1K9MP

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 37
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1k9mP00
1VQ7O 3CC7L 1VQKL 3CMEO 1YI2L 1VQ6L 1K8AP 3CCRO 3CPWK 1QVGN 1M90P 1KD1M 3CMAL 1VQ5O 3CC4L 3CPWN 3CCUO 3CCEO 1YHQO 2QA4L 1Q7YM 1VQNL 2OTLO 3I56L 3CD6L 1VQOO 1W2BN 1VQPL 1VQ9O 1S72O 1QVGK 3G4SL 1Q7YP 1KC8M 1YITO 1YJNL 3I55L 1VQLL 3CCQL 3CXCK 1YIJL 1VQML 3CCMO 1YJWL 1KC8P 3CCVO 3CXCN 1YJ9L 2OTJO 3CCJL 1VQ8O 1W2BK 3CC2O 1VQ7L 1Q81M 1KD1P 3CCLO 1JJ2K 3CMEL 3G6EO 1VQ4O 1Q86M 3CCRL 3G71O 1Q81P 1JJ2N 3CC7O 3CCSL 2QEXL 1VQ5L 1VQKO 1KQSK 1YI2O 1Q86P 3CCEL 1YHQL 1VQ6O 1VQLO 1QVFK 3CMAO 1KQSN 2OTLL 3CC4O 1M1KM 1QVFN 1K8AM 1VQ9L 1S72L 1M90M 2QA4O 1YITL 1VQNO 3I56O 1M1KP 3CD6O 3OW2K 1VQPO 1N8RM 3G4SO 1K73M 3CCML 3CCSO 2QEXO 3CCUL 3CCVL 3OW2N 1YJNO 1Q82M 1NJIM 2OTJL 3I55O 1K9MM 1VQ8L 3CC2L 3CCQO 3CCLL 1YIJO 1N8RP 1K73P 3G6EL 1VQMO 1VQ4L 1YJWO 1VQOL 1NJIP 1Q82P 1K9MP 1YJ9O 3G71L 3CCJO
chains in the Genus database with same CATH superfamily
1VQ7O 4N06A 3CC7L 3NKDA 1VQKL 3CMEO 1YI2L 1VQ6L 1K8AP 3CCRO 3CPWK 1QVGN 1M90P 1KD1M 3CMAL 1VQ5O 3CC4L 3CPWN 3CCUO 5DLJA 3CCEO 1YHQO 5DQZA 2QA4L 1Q7YM 1VQNL 2OTLO 3I56L 3CD6L 1VQOO 5DS5A 1W2BN 1VQPL 1VQ9O 1S72O 1QVGK 3G4SL 3GODA 1Q7YP 1KC8M 1YITO 1YJNL 3I55L 1VQLL 3CCQL 3CXCK 1YIJL 4P6IC 1VQML 3CCMO 1YJWL 1KC8P 2YZSA 3CCVO 3CXCN 1YJ9L 2OTJO 3CCJL 1VQ8O 4WJ0A 1W2BK 3CC2O 1VQ7L 1Q81M 1KD1P 3CCLO 1JJ2K 3CMEL 3G6EO 1VQ4O 1Q86M 3CCRL 3G71O 1Q81P 1JJ2N 5DS6A 3CC7O 3CCSL 2QEXL 1VQ5L 1VQKO 5DS4A 1KQSK 5DQTA 1YI2O 1Q86P 3CCEL 1YHQL 1VQ6O 1VQLO 1QVFK 3CMAO 4QDLA 1KQSN 2OTLL 4XTKA 3CC4O 1M1KM 1QVFN 1K8AM 4W8KA 1VQ9L 1S72L 1M90M 2QA4O 1YITL 1VQNO 5FCLA 3I56O 1M1KP 3CD6O 3OW2K 1VQPO 1N8RM 3G4SO 1K73M 3CCML 3CCSO 2QEXO 3CCUL 3CCVL 3OW2N 1YJNO 1Q82M 1NJIM 2OTJL 3I55O 1K9MM 1VQ8L 3CC2L 3CCQO 3CCLL 1YIJO 1N8RP 1K73P 3G6EL 1VQMO 1VQ4L 1YJWO 1VQOL 1NJIP 1Q82P 1K9MP 1YJ9O 3G71L 3CCJO
chains in the Genus database with same CATH topology
1VQ7O 4N06A 3CC7L 3NKDA 1VQKL 3CMEO 1YI2L 1VQ6L 1K8AP 3CCRO 3CPWK 1QVGN 1M90P 1KD1M 3CMAL 1VQ5O 3CC4L 3CPWN 3CCUO 5DLJA 3CCEO 1YHQO 5DQZA 2QA4L 1Q7YM 1VQNL 2OTLO 3I56L 3CD6L 1VQOO 5DS5A 1W2BN 1VQPL 1VQ9O 1S72O 1QVGK 3G4SL 3GODA 1Q7YP 1KC8M 1YITO 1YJNL 3I55L 1VQLL 3CCQL 3CXCK 1YIJL 4P6IC 1VQML 3CCMO 1YJWL 1KC8P 2YZSA 3CCVO 3CXCN 1YJ9L 2OTJO 3CCJL 1VQ8O 4WJ0A 1W2BK 3CC2O 1VQ7L 1Q81M 1KD1P 3CCLO 1JJ2K 3CMEL 3G6EO 1VQ4O 1Q86M 3CCRL 3G71O 1Q81P 1JJ2N 5DS6A 3CC7O 3CCSL 2QEXL 1VQ5L 1VQKO 5DS4A 1KQSK 5DQTA 1YI2O 1Q86P 3CCEL 1YHQL 1VQ6O 1VQLO 1QVFK 3CMAO 4QDLA 1KQSN 2OTLL 4XTKA 3CC4O 1M1KM 1QVFN 1K8AM 4W8KA 1VQ9L 1S72L 1M90M 2QA4O 1YITL 1VQNO 5FCLA 3I56O 1M1KP 3CD6O 3OW2K 1VQPO 1N8RM 3G4SO 1K73M 3CCML 3CCSO 2QEXO 3CCUL 3CCVL 3OW2N 1YJNO 1Q82M 1NJIM 2OTJL 3I55O 1K9MM 1VQ8L 3CC2L 3CCQO 3CCLL 1YIJO 1N8RP 1K73P 3G6EL 1VQMO 1VQ4L 1YJWO 1VQOL 1NJIP 1Q82P 1K9MP 1YJ9O 3G71L 3CCJO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 O;  3CC7 L;  1VQK L;  3CME O;  1YI2 L;  1VQ6 L;  1K8A P;  3CCR O;  3CPW K;  1QVG N;  1M90 P;  1KD1 M;  3CMA L;  1VQ5 O;  3CC4 L;  3CPW N;  3CCU O;  3CCE O;  1YHQ O;  2QA4 L;  1Q7Y M;  1VQN L;  2OTL O;  3I56 L;  3CD6 L;  1VQO O;  1W2B N;  1VQP L;  1VQ9 O;  1S72 O;  1QVG K;  3G4S L;  1Q7Y P;  1KC8 M;  1YIT O;  1YJN L;  3I55 L;  1VQL L;  3CCQ L;  3CXC K;  1YIJ L;  1VQM L;  3CCM O;  1YJW L;  1KC8 P;  3CCV O;  3CXC N;  1YJ9 L;  2OTJ O;  3CCJ L;  1VQ8 O;  1W2B K;  3CC2 O;  1VQ7 L;  1Q81 M;  1KD1 P;  3CCL O;  1JJ2 K;  3CME L;  3G6E O;  1VQ4 O;  1Q86 M;  3CCR L;  3G71 O;  1Q81 P;  1JJ2 N;  3CC7 O;  3CCS L;  2QEX L;  1VQ5 L;  1VQK O;  1KQS K;  1YI2 O;  1Q86 P;  3CCE L;  1YHQ L;  1VQ6 O;  1VQL O;  1QVF K;  3CMA O;  1KQS N;  2OTL L;  3CC4 O;  1M1K M;  1QVF N;  1K8A M;  1VQ9 L;  1S72 L;  1M90 M;  2QA4 O;  1YIT L;  1VQN O;  3I56 O;  1M1K P;  3CD6 O;  3OW2 K;  1VQP O;  1N8R M;  3G4S O;  1K73 M;  3CCM L;  3CCS O;  2QEX O;  3CCU L;  3CCV L;  3OW2 N;  1YJN O;  1Q82 M;  1NJI M;  2OTJ L;  3I55 O;  1K9M M;  1VQ8 L;  3CC2 L;  3CCQ O;  3CCL L;  1YIJ O;  1N8R P;  1K73 P;  3G6E L;  1VQM O;  1VQ4 L;  1YJW O;  1VQO L;  1NJI P;  1Q82 P;  1K9M P;  1YJ9 O;  3G71 L;  3CCJ O; 
#chains in the Genus database with same CATH topology
 1VQ7 O;  4N06 A;  3CC7 L;  3NKD A;  1VQK L;  3CME O;  1YI2 L;  1VQ6 L;  1K8A P;  3CCR O;  3CPW K;  1QVG N;  1M90 P;  1KD1 M;  3CMA L;  1VQ5 O;  3CC4 L;  3CPW N;  3CCU O;  5DLJ A;  3CCE O;  1YHQ O;  5DQZ A;  2QA4 L;  1Q7Y M;  1VQN L;  2OTL O;  3I56 L;  3CD6 L;  1VQO O;  5DS5 A;  1W2B N;  1VQP L;  1VQ9 O;  1S72 O;  1QVG K;  3G4S L;  3GOD A;  1Q7Y P;  1KC8 M;  1YIT O;  1YJN L;  3I55 L;  1VQL L;  3CCQ L;  3CXC K;  1YIJ L;  4P6I C;  1VQM L;  3CCM O;  1YJW L;  1KC8 P;  2YZS A;  3CCV O;  3CXC N;  1YJ9 L;  2OTJ O;  3CCJ L;  1VQ8 O;  4WJ0 A;  1W2B K;  3CC2 O;  1VQ7 L;  1Q81 M;  1KD1 P;  3CCL O;  1JJ2 K;  3CME L;  3G6E O;  1VQ4 O;  1Q86 M;  3CCR L;  3G71 O;  1Q81 P;  1JJ2 N;  5DS6 A;  3CC7 O;  3CCS L;  2QEX L;  1VQ5 L;  1VQK O;  5DS4 A;  1KQS K;  5DQT A;  1YI2 O;  1Q86 P;  3CCE L;  1YHQ L;  1VQ6 O;  1VQL O;  1QVF K;  3CMA O;  4QDL A;  1KQS N;  2OTL L;  4XTK A;  3CC4 O;  1M1K M;  1QVF N;  1K8A M;  4W8K A;  1VQ9 L;  1S72 L;  1M90 M;  2QA4 O;  1YIT L;  1VQN O;  5FCL A;  3I56 O;  1M1K P;  3CD6 O;  3OW2 K;  1VQP O;  1N8R M;  3G4S O;  1K73 M;  3CCM L;  3CCS O;  2QEX O;  3CCU L;  3CCV L;  3OW2 N;  1YJN O;  1Q82 M;  1NJI M;  2OTJ L;  3I55 O;  1K9M M;  1VQ8 L;  3CC2 L;  3CCQ O;  3CCL L;  1YIJ O;  1N8R P;  1K73 P;  3G6E L;  1VQM O;  1VQ4 L;  1YJW O;  1VQO L;  1NJI P;  1Q82 P;  1K9M P;  1YJ9 O;  3G71 L;  3CCJ O; 
#chains in the Genus database with same CATH homology
 1VQ7 O;  4N06 A;  3CC7 L;  3NKD A;  1VQK L;  3CME O;  1YI2 L;  1VQ6 L;  1K8A P;  3CCR O;  3CPW K;  1QVG N;  1M90 P;  1KD1 M;  3CMA L;  1VQ5 O;  3CC4 L;  3CPW N;  3CCU O;  5DLJ A;  3CCE O;  1YHQ O;  5DQZ A;  2QA4 L;  1Q7Y M;  1VQN L;  2OTL O;  3I56 L;  3CD6 L;  1VQO O;  5DS5 A;  1W2B N;  1VQP L;  1VQ9 O;  1S72 O;  1QVG K;  3G4S L;  3GOD A;  1Q7Y P;  1KC8 M;  1YIT O;  1YJN L;  3I55 L;  1VQL L;  3CCQ L;  3CXC K;  1YIJ L;  4P6I C;  1VQM L;  3CCM O;  1YJW L;  1KC8 P;  2YZS A;  3CCV O;  3CXC N;  1YJ9 L;  2OTJ O;  3CCJ L;  1VQ8 O;  4WJ0 A;  1W2B K;  3CC2 O;  1VQ7 L;  1Q81 M;  1KD1 P;  3CCL O;  1JJ2 K;  3CME L;  3G6E O;  1VQ4 O;  1Q86 M;  3CCR L;  3G71 O;  1Q81 P;  1JJ2 N;  5DS6 A;  3CC7 O;  3CCS L;  2QEX L;  1VQ5 L;  1VQK O;  5DS4 A;  1KQS K;  5DQT A;  1YI2 O;  1Q86 P;  3CCE L;  1YHQ L;  1VQ6 O;  1VQL O;  1QVF K;  3CMA O;  4QDL A;  1KQS N;  2OTL L;  4XTK A;  3CC4 O;  1M1K M;  1QVF N;  1K8A M;  4W8K A;  1VQ9 L;  1S72 L;  1M90 M;  2QA4 O;  1YIT L;  1VQN O;  5FCL A;  3I56 O;  1M1K P;  3CD6 O;  3OW2 K;  1VQP O;  1N8R M;  3G4S O;  1K73 M;  3CCM L;  3CCS O;  2QEX O;  3CCU L;  3CCV L;  3OW2 N;  1YJN O;  1Q82 M;  1NJI M;  2OTJ L;  3I55 O;  1K9M M;  1VQ8 L;  3CC2 L;  3CCQ O;  3CCL L;  1YIJ O;  1N8R P;  1K73 P;  3G6E L;  1VQM O;  1VQ4 L;  1YJW O;  1VQO L;  1NJI P;  1Q82 P;  1K9M P;  1YJ9 O;  3G71 L;  3CCJ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...