1KD1H

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kd1H00
2OTJF 5G4VC 3WXMB 2ALEA 5A2QM 5GINC 3I55F 1K9MH 1GO0A 1CN7A 3CMEF 1YIJF 3CC4F 2VGNA 1DT9A 3I56F 4BY9D 1Q81H 5GANK 1KC8H 1GZ0A 5GAPK 2OTLF 3CXCF 2AIFA 3G6EF 5DCVA 1Q82H 1YITF 3G4SF 5GIPC 1Q7YH 2I6DA 3NK6A 2QEXF 1KQSF 3NVKE 3J7AR 5G4UC 1X7PA 3LWVC 4X3MA 3PAFA 4BW0B 5FLXM 3JCMM 2KTUA 3SIUA 3LWOC 1SDSA 1VQ5F 1QVFF 1H7MA 3CCEF 3O85A 1CK2A 3CCMF 4NUTA 2OHWA 3AGKA 2QA4F 5FJ4C 1ZWZA 5EWRA 3HJWC 1W42A 3CMAF 3CCVF 3N4YA 3MCAB 3PLAC 4TZZA 2VGMA 3GYQA 1NMUB 3OBWA 2BO1A 2OZBA 1KD1H 1X7OA 1M90H 1RLGA 1VQMF 3VI6A 1N8RH 3E1YA 2HVYD 2LBWA 3LWQC 3CCQF 1NJIH 1W41A 1VQ8F 3ON1A 3RA6A 1VQOF 3OBYA 1VQ6F 2CZWA 3CCSF 1XBIA 3HAXD 3FFMA 1W40A 3SIVA 1K8AH 1YHQF 4X3LA 3CG6A 1VQ9F 3N4ZA 3OW2F 1IPAA 2KTVA 1E7KA 3E20B 1VQ7F 1PXWA 1Q86H 3JAMM 1K73H 3VMFB 1VQKF 2WALA 1YI2F 3J80M 1M1KH 3CPWF 4C4WC 1QVGF 3CD6F 3CCUF 1YJNF 3NK7A 3IR9A 2JNBA 3LFOA 3CPQA 1GO1A 5GIOC 3NMUC 1VQLF 3CC7F 3CCJF 1W3EX 1W2BF 5IT9M 3CCRF 3CC2F 3RA5A 3V7QA 1VQPF 3CCLF 1YJ9F 1YJWF 4LCKA 1VQ4F 1VQNF 3J81M 2KG4A 2QI2A 3LWPC 1S72F 1X52A 1T0KB 3G71F 5EO3A 2FC3A 3NVIB 2LBXA 1RA4A 1JJ2F 3LWRC 3V7EA
chains in the Genus database with same CATH superfamily
5G4VC 5EB1B 5LP6B 2ALEA 5A2QM 1GO0A 3E22B 1QD9A 3IEQA 3HKCB 5J2TB 5LOVA 3JATA 4BVRA 4I50A 3I56F 2W8BC 1U40A 2DYYA 1IV2A 2HRYA 4X1KA 3S02A 2AIFA 4ZI7A 1W5EA 5EIBC 2Z1UA 1Q82H 3JVHA 2R6R1 4YJ3A 2QEXF 2CSLA 5JH7B 1UFYA 4U3JB 3JALB 1X7PA 5IYZB 1KQSF 4X3MA 3VYSC 2K1SA 2IG8A 3LWOC 1SDSA 1QVFF 1W581 2HS0A 1H7MA 4O4LB 3D00A 3CCEF 3F0FA 5JCOC 2LBTA 3N2KA 3CCMF 4NUTA 2EWCA 3AGKA 3KJJA 2QA4F 4TUYA 1ZWZA 2BTOA 5EWRA 3C8LA 3ELCA 3F6MA 3ZP7A 3WGNA 4IIJA 3JATB 5LOVB 3CCVF 2Z1FA 3RYHB 3R0PA 3JARB 5CA1B 2VGMA 4TZZA 3KHNA 3GYQA 3M84A 2ZODA 2IQQA 4DXDA 1KD1H 1QAHA 3CB2A 1Q8RA 5LYJA 5KMGB 3WGMA 2Q1YA 3LWQC 4O4IB 3ON1A 2CHSA 4YJ3B 3OBYA 5HP8A 1VQOF 1XBIA 3HAXD 3K0TA 4O4HA 1K8AH 4O2BA 4ZOLB 3UT5A 1SA0A 3P0ZA 2KTVA 2VXYA 3N2KB 3VYTC 1Q86H 3JAMM 1K73H 3JAWA 4TUYB 3U0OA 5EIBD 3CPWF 4IIJB 2H8EA 3JASB 3HKBA 1VK3A 2B33A 3DC2A 5EZYB 1GX1A 3C9SA 5CA0A 2ZF8A 2N48A 1TUBB 2HS4A 3CCRF 3LDTA 2RHOA 3QUWA 2RHLA 4R40B 2UYNA 3V7QA 2HS3A 4O4JB 4LCKA 1VQ4F 3TD5A 2UZHA 4O4HB 3J81M 2R751 3WPWA 1S72F 5EB0A 5EO3A 3GTZA 4O2BB 2CWJA 2Z01A 3M1XA 3WXMB 5GINC 3I55F 3GHZA 3JAWB 1ONIA 1W55A 1J7HA 3K2XA 1FNJA 1YIJF 3VOBA 3JAKA 1DT9A 3HKBB 4BY9D 1Q81H 5GANK 5CA0B 1ODEA 4F6RB 2CHTA 4ZHQB 2Z1EA 3I7TA 3QHDA 5DCVA 3C9UA 5EYPA 2UYNB 1YITF 3MDOA 1Q7YH 4I4TB 3NVKE 2V9YA 3RE3A 5G4UC 2CW4A 3S0YA 3PAFA 4BW0B 4C8EA 4ZHWA 5FLXM 3LYBA 3SIUA 5J2UB 3ERNA 5HY1A 1XV2A 4EB6A 2H6LA 1UI9A 3F0DA 5LA6A 5LXTA 4TV8A 1OFUA 3HJWC 1W42A 4O2AA 3RYFB 4TV9A 1RQ7A 1W57A 3IKEA 3MCAB 1X25A 4RQOA 3PLAC 1YQNA 3WJPA 2OZBA 2VAMA 1VQMF 4G4ZA 2H8CA 1JFFA 5HY0A 3FD6A 4NQ3A 1KNJA 2CZWA 1PF5A 3EORA 3C9TA 4C8IA 3FPIA 1W40A 4B45A 3LMEA 3VTIC 1YGYA 3WJQA 4EB6B 5B8FA 1U3LA 2RB9A 3N2GA 4I50B 5LXTB 1VQKF 2WALA 3S0HA 4KWEA 2HQSC 3V3TA 3VCZA 5JQGA 3J80M 4I55A 1YI2F 4X1KB 4C4WC 1QVGF 2UYKA 4ZI7B 1IV3A 2VAPA 3CYQA 3RYIA 3CC7F 2NMUA 5IT9M 3MQWA 3ZP4A 3CCLF 5JVDA 4BT7A 2CVLA 4X20A 4X1IA 5BMVA 1T0KB 4C81A 1IV1A 3D01A 5IJ0A 2VAWA 3HKEA 4IHJA 5ITZA 2AMTA 3N2GB 3V7EA 3HKDA 1JD1A 3TD4A 3F0EA 4ZHYB 1CN7A 1TVKA 2ZAUA 1W5AA 5GONA 4BT5A 4WBNA 5JQGB 2BTUA 4I55B 4DRXA 3CC4F 2VGNA 4EI7A 4B62A 1U3PA 5LYJB 2GVIA 4X1YA 1GZ0A 5GAPK 2OTLF 5IJ9A 5HY2A 1JN1A 3C9RA 4G4WA 1RQ2A 3P4EA 5GIPC 3NK6A 2L26A 3UT5B 3J7AR 1SA0B 3HWUA 3JCMM 3VO8A 5FNVA 3HKEB 5ITZB 1FFXA 4M8IA 2UYPA 4ERHA 4FFBA 3HKDB 3L7QA 4NWOB 5C8YA 3M4SA 5KX5A 2OHWA 3KIZA 1TVKB 5AVMA 4YJ2A 2HP3A 3WGKA 3IMPA 4C8GA 2YYEA 3CMAF 3E22A 3HKCA 4EI8A 2HP0A 5IJ9B 3Q8HA 2YXZA 4E6EA 3VI6A 2ZVYA 2QTPA 3S0WA 3E1YA 2LBWA 3CCQF 1NJIH 1VQ8F 3RA6A 4U39A 3CCSF 3FFMA 4LNUA 1JY8A 3FBAA 1SZQA 5JH7A 4U3JA 5IYZA 3K14A 2HRUA 1IPAA 2RHHA 4FFBB 3OONA 2ZOVA 3JAKB 5HY4A 3E20B 5KX5B 4G4YA 1VQ7F 1PXWA 2IAFA 5HXUA 4O4LA 3VMFB 2I6RA 3CD6F 3CCUF 1YJNF 2JNBA 3LFOA 3NMUC 1GO1A 5EYPB 1VQLF 5LP6C 3CCJF 2HP0B 3F0GA 3RYHA 5CA1A 3JARA 3RA5A 1T0AA 4B5CA 2UYJA 1YJ9F 5HXZA 1VHAA 3RYCA 3BYQA 2KG4A 2QI2A 5KMGA 5MN6A 1FNKA 1X52A 4LNUB 5LA6B 3P10A 4O4IA 3G71F 2PMPA 3NVIB 3ZO8A 2LBXA 4TV8B 4BT3A 3DDNA 1CLIA 3VYUC 2OTJF 4O2AB 2LCAA 4TV9B 1K9MH 4ZOLA 3CMEF 1RLUA 1JFFB 1KC8H 1IV4A 3KE1A 5MN5A 3CXCF 1VH8A 3JASA 3TD3A 1R1MA 5MN4A 3G6EF 3WGLA 5EZYA 3G4SF 1TUBA 3FD5A 2Q1XA 4BVTA 4HNAA 2I6DA 4EI9A 2MQEA 3LWVC 3KJKA 3RYCB 1H47A 3WJRA 2G9IA 2KTUA 4O4JA 4B46A 1VQ5F 4XCQA 3VOAA 2FGYA 1W5BA 3O85A 3S06A 1CK2A 5HP7A 2BTQB 5FJ4C 1H48A 2Z1TA 4BVQA 3RYIB 1FSZA 1NQ3A 1DBFA 4G4VA 3N4YA 1W59A 1NMUB 3WPXA 3OBWA 2BO1A 4BT2A 3MBMA 4G4XA 5JVDB 5HWEA 1X7OA 1QU9A 1M90H 4X20B 1RLGA 3ZOPA 3B6NA 1N8RH 4C82A 4RHAA 4X1IB 2HVYD 5BMVB 3V4DA 4F6RA 1W41A 1Z5WA 4ZHQA 4HNAB 1VQ6F 5IJ0B 3MCQA 4IHJB 5EAZA 1OAPA 1XRGA 3QTYA 2OTMA 3SIVA 4I4TA 4G88A 2KGWA 4X3LA 1YHQF 3CG6A 3CYPB 1VQ9F 2GLZA 3N4ZA 3OW2F 5CB4A 5GONB 4WBNB 1KNKA 2ZVZA 2HX0A 4DRXB 1E7KA 5J2UA 5LP6A 2DT4A 3I3FA 4X1YB 3WGJA 5J2TA 3HTNA 1W5FA 3S03A 2P6YA 1M1KH 3VIUA 2AIZP 2GZLA 4BVSA 3NK7A 3IR9A 3CPQA 4ZK7A 3IEWA 4BT6A 5GIOC 3D54A 2RHJA 1W3EX 1W2BF 3RYFA 3ESJA 3CC2F 1XHOA 3T80A 2PHNA 1VQPF 4BT4A 3IKFA 1YJWF 1VQNF 5FNVB 3JALA 1U43A 1Z5VA 1FFXB 1COMA 3LWPC 5JCOA 5C8YB 3K12A 2FC3A 4ZHVA 4PWTA 1RA4A 1VQVA 1JJ2F 3LWRC 4YJ2B 5CB4B 2F9ZC
chains in the Genus database with same CATH topology
2OTJF 5G4VC 3WXMB 2ALEA 5A2QM 5GINC 3I55F 1K9MH 1GO0A 1CN7A 3CMEF 1YIJF 3CC4F 4BVRA 2VGNA 1DT9A 3I56F 4BY9D 4EI7A 1Q81H 5GANK 1KC8H 1GZ0A 5GAPK 2OTLF 3CXCF 2AIFA 5HY2A 3G6EF 5DCVA 1Q82H 1YITF 3G4SF 5GIPC 1Q7YH 4BVTA 2I6DA 3NK6A 4EI9A 2QEXF 1KQSF 3J7AR 3NVKE 1X7PA 5G4UC 3LWVC 4X3MA 3PAFA 4BW0B 5FLXM 3JCMM 2KTUA 3SIUA 3LWOC 1SDSA 1VQ5F 1QVFF 5HY1A 4XCQA 1H7MA 2FGYA 3D00A 3CCEF 3O85A 1CK2A 3CCMF 4NUTA 2OHWA 3AGKA 2QA4F 5FJ4C 1ZWZA 5EWRA 4BVQA 3HJWC 1W42A 3CMAF 3CCVF 3N4YA 3MCAB 3PLAC 4TZZA 2VGMA 3GYQA 4EI8A 1NMUB 3OBWA 2BO1A 5HWEA 2OZBA 1KD1H 1X7OA 1M90H 1RLGA 1VQMF 3VI6A 1N8RH 5HY0A 3E1YA 4NQ3A 2HVYD 2LBWA 3LWQC 3CCQF 1NJIH 1W41A 1VQ8F 3ON1A 3RA6A 1VQOF 3OBYA 1VQ6F 2CZWA 3CCSF 1XBIA 3HAXD 3FFMA 1W40A 3SIVA 1K8AH 1YHQF 4X3LA 3CG6A 1VQ9F 2GLZA 3N4ZA 3OW2F 1IPAA 2KTVA 5HY4A 3E20B 1E7KA 1VQ7F 1PXWA 5HXUA 3JAMM 1Q86H 1K73H 3VMFB 1VQKF 2WALA 3V3TA 3J80M 1YI2F 3CPWF 4BVSA 1M1KH 4C4WC 1QVGF 3CD6F 3CCUF 1YJNF 3NK7A 3IR9A 2JNBA 3LFOA 3CPQA 1GO1A 5GIOC 3NMUC 1VQLF 3CC7F 3CCJF 1W3EX 1W2BF 5IT9M 3CCRF 3CC2F 3RA5A 3V7QA 1VQPF 3CCLF 1YJ9F 1YJWF 4LCKA 1VQ4F 1VQNF 5HXZA 3J81M 2KG4A 2QI2A 3LWPC 1S72F 1X52A 1T0KB 3G71F 5EO3A 2FC3A 3NVIB 2LBXA 1RA4A 1JJ2F 3LWRC 3V7EA 2F9ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ F;  5G4V C;  3WXM B;  2ALE A;  5A2Q M;  5GIN C;  3I55 F;  1K9M H;  1GO0 A;  1CN7 A;  3CME F;  1YIJ F;  3CC4 F;  2VGN A;  1DT9 A;  3I56 F;  4BY9 D;  1Q81 H;  5GAN K;  1KC8 H;  1GZ0 A;  5GAP K;  2OTL F;  3CXC F;  2AIF A;  3G6E F;  5DCV A;  1Q82 H;  1YIT F;  3G4S F;  5GIP C;  1Q7Y H;  2I6D A;  3NK6 A;  2QEX F;  1KQS F;  3NVK E;  3J7A R;  5G4U C;  1X7P A;  3LWV C;  4X3M A;  3PAF A;  4BW0 B;  5FLX M;  3JCM M;  2KTU A;  3SIU A;  3LWO C;  1SDS A;  1VQ5 F;  1QVF F;  1H7M A;  3CCE F;  3O85 A;  1CK2 A;  3CCM F;  4NUT A;  2OHW A;  3AGK A;  2QA4 F;  5FJ4 C;  1ZWZ A;  5EWR A;  3HJW C;  1W42 A;  3CMA F;  3CCV F;  3N4Y A;  3MCA B;  3PLA C;  4TZZ A;  2VGM A;  3GYQ A;  1NMU B;  3OBW A;  2BO1 A;  2OZB A;  1KD1 H;  1X7O A;  1M90 H;  1RLG A;  1VQM F;  3VI6 A;  1N8R H;  3E1Y A;  2HVY D;  2LBW A;  3LWQ C;  3CCQ F;  1NJI H;  1W41 A;  1VQ8 F;  3ON1 A;  3RA6 A;  1VQO F;  3OBY A;  1VQ6 F;  2CZW A;  3CCS F;  1XBI A;  3HAX D;  3FFM A;  1W40 A;  3SIV A;  1K8A H;  1YHQ F;  4X3L A;  3CG6 A;  1VQ9 F;  3N4Z A;  3OW2 F;  1IPA A;  2KTV A;  1E7K A;  3E20 B;  1VQ7 F;  1PXW A;  1Q86 H;  3JAM M;  1K73 H;  3VMF B;  1VQK F;  2WAL A;  1YI2 F;  3J80 M;  1M1K H;  3CPW F;  4C4W C;  1QVG F;  3CD6 F;  3CCU F;  1YJN F;  3NK7 A;  3IR9 A;  2JNB A;  3LFO A;  3CPQ A;  1GO1 A;  5GIO C;  3NMU C;  1VQL F;  3CC7 F;  3CCJ F;  1W3E X;  1W2B F;  5IT9 M;  3CCR F;  3CC2 F;  3RA5 A;  3V7Q A;  1VQP F;  3CCL F;  1YJ9 F;  1YJW F;  4LCK A;  1VQ4 F;  1VQN F;  3J81 M;  2KG4 A;  2QI2 A;  3LWP C;  1S72 F;  1X52 A;  1T0K B;  3G71 F;  5EO3 A;  2FC3 A;  3NVI B;  2LBX A;  1RA4 A;  1JJ2 F;  3LWR C;  3V7E A; 
#chains in the Genus database with same CATH topology
 5G4V C;  5EB1 B;  5LP6 B;  2ALE A;  5A2Q M;  1GO0 A;  3E22 B;  1QD9 A;  3IEQ A;  3HKC B;  5J2T B;  5LOV A;  3JAT A;  4BVR A;  4I50 A;  3I56 F;  2W8B C;  1U40 A;  2DYY A;  1IV2 A;  2HRY A;  4X1K A;  3S02 A;  2AIF A;  4ZI7 A;  1W5E A;  5EIB C;  2Z1U A;  1Q82 H;  3JVH A;  2R6R 1;  4YJ3 A;  2QEX F;  2CSL A;  5JH7 B;  1UFY A;  4U3J B;  3JAL B;  1X7P A;  5IYZ B;  1KQS F;  4X3M A;  3VYS C;  2K1S A;  2IG8 A;  3LWO C;  1SDS A;  1QVF F;  1W58 1;  2HS0 A;  1H7M A;  4O4L B;  3D00 A;  3CCE F;  3F0F A;  5JCO C;  2LBT A;  3N2K A;  3CCM F;  4NUT A;  2EWC A;  3AGK A;  3KJJ A;  2QA4 F;  4TUY A;  1ZWZ A;  2BTO A;  5EWR A;  3C8L A;  3ELC A;  3F6M A;  3ZP7 A;  3WGN A;  4IIJ A;  3JAT B;  5LOV B;  3CCV F;  2Z1F A;  3RYH B;  3R0P A;  3JAR B;  5CA1 B;  2VGM A;  4TZZ A;  3KHN A;  3GYQ A;  3M84 A;  2ZOD A;  2IQQ A;  4DXD A;  1KD1 H;  1QAH A;  3CB2 A;  1Q8R A;  5LYJ A;  5KMG B;  3WGM A;  2Q1Y A;  3LWQ C;  4O4I B;  3ON1 A;  2CHS A;  4YJ3 B;  3OBY A;  5HP8 A;  1VQO F;  1XBI A;  3HAX D;  3K0T A;  4O4H A;  1K8A H;  4O2B A;  4ZOL B;  3UT5 A;  1SA0 A;  3P0Z A;  2KTV A;  2VXY A;  3N2K B;  3VYT C;  1Q86 H;  3JAM M;  1K73 H;  3JAW A;  4TUY B;  3U0O A;  5EIB D;  3CPW F;  4IIJ B;  2H8E A;  3JAS B;  3HKB A;  1VK3 A;  2B33 A;  3DC2 A;  5EZY B;  1GX1 A;  3C9S A;  5CA0 A;  2ZF8 A;  2N48 A;  1TUB B;  2HS4 A;  3CCR F;  3LDT A;  2RHO A;  3QUW A;  2RHL A;  4R40 B;  2UYN A;  3V7Q A;  2HS3 A;  4O4J B;  4LCK A;  1VQ4 F;  3TD5 A;  2UZH A;  4O4H B;  3J81 M;  2R75 1;  3WPW A;  1S72 F;  5EB0 A;  5EO3 A;  3GTZ A;  4O2B B;  2CWJ A;  2Z01 A;  3M1X A;  3WXM B;  5GIN C;  3I55 F;  3GHZ A;  3JAW B;  1ONI A;  1W55 A;  1J7H A;  3K2X A;  1FNJ A;  1YIJ F;  3VOB A;  3JAK A;  1DT9 A;  3HKB B;  4BY9 D;  1Q81 H;  5GAN K;  5CA0 B;  1ODE A;  4F6R B;  2CHT A;  4ZHQ B;  2Z1E A;  3I7T A;  3QHD A;  5DCV A;  3C9U A;  5EYP A;  2UYN B;  1YIT F;  3MDO A;  1Q7Y H;  4I4T B;  3NVK E;  2V9Y A;  3RE3 A;  5G4U C;  2CW4 A;  3S0Y A;  3PAF A;  4BW0 B;  4C8E A;  4ZHW A;  5FLX M;  3LYB A;  3SIU A;  5J2U B;  3ERN A;  5HY1 A;  1XV2 A;  4EB6 A;  2H6L A;  1UI9 A;  3F0D A;  5LA6 A;  5LXT A;  4TV8 A;  1OFU A;  3HJW C;  1W42 A;  4O2A A;  3RYF B;  4TV9 A;  1RQ7 A;  1W57 A;  3IKE A;  3MCA B;  1X25 A;  4RQO A;  3PLA C;  1YQN A;  3WJP A;  2OZB A;  2VAM A;  1VQM F;  4G4Z A;  2H8C A;  1JFF A;  5HY0 A;  3FD6 A;  4NQ3 A;  1KNJ A;  2CZW A;  1PF5 A;  3EOR A;  3C9T A;  4C8I A;  3FPI A;  1W40 A;  4B45 A;  3LME A;  3VTI C;  1YGY A;  3WJQ A;  4EB6 B;  5B8F A;  1U3L A;  2RB9 A;  3N2G A;  4I50 B;  5LXT B;  1VQK F;  2WAL A;  3S0H A;  4KWE A;  2HQS C;  3V3T A;  3VCZ A;  5JQG A;  3J80 M;  4I55 A;  1YI2 F;  4X1K B;  4C4W C;  1QVG F;  2UYK A;  4ZI7 B;  1IV3 A;  2VAP A;  3CYQ A;  3RYI A;  3CC7 F;  2NMU A;  5IT9 M;  3MQW A;  3ZP4 A;  3CCL F;  5JVD A;  4BT7 A;  2CVL A;  4X20 A;  4X1I A;  5BMV A;  1T0K B;  4C81 A;  1IV1 A;  3D01 A;  5IJ0 A;  2VAW A;  3HKE A;  4IHJ A;  5ITZ A;  2AMT A;  3N2G B;  3V7E A;  3HKD A;  1JD1 A;  3TD4 A;  3F0E A;  4ZHY B;  1CN7 A;  1TVK A;  2ZAU A;  1W5A A;  5GON A;  4BT5 A;  4WBN A;  5JQG B;  2BTU A;  4I55 B;  4DRX A;  3CC4 F;  2VGN A;  4EI7 A;  4B62 A;  1U3P A;  5LYJ B;  2GVI A;  4X1Y A;  1GZ0 A;  5GAP K;  2OTL F;  5IJ9 A;  5HY2 A;  1JN1 A;  3C9R A;  4G4W A;  1RQ2 A;  3P4E A;  5GIP C;  3NK6 A;  2L26 A;  3UT5 B;  3J7A R;  1SA0 B;  3HWU A;  3JCM M;  3VO8 A;  5FNV A;  3HKE B;  5ITZ B;  1FFX A;  4M8I A;  2UYP A;  4ERH A;  4FFB A;  3HKD B;  3L7Q A;  4NWO B;  5C8Y A;  3M4S A;  5KX5 A;  2OHW A;  3KIZ A;  1TVK B;  5AVM A;  4YJ2 A;  2HP3 A;  3WGK A;  3IMP A;  4C8G A;  2YYE A;  3CMA F;  3E22 A;  3HKC A;  4EI8 A;  2HP0 A;  5IJ9 B;  3Q8H A;  2YXZ A;  4E6E A;  3VI6 A;  2ZVY A;  2QTP A;  3S0W A;  3E1Y A;  2LBW A;  3CCQ F;  1NJI H;  1VQ8 F;  3RA6 A;  4U39 A;  3CCS F;  3FFM A;  4LNU A;  1JY8 A;  3FBA A;  1SZQ A;  5JH7 A;  4U3J A;  5IYZ A;  3K14 A;  2HRU A;  1IPA A;  2RHH A;  4FFB B;  3OON A;  2ZOV A;  3JAK B;  5HY4 A;  3E20 B;  5KX5 B;  4G4Y A;  1VQ7 F;  1PXW A;  2IAF A;  5HXU A;  4O4L A;  3VMF B;  2I6R A;  3CD6 F;  3CCU F;  1YJN F;  2JNB A;  3LFO A;  3NMU C;  1GO1 A;  5EYP B;  1VQL F;  5LP6 C;  3CCJ F;  2HP0 B;  3F0G A;  3RYH A;  5CA1 A;  3JAR A;  3RA5 A;  1T0A A;  4B5C A;  2UYJ A;  1YJ9 F;  5HXZ A;  1VHA A;  3RYC A;  3BYQ A;  2KG4 A;  2QI2 A;  5KMG A;  5MN6 A;  1FNK A;  1X52 A;  4LNU B;  5LA6 B;  3P10 A;  4O4I A;  3G71 F;  2PMP A;  3NVI B;  3ZO8 A;  2LBX A;  4TV8 B;  4BT3 A;  3DDN A;  1CLI A;  3VYU C;  2OTJ F;  4O2A B;  2LCA A;  4TV9 B;  1K9M H;  4ZOL A;  3CME F;  1RLU A;  1JFF B;  1KC8 H;  1IV4 A;  3KE1 A;  5MN5 A;  3CXC F;  1VH8 A;  3JAS A;  3TD3 A;  1R1M A;  5MN4 A;  3G6E F;  3WGL A;  5EZY A;  3G4S F;  1TUB A;  3FD5 A;  2Q1X A;  4BVT A;  4HNA A;  2I6D A;  4EI9 A;  2MQE A;  3LWV C;  3KJK A;  3RYC B;  1H47 A;  3WJR A;  2G9I A;  2KTU A;  4O4J A;  4B46 A;  1VQ5 F;  4XCQ A;  3VOA A;  2FGY A;  1W5B A;  3O85 A;  3S06 A;  1CK2 A;  5HP7 A;  2BTQ B;  5FJ4 C;  1H48 A;  2Z1T A;  4BVQ A;  3RYI B;  1FSZ A;  1NQ3 A;  1DBF A;  4G4V A;  3N4Y A;  1W59 A;  1NMU B;  3WPX A;  3OBW A;  2BO1 A;  4BT2 A;  3MBM A;  4G4X A;  5JVD B;  5HWE A;  1X7O A;  1QU9 A;  1M90 H;  4X20 B;  1RLG A;  3ZOP A;  3B6N A;  1N8R H;  4C82 A;  4RHA A;  4X1I B;  2HVY D;  5BMV B;  3V4D A;  4F6R A;  1W41 A;  1Z5W A;  4ZHQ A;  4HNA B;  1VQ6 F;  5IJ0 B;  3MCQ A;  4IHJ B;  5EAZ A;  1OAP A;  1XRG A;  3QTY A;  2OTM A;  3SIV A;  4I4T A;  4G88 A;  2KGW A;  4X3L A;  1YHQ F;  3CG6 A;  3CYP B;  1VQ9 F;  2GLZ A;  3N4Z A;  3OW2 F;  5CB4 A;  5GON B;  4WBN B;  1KNK A;  2ZVZ A;  2HX0 A;  4DRX B;  1E7K A;  5J2U A;  5LP6 A;  2DT4 A;  3I3F A;  4X1Y B;  3WGJ A;  5J2T A;  3HTN A;  1W5F A;  3S03 A;  2P6Y A;  1M1K H;  3VIU A;  2AIZ P;  2GZL A;  4BVS A;  3NK7 A;  3IR9 A;  3CPQ A;  4ZK7 A;  3IEW A;  4BT6 A;  5GIO C;  3D54 A;  2RHJ A;  1W3E X;  1W2B F;  3RYF A;  3ESJ A;  3CC2 F;  1XHO A;  3T80 A;  2PHN A;  1VQP F;  4BT4 A;  3IKF A;  1YJW F;  1VQN F;  5FNV B;  3JAL A;  1U43 A;  1Z5V A;  1FFX B;  1COM A;  3LWP C;  5JCO A;  5C8Y B;  3K12 A;  2FC3 A;  4ZHV A;  4PWT A;  1RA4 A;  1VQV A;  1JJ2 F;  3LWR C;  4YJ2 B;  5CB4 B;  2F9Z C; 
#chains in the Genus database with same CATH homology
 2OTJ F;  5G4V C;  3WXM B;  2ALE A;  5A2Q M;  5GIN C;  3I55 F;  1K9M H;  1GO0 A;  1CN7 A;  3CME F;  1YIJ F;  3CC4 F;  4BVR A;  2VGN A;  1DT9 A;  3I56 F;  4BY9 D;  4EI7 A;  1Q81 H;  5GAN K;  1KC8 H;  1GZ0 A;  5GAP K;  2OTL F;  3CXC F;  2AIF A;  5HY2 A;  3G6E F;  5DCV A;  1Q82 H;  1YIT F;  3G4S F;  5GIP C;  1Q7Y H;  4BVT A;  2I6D A;  3NK6 A;  4EI9 A;  2QEX F;  1KQS F;  3J7A R;  3NVK E;  1X7P A;  5G4U C;  3LWV C;  4X3M A;  3PAF A;  4BW0 B;  5FLX M;  3JCM M;  2KTU A;  3SIU A;  3LWO C;  1SDS A;  1VQ5 F;  1QVF F;  5HY1 A;  4XCQ A;  1H7M A;  2FGY A;  3D00 A;  3CCE F;  3O85 A;  1CK2 A;  3CCM F;  4NUT A;  2OHW A;  3AGK A;  2QA4 F;  5FJ4 C;  1ZWZ A;  5EWR A;  4BVQ A;  3HJW C;  1W42 A;  3CMA F;  3CCV F;  3N4Y A;  3MCA B;  3PLA C;  4TZZ A;  2VGM A;  3GYQ A;  4EI8 A;  1NMU B;  3OBW A;  2BO1 A;  5HWE A;  2OZB A;  1KD1 H;  1X7O A;  1M90 H;  1RLG A;  1VQM F;  3VI6 A;  1N8R H;  5HY0 A;  3E1Y A;  4NQ3 A;  2HVY D;  2LBW A;  3LWQ C;  3CCQ F;  1NJI H;  1W41 A;  1VQ8 F;  3ON1 A;  3RA6 A;  1VQO F;  3OBY A;  1VQ6 F;  2CZW A;  3CCS F;  1XBI A;  3HAX D;  3FFM A;  1W40 A;  3SIV A;  1K8A H;  1YHQ F;  4X3L A;  3CG6 A;  1VQ9 F;  2GLZ A;  3N4Z A;  3OW2 F;  1IPA A;  2KTV A;  5HY4 A;  3E20 B;  1E7K A;  1VQ7 F;  1PXW A;  5HXU A;  3JAM M;  1Q86 H;  1K73 H;  3VMF B;  1VQK F;  2WAL A;  3V3T A;  3J80 M;  1YI2 F;  3CPW F;  4BVS A;  1M1K H;  4C4W C;  1QVG F;  3CD6 F;  3CCU F;  1YJN F;  3NK7 A;  3IR9 A;  2JNB A;  3LFO A;  3CPQ A;  1GO1 A;  5GIO C;  3NMU C;  1VQL F;  3CC7 F;  3CCJ F;  1W3E X;  1W2B F;  5IT9 M;  3CCR F;  3CC2 F;  3RA5 A;  3V7Q A;  1VQP F;  3CCL F;  1YJ9 F;  1YJW F;  4LCK A;  1VQ4 F;  1VQN F;  5HXZ A;  3J81 M;  2KG4 A;  2QI2 A;  3LWP C;  1S72 F;  1X52 A;  1T0K B;  3G71 F;  5EO3 A;  2FC3 A;  3NVI B;  2LBX A;  1RA4 A;  1JJ2 F;  3LWR C;  3V7E A;  2F9Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...