF B;  1FMV A;  2DZ9 A;  2JS2 A;  4M78 F;  3OYI A;  1WGS A;  2HEQ A;  3P8B B;  3OYY A;  5FLX E;  2RJD A;  4YTL A;  1ZSZ A;  2HL5 C;  1LOJ A;  8ATC B;  1VQM A;  3CD6 Q;  3O8V A;  2DM1 A;  4N4H A;  3HPW A;  2MPX C;  2DF6 A;  2AIR B;  2LTO A;  1Y0M A;  3SWN C;  4LUD A;  4FCY A;  4IUV A;  3SB2 A;  2KNB B;  1HD3 A;  4NS5 A;  4X9D A;  3X25 B;  3S6W A;  4E7H A;  1I5O B;  5FRO A;  1VQ5 T;  2IG0 A;  2QAZ A;  1M8V A;  1AWW A;  1Q82 R;  4RTV A;  3TCJ A;  5IHN A;  2VUB A;  2E65 A;  3BY7 A;  1BI3 A;  4FL6 A;  2WSE E;  3M0T A;  1D0Y A;  3WVD B;  4C8Q D;  1M1K U;  1QWF A;  4JPB W;  1WYX A;  2EYQ A;  1GCP A;  4WF2 A;  3VUB A;  3QZ5 B;  2MWO A;  2LT1 A;  4C8Q G;  2DEQ A;  4OMM A;  5KYU A;  4RG2 A;  2I0N A;  3I56 T;  4PJO G;  4C92 F;  4J83 A;  3MEA A;  3EG9 A;  1M3A A;  2CUD A;  2L3S A;  4NL3 A;  2LJ3 A;  2M16 A;  4M78 B;  3MCA B;  1FYN A;  5KYN A;  4IKF A;  5CR2 A;  3EFS A;  3NHN A;  4V2S A;  1LJO A;  4A4G A;  3OS5 A;  2XG8 D;  3TSW A;  2EGC A;  4C8Q C;  1BI1 A;  2E70 A;  2QI2 A;  1GL5 A;  3UPU A;  2E12 A;  1QKX A;  4EMK B;  2YUP A;  1VQ8 Q;  2ZPE B;  2XDP A;  2JM8 A;  4ESR A;  1R0C B;  4XU0 A;  5GMK j;  1OI1 A;  1VQ4 T;  4F17 A;  4BI4 A;  4D8D A;  4FW2 A;  1CKB A;  2P0K A;  3CMA Q;  2KGT A;  2QK0 A;  2E5K A;  2VXF A;  5IHK A;  2KRS A;  4AFU C;  2HSE B;  4M75 E;  3RNJ A;  3QWY A;  1AOJ A;  1X2Q A;  1KC8 C;  4DQ2 A;  4JRQ A;  1KJW A;  1N27 A;  2YRC A;  1X43 A;  3CC2 T;  1BCM A;  4A63 B;  2EQJ A;  5AYF A;  1JXO A;  3HTR A;  4AFS C;  4EPC A;  4WTO B;  2V8K A;  5KYX B;  1GRI A;  2GQV A;  3AT1 B;  3JCM c;  2JOY A;  3G71 Q;  1RAG B;  1WLP B;  5HK3 A;  2FB7 A;  4KUI A;  3CQT A;  4FSX A;  2OJ2 A;  3N5B B;  2PZ1 A;  3JCM b;  5EC7 A;  5KE3 A;  3L2Q A;  2RI5 A;  3HRU A;  5GAN 4;  1GXI E;  2COW A;  1NJI R;  1KHC A;  1YJW T;  3CME Q;  4M7D D;  3EH1 A;  3OW2 S;  2EYZ A;  1M1K R;  1OYX A;  4XU2 A;  1N5Z A;  1H92 A;  2LDM A;  1Q81 C;  1ACM B;  1M4Z A;  2EGE A;  1WFW A;  4JZ3 A;  3JB9 J;  4QVD A;  4AFZ C;  4HVV A;  4J9F A;  2V8I A;  4TVR A;  1ZSG A;  4C0Z A;  3TEE A;  4UC4 A;  3OY9 A;  1JO8 A;  3RMS A;  3SDZ A;  1GBR A;  2OTL T;  2XI9 A;  3OMC A;  1R8O B;  1UGV A;  1D0Z A;  3O5Z A;  4QKU A;  3AHU A;  3QG1 A;  4EIK A;  4M7D C;  4LDV A;  3JAM E;  1YIT Q;  4F16 A;  1WJS A;  4KH1 B;  1QLY A;  4ZNX A;  2NUT A;  2F5T X;  5GMK h;  3JB9 D;  4L59 A;  3CCL A;  2A3L A;  5GAO r;  4PJN A;  3VS6 A;  2J05 A;  1WDX A;  1KK7 A;  2YDL A;  1HK9 A;  1LPL A;  2DXT A;  1ZUK A;  2RD1 A;  2XKO C;  1Q86 U;  3CCR T;  4II1 A;  1W6X A;  5A2Q E;  5FRM A;  2EGA A;  3RDV A;  3HKS A;  1R0B G;  1O9S A;  3C0C A;  1K8A U;  4IUT A;  1GCQ C;  3X28 B;  4AG2 C;  1J3T A;  3QHS A;  4DBH A;  3EFO A;  2KYB A;  1OZ2 A;  1G3S A;  2LCL A;  2HNI A;  1JB0 E;  1WX6 A;  1VQ6 T;  1HSQ A;  3GP8 A;  4AFQ C;  4JRI A;  3A8G B;  3M57 A;  4Z88 A;  1VQM Q;  2PQW A;  1PSE A;  3V7S A;  4M75 A;  2F1L A;  3EG0 A;  3C12 A;  1WHL A;  1HYO A;  1KQ2 A;  2ZPG B;  4LN2 A;  2O9S A;  1E6G A;  2AZS A;  4ZGE B;  3HSB A;  3NGP A;  2DJZ A;  1KQS A;  2CSQ A;  3CC4 T;  5DLO A;  3OB9 A;  2D6F A;  3OSV A;  3CCV A;  2XK0 A;  4RUG A;  3UT1 A;  2QA4 A;  1IHW A;  2JVV A;  4DOV A;  2DIQ A;  3GPL A;  1WQ7 A;  1M2V A;  4KBM B;  1VIF A;  3REB B;  1ZSZ C;  1MUZ A;  2RO0 A;  2YWW A;  4LDY A;  2K79 A;  1YJ9 Q;  4C8Q F;  1ABO A;  2L89 A;  1K4U S;  4PJM A;  1RI9 A;  4EDU A;  1IB8 A;  4HCK A;  4M77 E;  5FWB A;  3CD6 A;  3SWN B;  1ZX6 A;  1WJQ A;  1WJR A;  4IIM A;  1B3Q A;  4OP0 A;  2E6N A;  3PNW C;  5IHI A;  2K5L A;  1PRM C;  1NLP C;  3QDF A;  4XU3 A;  3RKY A;  2OX7 A;  1Q86 R;  2X9H A;  1KHI A;  2FRW A;  1SHF A;  2ABL A;  2P84 A;  3OQ5 A;  4XQ3 A;  2K5F A;  2BIV A;  3I35 A;  4QVZ A;  3V7C A;  5DY9 A;  1K8A R;  2CP5 A;  2BZ8 A;  1YFN A;  1Y96 A;  1M2O A;  3I5R A;  1RL2 A;  4JUV A;  1K73 R;  3EGD A;  1AHJ B;  2KAF A;  2EYX A;  2E64 A;  3C95 A;  3MP8 A;  1H3Z A;  2DE0 X;  4HXJ A;  1W1F A;  1AWX A;  1WQW A;  2PTK A;  2DMO A;  1X69 A;  2MWP A;  2FYK A;  4OML A;  1OZ3 A;  2NUP A;  2KVQ G;  1C6V X;  2QQA A;  3HHT B;  1YJN T;  2K2V A;  4C8Q B;  3PT9 A;  3WVE B;  1M9S A;  1YN8 A;  3CC7 T;  1WHG A;  1OQK A;  2GCX A;  2CSI A;  1KIK A;  1G8X A;  1YI2 T;  1VYU A;  1M90 U;  1CSK A;  1MND A;  2FZC B;  5AT1 B;  2DER A;  2HSP A;  7AT1 B;  4RCC A;  3FIF A;  2X3X D;  1UEB A;  1TH7 A;  5CQX A;  1MV3 A;  2O31 A;  1D0X A;  2DAQ A;  3EGX A;  4RTX A;  2YUN A;  4KH0 B;  9ATC B;  1YP5 A;  1VQK A;  4M7A E;  2XMF A;  1QW1 A;  1H64 1;  3CCM T;  1TUG B;  2CZ0 B;  2HZY A;  2BZX A;  3DB3 A;  1EFN A;  3JCM f;  1VQL T;  2HMA A;  1OPK A;  2IIM A;  2J6F A;  2LJ0 A;  1AD5 A;  1ZBX A;  1SHG A;  4QQD A;  4C5H A;  3DKM A;  4M7D F;  4ZN3 A;  3JB9 H;  3VRY A;  3ME9 A;  3REA B;  1RUW A;  2RQR A;  1UB4 A;  3JRZ A;  2YUO A;  1Q7Y U;  1I5L A;  3FLG A;  2MCN A;  4A4E A;  1SPK A;  3EG2 A;  3TVT A;  3CCU T;  1KQS P;  4OVA A;  2RK1 A;  5GJV B;  5HKC A;  5KYW B;  1N8R C;  4J9B A;  1NBE B;  2DXB A;  2AK5 A;  1FX7 A;  3NFC A;  1ZHI A;  5GAN 2;  2F5K A;  2QTX A;  2DVE A;  3VV0 A;  2F2W A;  2G3R A;  4F7U F;  2RI2 A;  5KYY A;  2L3Q A;  3CCL Q;  3VKI A;  1NM7 A;  1KC8 R;  5D7U A;  3QYG B;  3I55 A;  2ROL A;  4FYW B;  3DLM A;  1B34 A;  5KCO A;  2FHD A;  1IZ6 A;  2DFU A;  3JB9 F;  4ZGJ B;  3QUI A;  4PLL A;  4BAC A;  4MZM A;  4M77 A;  2DD4 A;  3OYB A;  1U5S A;  2QYZ A;  2M9U A;  1Y7X A;  3BE3 A;  3GNG A;  4QVC A;  4M7D B;  2VV5 A;  3D7S B;  1SKU B;  2X4J A;  4LDW A;  1JJ2 P;  4LUE A;  2L3P A;  2RH2 A;  1G2B A;  1QKW A;  2MK5 A;  2RN8 A;  3I56 A;  3UA6 A;  2QQS A;  2COZ A;  2V1Q A;  1I07 A;  2EQI A;  1GFC A;  2RJE A;  3EAE A;  1SRL A;  4BY6 B;  4C0F A;  1UDL A;  1M3C A;  1WI7 A;  3CCQ T;  4P5N A;  2FEI A;  3MEW A;  2O4X A;  4CC3 A;  3OYC A;  4BE1 A;  4F7U B;  2OTJ T;  2SEM A;  4M75 D;  1TTH B;  4O5V A;  2CP7 A;  1WXT A;  2DVJ A;  4XTZ A;  4F04 B;  3MKD A;  1UHF A;  4A4H A;  1JXM A;  2RMO A;  2RQU A;  5IAY A;  4ELY C;  4VUB A;  1AZE A;  3VS4 A;  2RNA A;  3CCV Q;  3JCM e;  2FPF A;  4ME7 A;  2NUZ A;  3PFS A;  3WXM B;  3MHX A;  3V8L A;  1VIE A;  3M4Y A;  5HCK A;  2EKO A;  5GAO p;  2VAS A;  1S1N A;  1QVF P;  2JTM A;  2B86 A;  1X6O A;  3X26 B;  5KCH A;  3CC2 A;  1VUB A;  4M75 C;  4M7A A;  3G6E T;  1XTD A;  2K57 A;  4PKC C;  1PD1 A;  4AT1 B;  4KRT A;  3VU3 C;  2KBT A;  5FU7 B;  1QVG S;  4E7I A;  2RK2 A;  1GBQ A;  1VQ7 T;  2V8J A;  3PTA A;  3G71 T;  4Z89 A;  2AZV A;  4JS5 A;  2RM4 A;  4ZGD B;  2ZPI B;  1QMC A;  1YHQ A;  4J9E A;  1NG2 A;  4CC2 A;  1TWB A;  1VOM A;  3G4S A;  3GNF B;  4OB2 B;  2VGM A;  3VYG A;  3HRT A;  3URG A;  1NJI U;  1AWJ A;  1T3L A;  3A8H B;  1YJW A;  5GAO q;  1ZSZ B;  3CME T;  1ZUU A;  4DEX A;  3PVL A;  2R5A A;  1ZUY A;  1VQ9 A;  3LH0 A;  2XDB A;  1QQJ A;  3QII A;  1YIJ T;  1TG0 A;  2K3X A;  2O88 A;  4BE0 A;  1YJ9 A;  3L42 A;  1Y57 A;  2X4W A;  4HCB A;  2E3I A;  4KGZ B;  1IRE B;  3J81 E;  3CPW A;  2OTL A;  2M0O A;  1K9M R;  4EMK A;  1QP3 A;  2AKK A;  3QPH A;  2HDA A;  4JJD A;  3HFN A;  4E2F B;  3M4G A;  2LNV A;  2O01 E;  4E7L A;  4BUG A;  1S72 T;  4B9W A;  3J7A F;  1N6A A;  2YLB A;  4D8K A;  2E10 A;  4CI0 C;  3QWX X;  5KYU B;  3LWI A;  4LD9 K;  3ASK A;  2KI7 A;  5KH6 A;  1VQK Q;  3CCE T;  3M9Q A;  2ED0 A;  1QVP A;  3FC3 A;  1U8R A;  3EG9 B;  1NPR A;  1PC0 A;  2QTV A;  3T9N A;  2W0Z A;  4LE9 A;  3PGG A;  3MPU B;  3OYL A;  3FRN A;  3CCR A;  1T0H A;  3PVQ A;  1K76 A; 
#chains in the Genus database with same CATH homology
 1WX6 A;  3I9Q A;  3H41 A;  2DL7 A;  5L23 A;  1HJD A;  5IXF A;  4J9I A;  2EYW A;  2GBQ A;  4RTZ A;  1HSQ A;  5IXB A;  3EG3 A;  1UJY A;  4AFQ C;  2ESW A;  3NPF A;  2W10 A;  1BU1 A;  1XOV A;  4Z88 A;  1MV0 B;  4OMP A;  3EG0 A;  2RQV A;  4WCI A;  1E6H A;  4CC4 B;  2KXC A;  4LN2 A;  4J9C A;  2O9S A;  1E6G A;  1H8K A;  2JXB A;  1AVZ C;  1PWT A;  2AZS A;  3NGP A;  3H0F A;  4HVW A;  2CSQ A;  2BZY A;  2DL5 A;  2KR3 A;  2DBM A;  2CT3 A;  1A0N B;  1TUC A;  5I11 A;  3H0I A;  2LZ6 B;  2CT4 A;  2K6D A;  2YUQ A;  1JEG A;  1PKT A;  2ED1 A;  2KRN A;  4RUG A;  4OMO A;  1UG1 A;  1M8M A;  2KEA A;  1B07 A;  1OPL A;  3JV3 A;  1TUD A;  2ROT A;  2EYY A;  3REB B;  2HCK A;  1I1J A;  1MUZ A;  3UA7 A;  4ORZ A;  2K79 A;  2DJQ A;  1KSW A;  4R0K A;  1ABO A;  1YCS B;  1K4U S;  2J7I A;  1VA7 A;  1RI9 A;  1RLQ C;  1QWE A;  4HCK A;  1CKA A;  2DRK A;  5FWB A;  2M0Y A;  3R6N A;  1ZX6 A;  4FSS A;  4IIM A;  1B3Q A;  2VVK A;  5IHI A;  1PRL C;  1UFF A;  1PRM C;  4E6R A;  2KE9 A;  1SRM A;  1NLP C;  3FJ5 A;  2LQW A;  2FRW A;  1SHF A;  2ABL A;  4Z8A A;  1UE9 A;  1V1C A;  3I35 A;  2KT1 A;  2BZ8 A;  2DBK A;  3U23 A;  3I5R A;  2DL3 A;  1M27 C;  3VS0 A;  1NYG A;  3EHR A;  3LH5 A;  3EHQ A;  2EYX A;  1U06 A;  2D8J A;  2J06 A;  2D0N A;  1AZG B;  2DE0 X;  2NWM A;  4HXJ A;  1W1F A;  4M4Z A;  1AWX A;  1GCQ A;  1UUE A;  2PTK A;  5ECA A;  2LQN A;  1X2K A;  2DMO A;  1FMK A;  1X69 A;  3M0P A;  2D8H A;  1NLO C;  5IH2 A;  2OAW A;  1VYV A;  4CC7 A;  2D1X A;  4OML A;  4J9G A;  1NEB A;  3EG1 A;  2GQI A;  1YWO A;  3VRZ A;  2JS0 A;  4IIO A;  3GBQ A;  2V1R A;  2RQT A;  2L0A A;  1YN8 A;  2CH4 A;  2FG0 A;  1T0J A;  2CSI A;  1KIK A;  2C0O A;  1VYU A;  3KFV A;  1CSK A;  3NMZ C;  2A37 A;  2FPD A;  2HSP A;  1UHC A;  3VS2 A;  2JTE A;  2X3X D;  1MV3 A;  2O31 A;  2CDT A;  4RTX A;  2YUN A;  2EVR A;  1NYF A;  2JW4 A;  3SHW A;  1YP5 A;  2HBW A;  2XMF A;  1M3B A;  4K11 A;  3SEM A;  4DEY A;  1K0S A;  2RPN A;  1OOT A;  2BZX A;  4J9H A;  1EFN A;  5FW9 A;  2K7A A;  1JU5 C;  1SEM A;  1YNZ A;  1ABQ A;  2X3W D;  4LNP A;  3H0H A;  1OPK A;  2IIM A;  3THK A;  2J6F A;  2LJ0 A;  1AD5 A;  1SHG A;  2JS2 A;  2PNI A;  2LX7 A;  1WIE A;  3VRY A;  3REA B;  1RUW A;  2RQR A;  1W70 A;  3I5S A;  2HEQ A;  2YUO A;  1OEB A;  3IQL A;  2MCN A;  1AWO A;  1SPK A;  3EG2 A;  3TVT A;  2F2V A;  2DM1 A;  1BBZ A;  1IO6 A;  2F2X A;  2DX1 A;  2O2O A;  5GJV B;  2DF6 A;  4J9B A;  2AK5 A;  1Y0M A;  2DIL A;  4LUD A;  2F2W A;  4JZ4 A;  2BTT A;  2KNB B;  1HD3 A;  1K0X A;  2L3Q A;  3PE0 A;  2SRC A;  1M30 A;  2LJ1 A;  3EGU A;  2VKN A;  2GNC A;  1NM7 A;  4J9D A;  1AWW A;  4RTV A;  2ROL A;  5IHN A;  2FPE A;  3M0T A;  1QWF A;  1Z9Q A;  1WYX A;  4JPB W;  4F14 A;  1GCP A;  2KXD A;  2M51 A;  1K9A A;  2EW3 A;  1KFZ A;  4OMM A;  1U3O A;  2I0N A;  1U5S A;  1LCK A;  2A08 A;  2J6O A;  1NEG A;  5FWC A;  2CRE A;  2LNH B;  1M3A A;  2CUD A;  4GLM A;  2L3S A;  2LJ3 A;  5GJW B;  1UJ0 A;  3TSZ A;  3ZL7 C;  2MIO A;  2H8H A;  1FYN A;  4LUE A;  3NHN A;  4X1V A;  2FO0 A;  3A98 A;  2L3P A;  2G6F X;  1BB9 A;  2GTJ A;  1G2B A;  1QKW A;  2AKL A;  2RN8 A;  3UA6 A;  2O9V A;  3TSW A;  1PKS A;  2EGC A;  2V1Q A;  1I07 A;  2EQI A;  1H3H A;  1GL5 A;  1GFC A;  4JJB A;  2CH4 W;  1SRL A;  1QKX A;  4RTY A;  1UDL A;  2JMA A;  2YUP A;  1M3C A;  1WI7 A;  4OMQ A;  2JM8 A;  1X27 A;  4ESR A;  1YWP A;  2VWF A;  1I0C A;  4F17 A;  2FEI A;  4CC3 A;  4D8D A;  2LMJ A;  4RTW A;  1CKB A;  2SEM A;  2JM9 A;  2KGT A;  2E5K A;  1WXT A;  2DVJ A;  5IHK A;  2CUB A;  2GGR A;  2KRS A;  4AFU C;  2DL4 A;  3RNJ A;  1JQQ A;  3QWY A;  3M0S A;  1AOJ A;  1X2Q A;  1UHF A;  2RQW A;  1JXM A;  2RMO A;  2RQU A;  2EPD A;  1KJW A;  1AZE A;  1SSH A;  1X43 A;  3VS4 A;  2RNA A;  3M0R A;  3VS3 A;  4A63 B;  2FPF A;  2NUZ A;  1ZLM A;  1PNJ A;  1JXO A;  4AFS C;  1GRI A;  1WA7 A;  5HCK A;  2K2M A;  1S1N A;  4Y92 A;  2P4R A;  2B86 A;  1WLP B;  2K9G A;  4AG1 C;  3CQT A;  2OJ2 A;  1Z9Z A;  4KRT A;  2LCS A;  3ULR B;  2PZ1 A;  2DRM A;  2KRM A;  2RF0 A;  1AEY A;  3UF4 A;  2KBT A;  1X6G A;  2DNU A;  5EC7 A;  1GBQ A;  4Z89 A;  2AZV A;  2GTO A;  1WXU A;  1RLP C;  4RTU A;  1UEC A;  2A36 A;  2EYZ A;  1K1Z A;  1N5Z A;  1H92 A;  4GBQ A;  2DL8 A;  2K3B A;  4J9E A;  1NG2 A;  4CC2 A;  2C0I A;  2EGE A;  1AWJ A;  1T3L A;  1WFW A;  4JZ3 A;  4OMN A;  4AFZ C;  1ARK A;  4HVV A;  2YSQ A;  4J9F A;  3UAT A;  1PHT A;  1ZUU A;  1ZSG A;  4DEX A;  1X6B A;  2KT8 A;  3PVL A;  1ZUY A;  1JO8 A;  1GBR A;  2J6K A;  2FRY A;  2C0T A;  3M0U A;  3VS7 A;  1UGV A;  2EKH A;  2KRO A;  1WXB A;  1TG0 A;  2DYB A;  3O5Z A;  5I22 A;  4JJC A;  2O88 A;  4EIK A;  1E7O A;  1Y57 A;  3M0Q A;  1GFD A;  2L2P A;  3VS1 A;  2MOX A;  4F16 A;  1QLY A;  1T3S A;  4ZNX A;  2JT4 A;  2DA9 A;  2KYM A;  2ENM A;  2AKK A;  1ZBJ A;  2HDA A;  1QCF A;  4JJD A;  3VS6 A;  2J05 A;  2DLP A;  3VS5 A;  1BK2 A;  1WDX A;  2A28 A;  2YDL A;  4D8K A;  1ZUK A;  1VYT A;  1W6X A;  2EGA A;  3QWX X;  4HVU A;  3RBB B;  3C0C A;  2ED0 A;  2JMC A;  1GCQ C;  4QT7 A;  4RTT A;  2QDL A;  2OI3 A;  2YT6 A;  4AG2 C;  1J3T A;  2W0Z A;  2EBP A;  4LE9 A;  2LP5 A;  1UTI A;  1G83 A;  1OV3 A;  2KYB A;  1T0H A;  3PVQ A;  2ECZ A;  1K76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...