1KBTA

Solution structure of cardiotoxin iv, nmr, 12 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the hemolytic activity and solution structures of two snake venom cardiotoxin analogues which only differ in their N-terminal amino acid.
pubmed doi rcsb
molecule tags Cytotoxin
molecule keywords CTX IV
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kbtA00
4AEAA 2LA1A 2JQPA 1KFHA 1PLOA 4QTIU 1BTEA 1IDGA 1W6BA 1MR6A 1TGXA 2CRTA 1FSSB 2QC1A 3FEVA 3PLCA 2HLRA 2CTXA 2QJ9C 1RGJA 5DU1A 2MUOA 1MAHF 2UWRA 6EBXA 1KBSA 2H5FA 3U74U 1IDHA 1V6PA 1FFJA 1KS6A 2X8BB 4LFTA 1FSCA 1JGKA 1HAJA 2ABXA 1F8UB 1ABTA 3BT1U 4IYEA 4BDTB 1H0JA 3BT2U 2HLQA 2CDXA 1F94A 3QB4B 1CDRA 3EBXA 1JBDA 1KBTA 3NH7A 2GOOC 1CHVS 1NTNA 1KTZB 1IJCA 3HH7A 1CDTA 2N99A 1ERGA 1NYSA 2H8UA 2H7ZA 1LJZA 1NXBA 1HC9A 1NTXA 4OM5A 1COEA 4P7UA 1IK8A 1VB0A 5DZ5A 1TXAA 4UY2C 2CRSA 1TXBA 5IMYC 1IQ9A 1NEAA 2MHYA 1CDQA 1ONJA 3U73U 1RL5A 2ERAA 1NORA 2UX2A 3NEQA 1JE9A 2GOOB 2L5SA 1CVOA 5DO6A 1M9ZA 2MJYA 4RUDA 2MUPA 2FD6U 1CCQA 1QKDA 2QJBC 1HOYA 1KXIA 1CXNA 2H7ZB 2H62D 2MJ4A 4DO8A 2BTXA 4FAOE 1HC9B 3LAQU 2PJYB 2H64C 2J8BA 3KFDI 1REWC 2K3GA 3NDSA 2I9BE 2H64B 1ERAA 1ES7B 1L4WA 1I02A 1LX5B 1XT3A 1ZADA 1CXOA 1YWHA 1QKEA 1KC4A 1LXHA 1FASA 2NBTA 1IDLA 1FRAA 4HQPF 1CDSA 2LCRA 1IKCA 1CRFA 1KL8A 2L03A 3ERAA 5EBXA 1BXPA 2H62C 1CB9A 1KU6B 1HAAA 1CTXA 4EY8B 2MJ0A 2CCXA 2OFSA 1UG4A 2QJAC 3EVSC 1S4YA 1TFSA 1IDIA 4OM4A 4XJJA 2JVEA 1LXGA 1LSIA 2VLWA 1KBAA 1CREA 2MFAA 2BHIA 3KFDE 1QM7A 4ZQYA 4BIKB 1G6MA 5IMTD 1CODA 1DRSA 1FF4A 1B41B 3VTSA 2PJYC 4FAOC 1NYUA
chains in the Genus database with same CATH superfamily
4AEAA 2LA1A 2JQPA 1KFHA 1PLOA 4QTIU 1BTEA 1IDGA 1W6BA 1MR6A 1TGXA 2CRTA 1FSSB 2QC1A 3FEVA 3PLCA 2HLRA 2CTXA 2QJ9C 1RGJA 5DU1A 2MUOA 1MAHF 2UWRA 6EBXA 1KBSA 2H5FA 3U74U 1IDHA 1V6PA 1FFJA 1KS6A 2X8BB 4LFTA 1FSCA 1JGKA 1HAJA 2ABXA 1F8UB 1ABTA 3BT1U 4IYEA 4BDTB 1H0JA 3BT2U 2HLQA 2CDXA 1F94A 3QB4B 1CDRA 3EBXA 1JBDA 1KBTA 3NH7A 2GOOC 1CHVS 1NTNA 1KTZB 1IJCA 3HH7A 1CDTA 2N99A 1ERGA 1NYSA 2H8UA 2H7ZA 1LJZA 1NXBA 1HC9A 1NTXA 4OM5A 1COEA 4P7UA 1IK8A 1VB0A 5DZ5A 1TXAA 4UY2C 2CRSA 1TXBA 5IMYC 1IQ9A 1NEAA 2MHYA 1CDQA 1ONJA 3U73U 1RL5A 2ERAA 1NORA 2UX2A 3NEQA 1JE9A 2GOOB 2L5SA 1CVOA 5DO6A 1M9ZA 2MJYA 4RUDA 2MUPA 2FD6U 1CCQA 1QKDA 2QJBC 1HOYA 1KXIA 1CXNA 2H7ZB 2H62D 2MJ4A 4DO8A 2BTXA 4FAOE 1HC9B 3LAQU 2PJYB 2H64C 2J8BA 3KFDI 1REWC 2K3GA 3NDSA 2I9BE 2H64B 1ERAA 1ES7B 1L4WA 1I02A 1LX5B 1XT3A 1ZADA 1CXOA 1YWHA 1QKEA 1KC4A 1LXHA 1FASA 2NBTA 1IDLA 1FRAA 4HQPF 1CDSA 2LCRA 1IKCA 1CRFA 1KL8A 2L03A 3ERAA 5EBXA 1BXPA 2H62C 1CB9A 4KSNA 1KU6B 1HAAA 1CTXA 4EY8B 2MJ0A 2CCXA 2OFSA 1UG4A 2QJAC 3EVSC 1S4YA 1TFSA 1IDIA 4OM4A 4XJJA 2JVEA 1LXGA 1LSIA 2VLWA 1KBAA 1CREA 2MFAA 2BHIA 3KFDE 1QM7A 4ZQYA 4BIKB 1G6MA 5IMTD 1CODA 1DRSA 1FF4A 1B41B 3VTSA 2PJYC 4FAOC 1NYUA
chains in the Genus database with same CATH topology
4AEAA 2LA1A 2JQPA 1KFHA 1PLOA 4QTIU 1BTEA 1IDGA 1W6BA 1MR6A 1TGXA 2CRTA 1FSSB 2QC1A 3FEVA 3PLCA 2HLRA 2CTXA 2QJ9C 1RGJA 5DU1A 2MUOA 1MAHF 2UWRA 6EBXA 1KBSA 2H5FA 3U74U 1IDHA 1V6PA 1FFJA 1KS6A 2X8BB 4LFTA 1FSCA 1JGKA 1HAJA 2ABXA 1F8UB 1ABTA 3BT1U 4IYEA 4BDTB 1H0JA 3BT2U 2HLQA 2CDXA 1F94A 3QB4B 1CDRA 3EBXA 1JBDA 1KBTA 3NH7A 2GOOC 1CHVS 1NTNA 1KTZB 1IJCA 3HH7A 1CDTA 2N99A 1ERGA 1NYSA 2H8UA 2H7ZA 1LJZA 1NXBA 1HC9A 1NTXA 4OM5A 1COEA 4P7UA 1IK8A 1VB0A 5DZ5A 1TXAA 4UY2C 2CRSA 1TXBA 5IMYC 1IQ9A 1NEAA 2MHYA 1CDQA 1ONJA 3U73U 1RL5A 2ERAA 1NORA 2UX2A 3NEQA 1JE9A 2GOOB 2L5SA 1CVOA 5DO6A 1M9ZA 2MJYA 4RUDA 2MUPA 2FD6U 1CCQA 1QKDA 2QJBC 1HOYA 1KXIA 1CXNA 2H7ZB 2H62D 2MJ4A 4DO8A 2BTXA 4FAOE 1HC9B 3LAQU 2PJYB 2H64C 2J8BA 3KFDI 1REWC 2K3GA 3NDSA 2I9BE 2H64B 1ERAA 1ES7B 1L4WA 1I02A 1LX5B 1XT3A 1ZADA 1CXOA 1YWHA 1QKEA 1KC4A 1LXHA 1FASA 2NBTA 1IDLA 1FRAA 4HQPF 1CDSA 2LCRA 1IKCA 1CRFA 1KL8A 2L03A 3ERAA 5EBXA 1BXPA 2H62C 1CB9A 4KSNA 1KU6B 1HAAA 1CTXA 4EY8B 2MJ0A 2CCXA 2OFSA 1UG4A 2QJAC 3EVSC 1S4YA 1TFSA 1IDIA 4OM4A 4XJJA 2JVEA 1LXGA 1LSIA 2VLWA 1KBAA 1CREA 2MFAA 2BHIA 3KFDE 1QM7A 4ZQYA 4BIKB 1G6MA 5IMTD 1CODA 1DRSA 1FF4A 1B41B 3VTSA 2PJYC 4FAOC 1NYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEA A;  2LA1 A;  2JQP A;  1KFH A;  1PLO A;  4QTI U;  1BTE A;  1IDG A;  1W6B A;  1MR6 A;  1TGX A;  2CRT A;  1FSS B;  2QC1 A;  3FEV A;  3PLC A;  2HLR A;  2CTX A;  2QJ9 C;  1RGJ A;  5DU1 A;  2MUO A;  1MAH F;  2UWR A;  6EBX A;  1KBS A;  2H5F A;  3U74 U;  1IDH A;  1V6P A;  1FFJ A;  1KS6 A;  2X8B B;  4LFT A;  1FSC A;  1JGK A;  1HAJ A;  2ABX A;  1F8U B;  1ABT A;  3BT1 U;  4IYE A;  4BDT B;  1H0J A;  3BT2 U;  2HLQ A;  2CDX A;  1F94 A;  3QB4 B;  1CDR A;  3EBX A;  1JBD A;  1KBT A;  3NH7 A;  2GOO C;  1CHV S;  1NTN A;  1KTZ B;  1IJC A;  3HH7 A;  1CDT A;  2N99 A;  1ERG A;  1NYS A;  2H8U A;  2H7Z A;  1LJZ A;  1NXB A;  1HC9 A;  1NTX A;  4OM5 A;  1COE A;  4P7U A;  1IK8 A;  1VB0 A;  5DZ5 A;  1TXA A;  4UY2 C;  2CRS A;  1TXB A;  5IMY C;  1IQ9 A;  1NEA A;  2MHY A;  1CDQ A;  1ONJ A;  3U73 U;  1RL5 A;  2ERA A;  1NOR A;  2UX2 A;  3NEQ A;  1JE9 A;  2GOO B;  2L5S A;  1CVO A;  5DO6 A;  1M9Z A;  2MJY A;  4RUD A;  2MUP A;  2FD6 U;  1CCQ A;  1QKD A;  2QJB C;  1HOY A;  1KXI A;  1CXN A;  2H7Z B;  2H62 D;  2MJ4 A;  4DO8 A;  2BTX A;  4FAO E;  1HC9 B;  3LAQ U;  2PJY B;  2H64 C;  2J8B A;  3KFD I;  1REW C;  2K3G A;  3NDS A;  2I9B E;  2H64 B;  1ERA A;  1ES7 B;  1L4W A;  1I02 A;  1LX5 B;  1XT3 A;  1ZAD A;  1CXO A;  1YWH A;  1QKE A;  1KC4 A;  1LXH A;  1FAS A;  2NBT A;  1IDL A;  1FRA A;  4HQP F;  1CDS A;  2LCR A;  1IKC A;  1CRF A;  1KL8 A;  2L03 A;  3ERA A;  5EBX A;  1BXP A;  2H62 C;  1CB9 A;  1KU6 B;  1HAA A;  1CTX A;  4EY8 B;  2MJ0 A;  2CCX A;  2OFS A;  1UG4 A;  2QJA C;  3EVS C;  1S4Y A;  1TFS A;  1IDI A;  4OM4 A;  4XJJ A;  2JVE A;  1LXG A;  1LSI A;  2VLW A;  1KBA A;  1CRE A;  2MFA A;  2BHI A;  3KFD E;  1QM7 A;  4ZQY A;  4BIK B;  1G6M A;  5IMT D;  1COD A;  1DRS A;  1FF4 A;  1B41 B;  3VTS A;  2PJY C;  4FAO C;  1NYU A; 
#chains in the Genus database with same CATH topology
 4AEA A;  2LA1 A;  2JQP A;  1KFH A;  1PLO A;  4QTI U;  1BTE A;  1IDG A;  1W6B A;  1MR6 A;  1TGX A;  2CRT A;  1FSS B;  2QC1 A;  3FEV A;  3PLC A;  2HLR A;  2CTX A;  2QJ9 C;  1RGJ A;  5DU1 A;  2MUO A;  1MAH F;  2UWR A;  6EBX A;  1KBS A;  2H5F A;  3U74 U;  1IDH A;  1V6P A;  1FFJ A;  1KS6 A;  2X8B B;  4LFT A;  1FSC A;  1JGK A;  1HAJ A;  2ABX A;  1F8U B;  1ABT A;  3BT1 U;  4IYE A;  4BDT B;  1H0J A;  3BT2 U;  2HLQ A;  2CDX A;  1F94 A;  3QB4 B;  1CDR A;  3EBX A;  1JBD A;  1KBT A;  3NH7 A;  2GOO C;  1CHV S;  1NTN A;  1KTZ B;  1IJC A;  3HH7 A;  1CDT A;  2N99 A;  1ERG A;  1NYS A;  2H8U A;  2H7Z A;  1LJZ A;  1NXB A;  1HC9 A;  1NTX A;  4OM5 A;  1COE A;  4P7U A;  1IK8 A;  1VB0 A;  5DZ5 A;  1TXA A;  4UY2 C;  2CRS A;  1TXB A;  5IMY C;  1IQ9 A;  1NEA A;  2MHY A;  1CDQ A;  1ONJ A;  3U73 U;  1RL5 A;  2ERA A;  1NOR A;  2UX2 A;  3NEQ A;  1JE9 A;  2GOO B;  2L5S A;  1CVO A;  5DO6 A;  1M9Z A;  2MJY A;  4RUD A;  2MUP A;  2FD6 U;  1CCQ A;  1QKD A;  2QJB C;  1HOY A;  1KXI A;  1CXN A;  2H7Z B;  2H62 D;  2MJ4 A;  4DO8 A;  2BTX A;  4FAO E;  1HC9 B;  3LAQ U;  2PJY B;  2H64 C;  2J8B A;  3KFD I;  1REW C;  2K3G A;  3NDS A;  2I9B E;  2H64 B;  1ERA A;  1ES7 B;  1L4W A;  1I02 A;  1LX5 B;  1XT3 A;  1ZAD A;  1CXO A;  1YWH A;  1QKE A;  1KC4 A;  1LXH A;  1FAS A;  2NBT A;  1IDL A;  1FRA A;  4HQP F;  1CDS A;  2LCR A;  1IKC A;  1CRF A;  1KL8 A;  2L03 A;  3ERA A;  5EBX A;  1BXP A;  2H62 C;  1CB9 A;  4KSN A;  1KU6 B;  1HAA A;  1CTX A;  4EY8 B;  2MJ0 A;  2CCX A;  2OFS A;  1UG4 A;  2QJA C;  3EVS C;  1S4Y A;  1TFS A;  1IDI A;  4OM4 A;  4XJJ A;  2JVE A;  1LXG A;  1LSI A;  2VLW A;  1KBA A;  1CRE A;  2MFA A;  2BHI A;  3KFD E;  1QM7 A;  4ZQY A;  4BIK B;  1G6M A;  5IMT D;  1COD A;  1DRS A;  1FF4 A;  1B41 B;  3VTS A;  2PJY C;  4FAO C;  1NYU A; 
#chains in the Genus database with same CATH homology
 4AEA A;  2LA1 A;  2JQP A;  1KFH A;  1PLO A;  4QTI U;  1BTE A;  1IDG A;  1W6B A;  1MR6 A;  1TGX A;  2CRT A;  1FSS B;  2QC1 A;  3FEV A;  3PLC A;  2HLR A;  2CTX A;  2QJ9 C;  1RGJ A;  5DU1 A;  2MUO A;  1MAH F;  2UWR A;  6EBX A;  1KBS A;  2H5F A;  3U74 U;  1IDH A;  1V6P A;  1FFJ A;  1KS6 A;  2X8B B;  4LFT A;  1FSC A;  1JGK A;  1HAJ A;  2ABX A;  1F8U B;  1ABT A;  3BT1 U;  4IYE A;  4BDT B;  1H0J A;  3BT2 U;  2HLQ A;  2CDX A;  1F94 A;  3QB4 B;  1CDR A;  3EBX A;  1JBD A;  1KBT A;  3NH7 A;  2GOO C;  1CHV S;  1NTN A;  1KTZ B;  1IJC A;  3HH7 A;  1CDT A;  2N99 A;  1ERG A;  1NYS A;  2H8U A;  2H7Z A;  1LJZ A;  1NXB A;  1HC9 A;  1NTX A;  4OM5 A;  1COE A;  4P7U A;  1IK8 A;  1VB0 A;  5DZ5 A;  1TXA A;  4UY2 C;  2CRS A;  1TXB A;  5IMY C;  1IQ9 A;  1NEA A;  2MHY A;  1CDQ A;  1ONJ A;  3U73 U;  1RL5 A;  2ERA A;  1NOR A;  2UX2 A;  3NEQ A;  1JE9 A;  2GOO B;  2L5S A;  1CVO A;  5DO6 A;  1M9Z A;  2MJY A;  4RUD A;  2MUP A;  2FD6 U;  1CCQ A;  1QKD A;  2QJB C;  1HOY A;  1KXI A;  1CXN A;  2H7Z B;  2H62 D;  2MJ4 A;  4DO8 A;  2BTX A;  4FAO E;  1HC9 B;  3LAQ U;  2PJY B;  2H64 C;  2J8B A;  3KFD I;  1REW C;  2K3G A;  3NDS A;  2I9B E;  2H64 B;  1ERA A;  1ES7 B;  1L4W A;  1I02 A;  1LX5 B;  1XT3 A;  1ZAD A;  1CXO A;  1YWH A;  1QKE A;  1KC4 A;  1LXH A;  1FAS A;  2NBT A;  1IDL A;  1FRA A;  4HQP F;  1CDS A;  2LCR A;  1IKC A;  1CRF A;  1KL8 A;  2L03 A;  3ERA A;  5EBX A;  1BXP A;  2H62 C;  1CB9 A;  4KSN A;  1KU6 B;  1HAA A;  1CTX A;  4EY8 B;  2MJ0 A;  2CCX A;  2OFS A;  1UG4 A;  2QJA C;  3EVS C;  1S4Y A;  1TFS A;  1IDI A;  4OM4 A;  4XJJ A;  2JVE A;  1LXG A;  1LSI A;  2VLW A;  1KBA A;  1CRE A;  2MFA A;  2BHI A;  3KFD E;  1QM7 A;  4ZQY A;  4BIK B;  1G6M A;  5IMT D;  1COD A;  1DRS A;  1FF4 A;  1B41 B;  3VTS A;  2PJY C;  4FAO C;  1NYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...