1K8AJ

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 29
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1k8aJ00
5GAEN 1Q7YJ 1K73J 4WCEJ 3CMEH 4U67J 1Q81J 4IOAJ 4UY8M 1VQ6H 5JVGJ 3CCLH 3CCRH 3CPWH 2ZJQJ 1YJ9H 3CCSH 4IO9J 1KQSH 5AN9F 2ZJPJ 1YI2H 1W2BH 1VQKH 4WFBJ 1K8AJ 3G71H 1Y69K 3CC4H 1VQ4H 3CCQH 3CCMH 1YITH 2OTLH 1K9MJ 4IOCJ 3PIOJ 5H1SO 1QVGH 3PIPJ 1YHQH 1M90J 3CXCH 1JJ2H 2QA4H 4WFAJ 1YIJH 3DLLJ 1YJWH 3CMAH 1M1KJ 3CCVH 3I55H 1KD1J 3I56H 3CC2H 1VQPH 1VQNH 2ZJRJ 1WKIA 3CD6H 1S72H 1VQ8H 1QVFH 1YJNH 5MLCO 3G6EH 1VQLH 1KC8J 3CC7H 5HL7J 3OW2H 5JVHJ 3CF5J 1VQ5H 3J7ZM 5GAGN 4WFNJ 1VQMH 3CCUH 1VQOH 1Q86J 1VQ7H 1NJIJ 4WF9J 5DM7J 3G4SH 1N8RJ 2OTJH 3CCJH 5GADN 3CCEH 5GAHN 1Q82J 5DM6J 2QEXH 1VQ9H 2PA2A
chains in the Genus database with same CATH superfamily
3TQVA 5GAEN 1Q7YJ 1K73J 3FC4A 2B7NA 3WO1A 4WCEJ 3WO0A 3CMEH 1QPNA 4U67J 5AYYA 1Q81J 4IOAJ 3EUB4 4US9A 1FM0E 4YEKA 5EY3A 2I1OA 1NVIE 3NVWC 4UY8M 1VQ6H 1YTKA 5JVGJ 4KWVA 3CCLH 4YYYA 2DSJA 2W55B 3VMMA 3NVZC 4C80A 4GA5A 2WP4A 2ZJQJ 3CCRH 3CPWH 1N61B 1YJ9H 4LHMA 5EP8A 3H5QA 4EADA 3CCSH 2B7QA 1QPOA 3WNZA 4IO9J 1KQSH 3SR6C 5AN9F 1BRWA 2ZJPJ 1YI2H 1W2BH 1VQKH 4WFBJ 1K8AJ 3G71H 4GA4A 1Y69K 3CC4H 1VQ4H 1QAPA 4EAFA 3CCMH 1N63B 3CCQH 1YITH 4IOCJ 1YTEA 1K9MJ 1FIQC 5MPOC 5H1SO 3L0GA 3PIOJ 2QIEA 1FFVB 3PIPJ 1YHQH 1QVGH 1N62B 1M90J 3CXCH 5AYXA 3NRZC 1O4UA 2I14A 1JJ2H 2QA4H 3B9JC 4C7ZA 4KWWA 4WFAJ 1UOUA 1YIJH 3NS1C 3DLLJ 5HUOA 1YJWH 3CMAH 1M1KJ 3NVVC 5HULA 3CCVH 3I55H 3L4PA 1KD1J 1JROB 3C2EA 3I56H 3ETRC 4C7YA 3CC2H 1VQPH 1VQNH 2ZJRJ 3NVYC 1SIJA 1X1OA 1WKIA 1QPRA 3AN1A 3CD6H 1FO4A 3AMZA 4X46A 4GA6A 1S72H 1VQ8H 1QVFH 4AP8A 1YJNH 1N5WB 1VDVA 2E3TA 4XR5A 5MLCO 3G6EH 3FAHA 1RM6A 5HUPA 1DGJA 1VQLH 2W54B 1KC8J 1AZYA 1V97A 3GNNA 3CC7H 3PAJA 4ZOHA 5HL7J 1YTDA 3C2FA 3OW2H 4USAA 2W3SB 3C2OA 2TPTA 1ZXIB 1VLBA 3CF5J 5JVHJ 1VQ5H 3J7ZM 5GAGN 2JBMA 1SB3A 2WK6A 2OTLH 4WFNJ 1FFUB 1OTPA 5AYZA 2Q5WE 3CCUH 1VQOH 1VQMH 2WK5A 1Q86J 1VQ7H 4I9AA 1N5XA 3RPFA 1NJIJ 4WF9J 5DM7J 1FMAE 1QPQA 4US8A 3C2VA 3G4SH 1N8RJ 2OTJH 3CCJH 5GADN 1JRPB 3C2RA 3CCEH 5GAHN 1Q82J 2J0FA 5DM6J 2QEXH 1N60B 1VQ9H 2B7PA 1WYGA 2PA2A 3AM9A 2OMDA 1NVJA 2W3RB 3BIIE
chains in the Genus database with same CATH topology
5GAEN 1Q7YJ 1K73J 4WCEJ 3CMEH 4U67J 1Q81J 4IOAJ 4UY8M 1VQ6H 5JVGJ 3CCLH 3CCRH 3CPWH 2ZJQJ 1YJ9H 3CCSH 4IO9J 1KQSH 5AN9F 2ZJPJ 1YI2H 1W2BH 1VQKH 4WFBJ 1K8AJ 3G71H 1Y69K 3CC4H 1VQ4H 3CCQH 3CCMH 1YITH 2OTLH 1K9MJ 4IOCJ 3PIOJ 5H1SO 1QVGH 3PIPJ 1YHQH 1M90J 3CXCH 1JJ2H 2QA4H 4WFAJ 1YIJH 3DLLJ 1YJWH 3CMAH 1M1KJ 3CCVH 3I55H 1KD1J 3I56H 3CC2H 1VQPH 1VQNH 2ZJRJ 1WKIA 3CD6H 1S72H 1VQ8H 1QVFH 1YJNH 5MLCO 3G6EH 1VQLH 1KC8J 3CC7H 5HL7J 3OW2H 5JVHJ 3CF5J 1VQ5H 3J7ZM 5GAGN 4WFNJ 1VQMH 3CCUH 1VQOH 1Q86J 1VQ7H 1NJIJ 4WF9J 5DM7J 3G4SH 1N8RJ 2OTJH 3CCJH 5GADN 3CCEH 5GAHN 1Q82J 5DM6J 2QEXH 1VQ9H 2PA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE N;  1Q7Y J;  1K73 J;  4WCE J;  3CME H;  4U67 J;  1Q81 J;  4IOA J;  4UY8 M;  1VQ6 H;  5JVG J;  3CCL H;  3CCR H;  3CPW H;  2ZJQ J;  1YJ9 H;  3CCS H;  4IO9 J;  1KQS H;  5AN9 F;  2ZJP J;  1YI2 H;  1W2B H;  1VQK H;  4WFB J;  1K8A J;  3G71 H;  1Y69 K;  3CC4 H;  1VQ4 H;  3CCQ H;  3CCM H;  1YIT H;  2OTL H;  1K9M J;  4IOC J;  3PIO J;  5H1S O;  1QVG H;  3PIP J;  1YHQ H;  1M90 J;  3CXC H;  1JJ2 H;  2QA4 H;  4WFA J;  1YIJ H;  3DLL J;  1YJW H;  3CMA H;  1M1K J;  3CCV H;  3I55 H;  1KD1 J;  3I56 H;  3CC2 H;  1VQP H;  1VQN H;  2ZJR J;  1WKI A;  3CD6 H;  1S72 H;  1VQ8 H;  1QVF H;  1YJN H;  5MLC O;  3G6E H;  1VQL H;  1KC8 J;  3CC7 H;  5HL7 J;  3OW2 H;  5JVH J;  3CF5 J;  1VQ5 H;  3J7Z M;  5GAG N;  4WFN J;  1VQM H;  3CCU H;  1VQO H;  1Q86 J;  1VQ7 H;  1NJI J;  4WF9 J;  5DM7 J;  3G4S H;  1N8R J;  2OTJ H;  3CCJ H;  5GAD N;  3CCE H;  5GAH N;  1Q82 J;  5DM6 J;  2QEX H;  1VQ9 H;  2PA2 A; 
#chains in the Genus database with same CATH topology
 3TQV A;  5GAE N;  1Q7Y J;  1K73 J;  3FC4 A;  2B7N A;  3WO1 A;  4WCE J;  3WO0 A;  3CME H;  1QPN A;  4U67 J;  5AYY A;  1Q81 J;  4IOA J;  3EUB 4;  4US9 A;  1FM0 E;  4YEK A;  5EY3 A;  2I1O A;  1NVI E;  3NVW C;  4UY8 M;  1VQ6 H;  1YTK A;  5JVG J;  4KWV A;  3CCL H;  4YYY A;  2DSJ A;  2W55 B;  3VMM A;  3NVZ C;  4C80 A;  4GA5 A;  2WP4 A;  2ZJQ J;  3CCR H;  3CPW H;  1N61 B;  1YJ9 H;  4LHM A;  5EP8 A;  3H5Q A;  4EAD A;  3CCS H;  2B7Q A;  1QPO A;  3WNZ A;  4IO9 J;  1KQS H;  3SR6 C;  5AN9 F;  1BRW A;  2ZJP J;  1YI2 H;  1W2B H;  1VQK H;  4WFB J;  1K8A J;  3G71 H;  4GA4 A;  1Y69 K;  3CC4 H;  1VQ4 H;  1QAP A;  4EAF A;  3CCM H;  1N63 B;  3CCQ H;  1YIT H;  4IOC J;  1YTE A;  1K9M J;  1FIQ C;  5MPO C;  5H1S O;  3L0G A;  3PIO J;  2QIE A;  1FFV B;  3PIP J;  1YHQ H;  1QVG H;  1N62 B;  1M90 J;  3CXC H;  5AYX A;  3NRZ C;  1O4U A;  2I14 A;  1JJ2 H;  2QA4 H;  3B9J C;  4C7Z A;  4KWW A;  4WFA J;  1UOU A;  1YIJ H;  3NS1 C;  3DLL J;  5HUO A;  1YJW H;  3CMA H;  1M1K J;  3NVV C;  5HUL A;  3CCV H;  3I55 H;  3L4P A;  1KD1 J;  1JRO B;  3C2E A;  3I56 H;  3ETR C;  4C7Y A;  3CC2 H;  1VQP H;  1VQN H;  2ZJR J;  3NVY C;  1SIJ A;  1X1O A;  1WKI A;  1QPR A;  3AN1 A;  3CD6 H;  1FO4 A;  3AMZ A;  4X46 A;  4GA6 A;  1S72 H;  1VQ8 H;  1QVF H;  4AP8 A;  1YJN H;  1N5W B;  1VDV A;  2E3T A;  4XR5 A;  5MLC O;  3G6E H;  3FAH A;  1RM6 A;  5HUP A;  1DGJ A;  1VQL H;  2W54 B;  1KC8 J;  1AZY A;  1V97 A;  3GNN A;  3CC7 H;  3PAJ A;  4ZOH A;  5HL7 J;  1YTD A;  3C2F A;  3OW2 H;  4USA A;  2W3S B;  3C2O A;  2TPT A;  1ZXI B;  1VLB A;  3CF5 J;  5JVH J;  1VQ5 H;  3J7Z M;  5GAG N;  2JBM A;  1SB3 A;  2WK6 A;  2OTL H;  4WFN J;  1FFU B;  1OTP A;  5AYZ A;  2Q5W E;  3CCU H;  1VQO H;  1VQM H;  2WK5 A;  1Q86 J;  1VQ7 H;  4I9A A;  1N5X A;  3RPF A;  1NJI J;  4WF9 J;  5DM7 J;  1FMA E;  1QPQ A;  4US8 A;  3C2V A;  3G4S H;  1N8R J;  2OTJ H;  3CCJ H;  5GAD N;  1JRP B;  3C2R A;  3CCE H;  5GAH N;  1Q82 J;  2J0F A;  5DM6 J;  2QEX H;  1N60 B;  1VQ9 H;  2B7P A;  1WYG A;  2PA2 A;  3AM9 A;  2OMD A;  1NVJ A;  2W3R B;  3BII E; 
#chains in the Genus database with same CATH homology
 5GAE N;  1Q7Y J;  1K73 J;  4WCE J;  3CME H;  4U67 J;  1Q81 J;  4IOA J;  4UY8 M;  1VQ6 H;  5JVG J;  3CCL H;  3CCR H;  3CPW H;  2ZJQ J;  1YJ9 H;  3CCS H;  4IO9 J;  1KQS H;  5AN9 F;  2ZJP J;  1YI2 H;  1W2B H;  1VQK H;  4WFB J;  1K8A J;  3G71 H;  1Y69 K;  3CC4 H;  1VQ4 H;  3CCQ H;  3CCM H;  1YIT H;  2OTL H;  1K9M J;  4IOC J;  3PIO J;  5H1S O;  1QVG H;  3PIP J;  1YHQ H;  1M90 J;  3CXC H;  1JJ2 H;  2QA4 H;  4WFA J;  1YIJ H;  3DLL J;  1YJW H;  3CMA H;  1M1K J;  3CCV H;  3I55 H;  1KD1 J;  3I56 H;  3CC2 H;  1VQP H;  1VQN H;  2ZJR J;  1WKI A;  3CD6 H;  1S72 H;  1VQ8 H;  1QVF H;  1YJN H;  5MLC O;  3G6E H;  1VQL H;  1KC8 J;  3CC7 H;  5HL7 J;  3OW2 H;  5JVH J;  3CF5 J;  1VQ5 H;  3J7Z M;  5GAG N;  4WFN J;  1VQM H;  3CCU H;  1VQO H;  1Q86 J;  1VQ7 H;  1NJI J;  4WF9 J;  5DM7 J;  3G4S H;  1N8R J;  2OTJ H;  3CCJ H;  5GAD N;  3CCE H;  5GAH N;  1Q82 J;  5DM6 J;  2QEX H;  1VQ9 H;  2PA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...