1K73P

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1k73P00
1VQOO 1YI2O 1YITO 1Q82P 1YJ9O 3CCUL 3CCLO 1YHQL 2OTJO 3CCSL 3CXCN 2QA4L 3CCVO 1VQ8L 1QVFK 1W2BN 1YJWL 1JJ2N 1VQ5O 3G4SO 1K8AM 1VQ4O 3CC7L 3CCQO 1VQPO 2QEXL 1K73M 1VQ6O 1VQLO 1VQ9O 3CMAL 1K73P 1YIJO 3CD6O 3CCRL 3I55L 1VQKO 1NJIM 1S72L 1VQML 3G71O 2OTLL 3CCEO 3OW2K 3CC4L 3I56L 1NJIP 3CPWK 1QVFN 1N8RM 2OTJL 1Q7YM 3CCUO 1YHQO 3CCSO 2QA4O 1QVGN 1K8AP 1Q81M 1VQ8O 1YJWO 1Q7YP 3G6EO 1VQ7L 1VQPL 3CCJL 3CC7O 1W2BK 1YJNL 1VQNL 1KQSK 2QEXO 3CMEL 3CCML 3CC2L 1M1KM 3CMAO 1VQOL 1YIJL 1YI2L 1YITL 3OW2N 3CCRO 3I55O 1YJ9L 3CCLL 3CPWN 1S72O 1VQMO 1M90M 3CCVL 2OTLO 1N8RP 1VQ5L 3CC4O 3G4SL 3I56O 1VQ4L 1Q86M 3CCQL 1M90P 3CXCK 1Q81P 1K9MM 1JJ2K 1VQ9L 1VQLL 1VQ6L 1Q86P 3G6EL 1KQSN 1KD1M 1K9MP 3CD6L 1KC8M 1VQ7O 1QVGK 3CCJO 1M1KP 1VQKL 1YJNO 1VQNO 1KD1P 3G71L 3CMEO 3CCMO 1KC8P 3CC2O 3CCEL 1Q82M
chains in the Genus database with same CATH superfamily
1VQOO 5DS4A 3GODA 1YI2O 1YITO 4WJ0A 1Q82P 5DS6A 1YJ9O 3CCUL 3CCLO 1YHQL 2OTJO 3CCSL 3CXCN 2QA4L 3CCVO 1VQ8L 1QVFK 1W2BN 1YJWL 1JJ2N 1VQ5O 3G4SO 4W8KA 4QDLA 1K8AM 1VQ4O 3CC7L 3CCQO 1VQPO 2QEXL 1K73M 1VQ6O 1VQLO 5DLJA 1VQ9O 3CMAL 3NKDA 1K73P 1YIJO 3CD6O 3CCRL 3I55L 1VQKO 1NJIM 1S72L 1VQML 3G71O 2OTLL 3CCEO 3OW2K 3CC4L 3I56L 1NJIP 2YZSA 3CPWK 1QVFN 1N8RM 4P6IC 2OTJL 1Q7YM 3CCUO 1YHQO 3CCSO 2QA4O 1QVGN 1K8AP 1Q81M 1VQ8O 1YJWO 1Q7YP 3G6EO 4XTKA 1VQ7L 1VQPL 3CCJL 3CC7O 1W2BK 1YJNL 1VQNL 1KQSK 2QEXO 3CMEL 3CCML 3CC2L 1M1KM 3CMAO 1VQOL 1YIJL 1YI2L 1YITL 3OW2N 3CCRO 3I55O 1YJ9L 3CCLL 3CPWN 1S72O 1VQMO 1M90M 3CCVL 2OTLO 4N06A 1N8RP 1VQ5L 3CC4O 3G4SL 3I56O 1VQ4L 1Q86M 3CCQL 1M90P 3CXCK 5DS5A 1Q81P 1K9MM 1JJ2K 1VQ9L 1VQLL 5DQZA 1VQ6L 1Q86P 3G6EL 1KQSN 5DQTA 1KD1M 1K9MP 3CD6L 1KC8M 1VQ7O 1QVGK 3CCJO 1M1KP 1VQKL 1YJNO 1VQNO 1KD1P 3G71L 3CMEO 3CCMO 1KC8P 3CC2O 3CCEL 1Q82M 5FCLA
chains in the Genus database with same CATH topology
1VQOO 5DS4A 3GODA 1YI2O 1YITO 4WJ0A 1Q82P 5DS6A 1YJ9O 3CCUL 3CCLO 1YHQL 2OTJO 3CCSL 3CXCN 2QA4L 3CCVO 1VQ8L 1QVFK 1W2BN 1YJWL 1JJ2N 1VQ5O 3G4SO 4W8KA 4QDLA 1K8AM 1VQ4O 3CC7L 3CCQO 1VQPO 2QEXL 1K73M 1VQ6O 1VQLO 5DLJA 1VQ9O 3CMAL 3NKDA 1K73P 1YIJO 3CD6O 3CCRL 3I55L 1VQKO 1NJIM 1S72L 1VQML 3G71O 2OTLL 3CCEO 3OW2K 3CC4L 3I56L 1NJIP 2YZSA 3CPWK 1QVFN 1N8RM 4P6IC 2OTJL 1Q7YM 3CCUO 1YHQO 3CCSO 2QA4O 1QVGN 1K8AP 1Q81M 1VQ8O 1YJWO 1Q7YP 3G6EO 4XTKA 1VQ7L 1VQPL 3CCJL 3CC7O 1W2BK 1YJNL 1VQNL 1KQSK 2QEXO 3CMEL 3CCML 3CC2L 1M1KM 3CMAO 1VQOL 1YIJL 1YI2L 1YITL 3OW2N 3CCRO 3I55O 1YJ9L 3CCLL 3CPWN 1S72O 1VQMO 1M90M 3CCVL 2OTLO 4N06A 1N8RP 1VQ5L 3CC4O 3G4SL 3I56O 1VQ4L 1Q86M 3CCQL 1M90P 3CXCK 5DS5A 1Q81P 1K9MM 1JJ2K 1VQ9L 1VQLL 5DQZA 1VQ6L 1Q86P 3G6EL 1KQSN 5DQTA 1KD1M 1K9MP 3CD6L 1KC8M 1VQ7O 1QVGK 3CCJO 1M1KP 1VQKL 1YJNO 1VQNO 1KD1P 3G71L 3CMEO 3CCMO 1KC8P 3CC2O 3CCEL 1Q82M 5FCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO O;  1YI2 O;  1YIT O;  1Q82 P;  1YJ9 O;  3CCU L;  3CCL O;  1YHQ L;  2OTJ O;  3CCS L;  3CXC N;  2QA4 L;  3CCV O;  1VQ8 L;  1QVF K;  1W2B N;  1YJW L;  1JJ2 N;  1VQ5 O;  3G4S O;  1K8A M;  1VQ4 O;  3CC7 L;  3CCQ O;  1VQP O;  2QEX L;  1K73 M;  1VQ6 O;  1VQL O;  1VQ9 O;  3CMA L;  1K73 P;  1YIJ O;  3CD6 O;  3CCR L;  3I55 L;  1VQK O;  1NJI M;  1S72 L;  1VQM L;  3G71 O;  2OTL L;  3CCE O;  3OW2 K;  3CC4 L;  3I56 L;  1NJI P;  3CPW K;  1QVF N;  1N8R M;  2OTJ L;  1Q7Y M;  3CCU O;  1YHQ O;  3CCS O;  2QA4 O;  1QVG N;  1K8A P;  1Q81 M;  1VQ8 O;  1YJW O;  1Q7Y P;  3G6E O;  1VQ7 L;  1VQP L;  3CCJ L;  3CC7 O;  1W2B K;  1YJN L;  1VQN L;  1KQS K;  2QEX O;  3CME L;  3CCM L;  3CC2 L;  1M1K M;  3CMA O;  1VQO L;  1YIJ L;  1YI2 L;  1YIT L;  3OW2 N;  3CCR O;  3I55 O;  1YJ9 L;  3CCL L;  3CPW N;  1S72 O;  1VQM O;  1M90 M;  3CCV L;  2OTL O;  1N8R P;  1VQ5 L;  3CC4 O;  3G4S L;  3I56 O;  1VQ4 L;  1Q86 M;  3CCQ L;  1M90 P;  3CXC K;  1Q81 P;  1K9M M;  1JJ2 K;  1VQ9 L;  1VQL L;  1VQ6 L;  1Q86 P;  3G6E L;  1KQS N;  1KD1 M;  1K9M P;  3CD6 L;  1KC8 M;  1VQ7 O;  1QVG K;  3CCJ O;  1M1K P;  1VQK L;  1YJN O;  1VQN O;  1KD1 P;  3G71 L;  3CME O;  3CCM O;  1KC8 P;  3CC2 O;  3CCE L;  1Q82 M; 
#chains in the Genus database with same CATH topology
 1VQO O;  5DS4 A;  3GOD A;  1YI2 O;  1YIT O;  4WJ0 A;  1Q82 P;  5DS6 A;  1YJ9 O;  3CCU L;  3CCL O;  1YHQ L;  2OTJ O;  3CCS L;  3CXC N;  2QA4 L;  3CCV O;  1VQ8 L;  1QVF K;  1W2B N;  1YJW L;  1JJ2 N;  1VQ5 O;  3G4S O;  4W8K A;  4QDL A;  1K8A M;  1VQ4 O;  3CC7 L;  3CCQ O;  1VQP O;  2QEX L;  1K73 M;  1VQ6 O;  1VQL O;  5DLJ A;  1VQ9 O;  3CMA L;  3NKD A;  1K73 P;  1YIJ O;  3CD6 O;  3CCR L;  3I55 L;  1VQK O;  1NJI M;  1S72 L;  1VQM L;  3G71 O;  2OTL L;  3CCE O;  3OW2 K;  3CC4 L;  3I56 L;  1NJI P;  2YZS A;  3CPW K;  1QVF N;  1N8R M;  4P6I C;  2OTJ L;  1Q7Y M;  3CCU O;  1YHQ O;  3CCS O;  2QA4 O;  1QVG N;  1K8A P;  1Q81 M;  1VQ8 O;  1YJW O;  1Q7Y P;  3G6E O;  4XTK A;  1VQ7 L;  1VQP L;  3CCJ L;  3CC7 O;  1W2B K;  1YJN L;  1VQN L;  1KQS K;  2QEX O;  3CME L;  3CCM L;  3CC2 L;  1M1K M;  3CMA O;  1VQO L;  1YIJ L;  1YI2 L;  1YIT L;  3OW2 N;  3CCR O;  3I55 O;  1YJ9 L;  3CCL L;  3CPW N;  1S72 O;  1VQM O;  1M90 M;  3CCV L;  2OTL O;  4N06 A;  1N8R P;  1VQ5 L;  3CC4 O;  3G4S L;  3I56 O;  1VQ4 L;  1Q86 M;  3CCQ L;  1M90 P;  3CXC K;  5DS5 A;  1Q81 P;  1K9M M;  1JJ2 K;  1VQ9 L;  1VQL L;  5DQZ A;  1VQ6 L;  1Q86 P;  3G6E L;  1KQS N;  5DQT A;  1KD1 M;  1K9M P;  3CD6 L;  1KC8 M;  1VQ7 O;  1QVG K;  3CCJ O;  1M1K P;  1VQK L;  1YJN O;  1VQN O;  1KD1 P;  3G71 L;  3CME O;  3CCM O;  1KC8 P;  3CC2 O;  3CCE L;  1Q82 M;  5FCL A; 
#chains in the Genus database with same CATH homology
 1VQO O;  5DS4 A;  3GOD A;  1YI2 O;  1YIT O;  4WJ0 A;  1Q82 P;  5DS6 A;  1YJ9 O;  3CCU L;  3CCL O;  1YHQ L;  2OTJ O;  3CCS L;  3CXC N;  2QA4 L;  3CCV O;  1VQ8 L;  1QVF K;  1W2B N;  1YJW L;  1JJ2 N;  1VQ5 O;  3G4S O;  4W8K A;  4QDL A;  1K8A M;  1VQ4 O;  3CC7 L;  3CCQ O;  1VQP O;  2QEX L;  1K73 M;  1VQ6 O;  1VQL O;  5DLJ A;  1VQ9 O;  3CMA L;  3NKD A;  1K73 P;  1YIJ O;  3CD6 O;  3CCR L;  3I55 L;  1VQK O;  1NJI M;  1S72 L;  1VQM L;  3G71 O;  2OTL L;  3CCE O;  3OW2 K;  3CC4 L;  3I56 L;  1NJI P;  2YZS A;  3CPW K;  1QVF N;  1N8R M;  4P6I C;  2OTJ L;  1Q7Y M;  3CCU O;  1YHQ O;  3CCS O;  2QA4 O;  1QVG N;  1K8A P;  1Q81 M;  1VQ8 O;  1YJW O;  1Q7Y P;  3G6E O;  4XTK A;  1VQ7 L;  1VQP L;  3CCJ L;  3CC7 O;  1W2B K;  1YJN L;  1VQN L;  1KQS K;  2QEX O;  3CME L;  3CCM L;  3CC2 L;  1M1K M;  3CMA O;  1VQO L;  1YIJ L;  1YI2 L;  1YIT L;  3OW2 N;  3CCR O;  3I55 O;  1YJ9 L;  3CCL L;  3CPW N;  1S72 O;  1VQM O;  1M90 M;  3CCV L;  2OTL O;  4N06 A;  1N8R P;  1VQ5 L;  3CC4 O;  3G4S L;  3I56 O;  1VQ4 L;  1Q86 M;  3CCQ L;  1M90 P;  3CXC K;  5DS5 A;  1Q81 P;  1K9M M;  1JJ2 K;  1VQ9 L;  1VQL L;  5DQZ A;  1VQ6 L;  1Q86 P;  3G6E L;  1KQS N;  5DQT A;  1KD1 M;  1K9M P;  3CD6 L;  1KC8 M;  1VQ7 O;  1QVG K;  3CCJ O;  1M1K P;  1VQK L;  1YJN O;  1VQN O;  1KD1 P;  3G71 L;  3CME O;  3CCM O;  1KC8 P;  3CC2 O;  3CCE L;  1Q82 M;  5FCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...