1K8AM

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 31
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1k8aM02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1k8aM01
1Q86P 1YJ9L 1M1KM 1VQ8O 1VQ4L 1YIJO 1YJWL 3CD6L 3OW2K 1Q86M 1KC8M 3G71O 1K8AM 1W2BN 3OW2N 1VQLO 1YJNL 1M90P 3G6EL 3CXCN 3CCMO 1QVGN 1VQ7O 3I55L 1Q7YM 1QVFN 3CCRO 1YITO 1VQ8L 1YHQL 3CC4L 2OTLO 3CCQO 3I56O 3G4SO 3CCJO 3CMAO 2OTJO 1NJIP 1Q81P 3CCSO 1VQOO 1VQNO 2QEXL 1W2BK 1VQ5O 1VQ6O 1NJIM 3CCML 3CXCK 1QVGK 2QA4L 1S72L 1YI2O 1VQKL 1QVFK 3CPWK 3CCUL 1VQPL 3G4SL 3CC7O 1M90M 3CPWN 3CCEO 3CMEO 3CC2O 1VQMO 1YIJL 1VQNL 1VQ9O 1YJ9O 3G71L 1VQ4O 1YJWO 1K9MP 3CCVO 1VQLL 1Q82P 1Q81M 1VQ7L 3CCLO 1K9MM 3CC7L 1M1KP 3CCRL 3CCEL 1YITL 3CC2L 3I55O 1K73P 1VQML 2OTLL 3CCQL 3I56L 3CCJL 3CMAL 2OTJL 1N8RP 1JJ2N 1KC8P 1YHQO 3CC4O 1K73M 3CCSL 1VQOL 1K8AP 1VQ5L 1N8RM 3CCVL 1VQ6L 2QEXO 3CCLL 1YI2L 3CD6O 1Q7YP 1KQSK 2QA4O 1S72O 1VQKO 1KQSN 1YJNO 1KD1P 1Q82M 3G6EO 3CMEL 3CCUO 1JJ2K 1VQPO 1VQ9L 1KD1M
chains in the Genus database with same CATH superfamily
1Q86P 1YJ9L 1M1KM 1VQ8O 5DS4A 1VQ4L 1YIJO 1YJWL 3NKDA 5DS5A 3CD6L 3OW2K 1Q86M 1KC8M 3G71O 1K8AM 1W2BN 3OW2N 5DQTA 1VQLO 1YJNL 1M90P 3G6EL 3CXCN 3CCMO 1QVGN 1VQ7O 3I55L 1Q7YM 1QVFN 3CCRO 1YITO 1VQ8L 1YHQL 3CC4L 2OTLO 3CCQO 2YZSA 3I56O 3G4SO 3CCJO 3CMAO 2OTJO 1NJIP 1Q81P 3CCSO 1VQOO 1VQNO 2QEXL 5DS6A 1W2BK 1VQ5O 1VQ6O 1NJIM 4QDLA 3CCML 3CXCK 1QVGK 2QA4L 1S72L 5DLJA 1YI2O 1VQKL 1QVFK 3CPWK 3CCUL 1VQPL 3G4SL 3CC7O 1M90M 3CPWN 3CCEO 3CMEO 3CC2O 1VQMO 1YIJL 1VQNL 1VQ9O 1YJ9O 3G71L 1VQ4O 1YJWO 1K9MP 3CCVO 1VQLL 1Q82P 1Q81M 1VQ7L 3CCLO 1K9MM 3CC7L 1M1KP 3CCRL 4P6IC 3CCEL 1YITL 5FCLA 3CC2L 3I55O 1K73P 4N06A 1VQML 2OTLL 3CCQL 3I56L 3CCJL 4XTKA 3CMAL 2OTJL 1N8RP 4W8KA 1JJ2N 1KC8P 1YHQO 3CC4O 1K73M 3CCSL 1VQOL 1K8AP 1VQ5L 1N8RM 3CCVL 1VQ6L 2QEXO 3CCLL 1YI2L 3CD6O 1Q7YP 1KQSK 5DQZA 4WJ0A 2QA4O 1S72O 1VQKO 1KQSN 1YJNO 1KD1P 1Q82M 3G6EO 3CMEL 3CCUO 1JJ2K 3GODA 1VQPO 1VQ9L 1KD1M
chains in the Genus database with same CATH topology
1Q86P 1YJ9L 1M1KM 1VQ8O 5DS4A 1VQ4L 1YIJO 1YJWL 3NKDA 5DS5A 3CD6L 3OW2K 1Q86M 1KC8M 3G71O 1K8AM 1W2BN 3OW2N 5DQTA 1VQLO 1YJNL 1M90P 3G6EL 3CXCN 3CCMO 1QVGN 1VQ7O 3I55L 1Q7YM 1QVFN 3CCRO 1YITO 1VQ8L 1YHQL 3CC4L 2OTLO 3CCQO 2YZSA 3I56O 3G4SO 3CCJO 3CMAO 2OTJO 1NJIP 1Q81P 3CCSO 1VQOO 1VQNO 2QEXL 5DS6A 1W2BK 1VQ5O 1VQ6O 1NJIM 4QDLA 3CCML 3CXCK 1QVGK 2QA4L 1S72L 5DLJA 1YI2O 1VQKL 1QVFK 3CPWK 3CCUL 1VQPL 3G4SL 3CC7O 1M90M 3CPWN 3CCEO 3CMEO 3CC2O 1VQMO 1YIJL 1VQNL 1VQ9O 1YJ9O 3G71L 1VQ4O 1YJWO 1K9MP 3CCVO 1VQLL 1Q82P 1Q81M 1VQ7L 3CCLO 1K9MM 3CC7L 1M1KP 3CCRL 4P6IC 3CCEL 1YITL 5FCLA 3CC2L 3I55O 1K73P 4N06A 1VQML 2OTLL 3CCQL 3I56L 3CCJL 4XTKA 3CMAL 2OTJL 1N8RP 4W8KA 1JJ2N 1KC8P 1YHQO 3CC4O 1K73M 3CCSL 1VQOL 1K8AP 1VQ5L 1N8RM 3CCVL 1VQ6L 2QEXO 3CCLL 1YI2L 3CD6O 1Q7YP 1KQSK 5DQZA 4WJ0A 2QA4O 1S72O 1VQKO 1KQSN 1YJNO 1KD1P 1Q82M 3G6EO 3CMEL 3CCUO 1JJ2K 3GODA 1VQPO 1VQ9L 1KD1M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 P;  1YJ9 L;  1M1K M;  1VQ8 O;  1VQ4 L;  1YIJ O;  1YJW L;  3CD6 L;  3OW2 K;  1Q86 M;  1KC8 M;  3G71 O;  1K8A M;  1W2B N;  3OW2 N;  1VQL O;  1YJN L;  1M90 P;  3G6E L;  3CXC N;  3CCM O;  1QVG N;  1VQ7 O;  3I55 L;  1Q7Y M;  1QVF N;  3CCR O;  1YIT O;  1VQ8 L;  1YHQ L;  3CC4 L;  2OTL O;  3CCQ O;  3I56 O;  3G4S O;  3CCJ O;  3CMA O;  2OTJ O;  1NJI P;  1Q81 P;  3CCS O;  1VQO O;  1VQN O;  2QEX L;  1W2B K;  1VQ5 O;  1VQ6 O;  1NJI M;  3CCM L;  3CXC K;  1QVG K;  2QA4 L;  1S72 L;  1YI2 O;  1VQK L;  1QVF K;  3CPW K;  3CCU L;  1VQP L;  3G4S L;  3CC7 O;  1M90 M;  3CPW N;  3CCE O;  3CME O;  3CC2 O;  1VQM O;  1YIJ L;  1VQN L;  1VQ9 O;  1YJ9 O;  3G71 L;  1VQ4 O;  1YJW O;  1K9M P;  3CCV O;  1VQL L;  1Q82 P;  1Q81 M;  1VQ7 L;  3CCL O;  1K9M M;  3CC7 L;  1M1K P;  3CCR L;  3CCE L;  1YIT L;  3CC2 L;  3I55 O;  1K73 P;  1VQM L;  2OTL L;  3CCQ L;  3I56 L;  3CCJ L;  3CMA L;  2OTJ L;  1N8R P;  1JJ2 N;  1KC8 P;  1YHQ O;  3CC4 O;  1K73 M;  3CCS L;  1VQO L;  1K8A P;  1VQ5 L;  1N8R M;  3CCV L;  1VQ6 L;  2QEX O;  3CCL L;  1YI2 L;  3CD6 O;  1Q7Y P;  1KQS K;  2QA4 O;  1S72 O;  1VQK O;  1KQS N;  1YJN O;  1KD1 P;  1Q82 M;  3G6E O;  3CME L;  3CCU O;  1JJ2 K;  1VQP O;  1VQ9 L;  1KD1 M; 
#chains in the Genus database with same CATH topology
 1Q86 P;  1YJ9 L;  1M1K M;  1VQ8 O;  5DS4 A;  1VQ4 L;  1YIJ O;  1YJW L;  3NKD A;  5DS5 A;  3CD6 L;  3OW2 K;  1Q86 M;  1KC8 M;  3G71 O;  1K8A M;  1W2B N;  3OW2 N;  5DQT A;  1VQL O;  1YJN L;  1M90 P;  3G6E L;  3CXC N;  3CCM O;  1QVG N;  1VQ7 O;  3I55 L;  1Q7Y M;  1QVF N;  3CCR O;  1YIT O;  1VQ8 L;  1YHQ L;  3CC4 L;  2OTL O;  3CCQ O;  2YZS A;  3I56 O;  3G4S O;  3CCJ O;  3CMA O;  2OTJ O;  1NJI P;  1Q81 P;  3CCS O;  1VQO O;  1VQN O;  2QEX L;  5DS6 A;  1W2B K;  1VQ5 O;  1VQ6 O;  1NJI M;  4QDL A;  3CCM L;  3CXC K;  1QVG K;  2QA4 L;  1S72 L;  5DLJ A;  1YI2 O;  1VQK L;  1QVF K;  3CPW K;  3CCU L;  1VQP L;  3G4S L;  3CC7 O;  1M90 M;  3CPW N;  3CCE O;  3CME O;  3CC2 O;  1VQM O;  1YIJ L;  1VQN L;  1VQ9 O;  1YJ9 O;  3G71 L;  1VQ4 O;  1YJW O;  1K9M P;  3CCV O;  1VQL L;  1Q82 P;  1Q81 M;  1VQ7 L;  3CCL O;  1K9M M;  3CC7 L;  1M1K P;  3CCR L;  4P6I C;  3CCE L;  1YIT L;  5FCL A;  3CC2 L;  3I55 O;  1K73 P;  4N06 A;  1VQM L;  2OTL L;  3CCQ L;  3I56 L;  3CCJ L;  4XTK A;  3CMA L;  2OTJ L;  1N8R P;  4W8K A;  1JJ2 N;  1KC8 P;  1YHQ O;  3CC4 O;  1K73 M;  3CCS L;  1VQO L;  1K8A P;  1VQ5 L;  1N8R M;  3CCV L;  1VQ6 L;  2QEX O;  3CCL L;  1YI2 L;  3CD6 O;  1Q7Y P;  1KQS K;  5DQZ A;  4WJ0 A;  2QA4 O;  1S72 O;  1VQK O;  1KQS N;  1YJN O;  1KD1 P;  1Q82 M;  3G6E O;  3CME L;  3CCU O;  1JJ2 K;  3GOD A;  1VQP O;  1VQ9 L;  1KD1 M; 
#chains in the Genus database with same CATH homology
 1Q86 P;  1YJ9 L;  1M1K M;  1VQ8 O;  5DS4 A;  1VQ4 L;  1YIJ O;  1YJW L;  3NKD A;  5DS5 A;  3CD6 L;  3OW2 K;  1Q86 M;  1KC8 M;  3G71 O;  1K8A M;  1W2B N;  3OW2 N;  5DQT A;  1VQL O;  1YJN L;  1M90 P;  3G6E L;  3CXC N;  3CCM O;  1QVG N;  1VQ7 O;  3I55 L;  1Q7Y M;  1QVF N;  3CCR O;  1YIT O;  1VQ8 L;  1YHQ L;  3CC4 L;  2OTL O;  3CCQ O;  2YZS A;  3I56 O;  3G4S O;  3CCJ O;  3CMA O;  2OTJ O;  1NJI P;  1Q81 P;  3CCS O;  1VQO O;  1VQN O;  2QEX L;  5DS6 A;  1W2B K;  1VQ5 O;  1VQ6 O;  1NJI M;  4QDL A;  3CCM L;  3CXC K;  1QVG K;  2QA4 L;  1S72 L;  5DLJ A;  1YI2 O;  1VQK L;  1QVF K;  3CPW K;  3CCU L;  1VQP L;  3G4S L;  3CC7 O;  1M90 M;  3CPW N;  3CCE O;  3CME O;  3CC2 O;  1VQM O;  1YIJ L;  1VQN L;  1VQ9 O;  1YJ9 O;  3G71 L;  1VQ4 O;  1YJW O;  1K9M P;  3CCV O;  1VQL L;  1Q82 P;  1Q81 M;  1VQ7 L;  3CCL O;  1K9M M;  3CC7 L;  1M1K P;  3CCR L;  4P6I C;  3CCE L;  1YIT L;  5FCL A;  3CC2 L;  3I55 O;  1K73 P;  4N06 A;  1VQM L;  2OTL L;  3CCQ L;  3I56 L;  3CCJ L;  4XTK A;  3CMA L;  2OTJ L;  1N8R P;  4W8K A;  1JJ2 N;  1KC8 P;  1YHQ O;  3CC4 O;  1K73 M;  3CCS L;  1VQO L;  1K8A P;  1VQ5 L;  1N8R M;  3CCV L;  1VQ6 L;  2QEX O;  3CCL L;  1YI2 L;  3CD6 O;  1Q7Y P;  1KQS K;  5DQZ A;  4WJ0 A;  2QA4 O;  1S72 O;  1VQK O;  1KQS N;  1YJN O;  1KD1 P;  1Q82 M;  3G6E O;  3CME L;  3CCU O;  1JJ2 K;  3GOD A;  1VQP O;  1VQ9 L;  1KD1 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...