1KD1J

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 29
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1kd1J00
3I55H 1VQ7H 2ZJPJ 4WF9J 2QEXH 4U67J 3G4SH 1VQOH 3J7ZM 3CMAH 3PIPJ 3G6EH 5GADN 3CCUH 1YI2H 1W2BH 1JJ2H 1VQ5H 1YHQH 5MLCO 4IOCJ 1VQPH 4WFAJ 1VQ4H 3CC7H 1YITH 3CC4H 3CCRH 3CMEH 1K9MJ 3G71H 1K73J 1S72H 1KC8J 1VQKH 3CCEH 1YJ9H 3CCLH 1Q81J 2QA4H 3CCJH 5DM6J 1KQSH 1YJWH 4IO9J 1Y69K 1Q7YJ 1N8RJ 5H1SO 3DLLJ 5HL7J 3PIOJ 3OW2H 1VQMH 5JVGJ 4WFNJ 1Q82J 2ZJRJ 3CC2H 2OTJH 5JVHJ 1M1KJ 3I56H 1NJIJ 1WKIA 2ZJQJ 1VQ6H 3CCVH 4WFBJ 1VQNH 3CD6H 5GAEN 4WCEJ 5GAGN 3CCSH 4UY8M 1QVGH 3CF5J 5DM7J 3CPWH 2OTLH 3CCMH 3CCQH 1YJNH 1Q86J 1KD1J 1VQ8H 1M90J 4IOAJ 5AN9F 1VQ9H 2PA2A 1K8AJ 1YIJH 1QVFH 1VQLH 5GAHN 3CXCH
chains in the Genus database with same CATH superfamily
4C7YA 3I55H 1QPQA 3AN1A 3WNZA 1VQ7H 5EY3A 2ZJPJ 1QPRA 3GNNA 4WF9J 3H5QA 1AZYA 2QEXH 3FC4A 4ZOHA 2E3TA 4U67J 3G4SH 1VQOH 1YTDA 1V97A 4LHMA 1YTKA 4GA4A 5HULA 4C7ZA 3J7ZM 3CMAH 3PIPJ 1FFVB 3G6EH 1N5XA 1DGJA 3C2RA 4USAA 3WO1A 5GADN 3VMMA 1X1OA 1YTEA 1FIQC 3CCUH 1YI2H 3AMZA 5AYYA 1W2BH 1JJ2H 1VQ5H 2B7QA 1YHQH 1N61B 2DSJA 4XR5A 5MLCO 4IOCJ 1VQPH 4WFAJ 5HUPA 2W55B 5EP8A 1VQ4H 1SB3A 3TQVA 3CC7H 1YITH 3CC4H 3RPFA 3CCRH 3CMEH 1K9MJ 2W54B 3G71H 3ETRC 1K73J 1S72H 4EAFA 5AYZA 1KC8J 1VQKH 3CCEH 1N60B 2B7NA 1YJ9H 3NS1C 1FMAE 3WO0A 3CCLH 4I9AA 1Q81J 3C2OA 2W3RB 2WP4A 2JBMA 3AM9A 1UOUA 2QA4H 1N5WB 5DM6J 3CCJH 1KQSH 1YJWH 4IO9J 1Y69K 1NVJA 1Q7YJ 3NRZC 1N8RJ 5H1SO 3DLLJ 1FFUB 5HL7J 3NVVC 3L4PA 3PIOJ 2B7PA 2W3SB 3BIIE 4YYYA 3C2VA 3OW2H 1VQMH 5JVGJ 4AP8A 4WFNJ 4YEKA 1N63B 2TPTA 1Q82J 3SR6C 2ZJRJ 4GA5A 3CC2H 2OTJH 4US9A 1RM6A 2QIEA 5JVHJ 1M1KJ 1OTPA 3I56H 4KWWA 1NJIJ 1WKIA 3C2EA 2ZJQJ 3CCVH 4WFBJ 1VQ6H 1VQNH 3CD6H 3NVWC 5GAEN 4WCEJ 1FO4A 1WYGA 2WK5A 5GAGN 3FAHA 3CCSH 4UY8M 1QVGH 2I14A 1SIJA 1BRWA 5DM7J 3CF5J 1VDVA 3CPWH 1NVIE 1QPNA 2OTLH 5AYXA 4GA6A 2J0FA 4EADA 3CCMH 5MPOC 3CCQH 1YJNH 1Q86J 1KD1J 1M90J 1VQ8H 4IOAJ 1FM0E 3B9JC 3PAJA 1N62B 5AN9F 1QPOA 2Q5WE 1VQ9H 1QAPA 3EUB4 1VLBA 2PA2A 3NVZC 1O4UA 1JRPB 1JROB 1K8AJ 2OMDA 2WK6A 1YIJH 4US8A 1QVFH 4C80A 1VQLH 3NVYC 3C2FA 5GAHN 5HUOA 4KWVA 2I1OA 1ZXIB 3L0GA 3CXCH 4X46A
chains in the Genus database with same CATH topology
3I55H 1VQ7H 2ZJPJ 4WF9J 2QEXH 4U67J 3G4SH 1VQOH 3J7ZM 3CMAH 3PIPJ 3G6EH 5GADN 3CCUH 1YI2H 1W2BH 1JJ2H 1VQ5H 1YHQH 5MLCO 4IOCJ 1VQPH 4WFAJ 1VQ4H 3CC7H 1YITH 3CC4H 3CCRH 3CMEH 1K9MJ 3G71H 1K73J 1S72H 1KC8J 1VQKH 3CCEH 1YJ9H 3CCLH 1Q81J 2QA4H 3CCJH 5DM6J 1KQSH 1YJWH 4IO9J 1Y69K 1Q7YJ 1N8RJ 5H1SO 3DLLJ 5HL7J 3PIOJ 3OW2H 1VQMH 5JVGJ 4WFNJ 1Q82J 2ZJRJ 3CC2H 2OTJH 5JVHJ 1M1KJ 3I56H 1NJIJ 1WKIA 2ZJQJ 1VQ6H 3CCVH 4WFBJ 1VQNH 3CD6H 5GAEN 4WCEJ 5GAGN 3CCSH 4UY8M 1QVGH 3CF5J 5DM7J 3CPWH 2OTLH 3CCMH 3CCQH 1YJNH 1Q86J 1KD1J 1VQ8H 1M90J 4IOAJ 5AN9F 1VQ9H 2PA2A 1K8AJ 1YIJH 1QVFH 1VQLH 5GAHN 3CXCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 H;  1VQ7 H;  2ZJP J;  4WF9 J;  2QEX H;  4U67 J;  3G4S H;  1VQO H;  3J7Z M;  3CMA H;  3PIP J;  3G6E H;  5GAD N;  3CCU H;  1YI2 H;  1W2B H;  1JJ2 H;  1VQ5 H;  1YHQ H;  5MLC O;  4IOC J;  1VQP H;  4WFA J;  1VQ4 H;  3CC7 H;  1YIT H;  3CC4 H;  3CCR H;  3CME H;  1K9M J;  3G71 H;  1K73 J;  1S72 H;  1KC8 J;  1VQK H;  3CCE H;  1YJ9 H;  3CCL H;  1Q81 J;  2QA4 H;  3CCJ H;  5DM6 J;  1KQS H;  1YJW H;  4IO9 J;  1Y69 K;  1Q7Y J;  1N8R J;  5H1S O;  3DLL J;  5HL7 J;  3PIO J;  3OW2 H;  1VQM H;  5JVG J;  4WFN J;  1Q82 J;  2ZJR J;  3CC2 H;  2OTJ H;  5JVH J;  1M1K J;  3I56 H;  1NJI J;  1WKI A;  2ZJQ J;  1VQ6 H;  3CCV H;  4WFB J;  1VQN H;  3CD6 H;  5GAE N;  4WCE J;  5GAG N;  3CCS H;  4UY8 M;  1QVG H;  3CF5 J;  5DM7 J;  3CPW H;  2OTL H;  3CCM H;  3CCQ H;  1YJN H;  1Q86 J;  1KD1 J;  1VQ8 H;  1M90 J;  4IOA J;  5AN9 F;  1VQ9 H;  2PA2 A;  1K8A J;  1YIJ H;  1QVF H;  1VQL H;  5GAH N;  3CXC H; 
#chains in the Genus database with same CATH topology
 4C7Y A;  3I55 H;  1QPQ A;  3AN1 A;  3WNZ A;  1VQ7 H;  5EY3 A;  2ZJP J;  1QPR A;  3GNN A;  4WF9 J;  3H5Q A;  1AZY A;  2QEX H;  3FC4 A;  4ZOH A;  2E3T A;  4U67 J;  3G4S H;  1VQO H;  1YTD A;  1V97 A;  4LHM A;  1YTK A;  4GA4 A;  5HUL A;  4C7Z A;  3J7Z M;  3CMA H;  3PIP J;  1FFV B;  3G6E H;  1N5X A;  1DGJ A;  3C2R A;  4USA A;  3WO1 A;  5GAD N;  3VMM A;  1X1O A;  1YTE A;  1FIQ C;  3CCU H;  1YI2 H;  3AMZ A;  5AYY A;  1W2B H;  1JJ2 H;  1VQ5 H;  2B7Q A;  1YHQ H;  1N61 B;  2DSJ A;  4XR5 A;  5MLC O;  4IOC J;  1VQP H;  4WFA J;  5HUP A;  2W55 B;  5EP8 A;  1VQ4 H;  1SB3 A;  3TQV A;  3CC7 H;  1YIT H;  3CC4 H;  3RPF A;  3CCR H;  3CME H;  1K9M J;  2W54 B;  3G71 H;  3ETR C;  1K73 J;  1S72 H;  4EAF A;  5AYZ A;  1KC8 J;  1VQK H;  3CCE H;  1N60 B;  2B7N A;  1YJ9 H;  3NS1 C;  1FMA E;  3WO0 A;  3CCL H;  4I9A A;  1Q81 J;  3C2O A;  2W3R B;  2WP4 A;  2JBM A;  3AM9 A;  1UOU A;  2QA4 H;  1N5W B;  5DM6 J;  3CCJ H;  1KQS H;  1YJW H;  4IO9 J;  1Y69 K;  1NVJ A;  1Q7Y J;  3NRZ C;  1N8R J;  5H1S O;  3DLL J;  1FFU B;  5HL7 J;  3NVV C;  3L4P A;  3PIO J;  2B7P A;  2W3S B;  3BII E;  4YYY A;  3C2V A;  3OW2 H;  1VQM H;  5JVG J;  4AP8 A;  4WFN J;  4YEK A;  1N63 B;  2TPT A;  1Q82 J;  3SR6 C;  2ZJR J;  4GA5 A;  3CC2 H;  2OTJ H;  4US9 A;  1RM6 A;  2QIE A;  5JVH J;  1M1K J;  1OTP A;  3I56 H;  4KWW A;  1NJI J;  1WKI A;  3C2E A;  2ZJQ J;  3CCV H;  4WFB J;  1VQ6 H;  1VQN H;  3CD6 H;  3NVW C;  5GAE N;  4WCE J;  1FO4 A;  1WYG A;  2WK5 A;  5GAG N;  3FAH A;  3CCS H;  4UY8 M;  1QVG H;  2I14 A;  1SIJ A;  1BRW A;  5DM7 J;  3CF5 J;  1VDV A;  3CPW H;  1NVI E;  1QPN A;  2OTL H;  5AYX A;  4GA6 A;  2J0F A;  4EAD A;  3CCM H;  5MPO C;  3CCQ H;  1YJN H;  1Q86 J;  1KD1 J;  1M90 J;  1VQ8 H;  4IOA J;  1FM0 E;  3B9J C;  3PAJ A;  1N62 B;  5AN9 F;  1QPO A;  2Q5W E;  1VQ9 H;  1QAP A;  3EUB 4;  1VLB A;  2PA2 A;  3NVZ C;  1O4U A;  1JRP B;  1JRO B;  1K8A J;  2OMD A;  2WK6 A;  1YIJ H;  4US8 A;  1QVF H;  4C80 A;  1VQL H;  3NVY C;  3C2F A;  5GAH N;  5HUO A;  4KWV A;  2I1O A;  1ZXI B;  3L0G A;  3CXC H;  4X46 A; 
#chains in the Genus database with same CATH homology
 3I55 H;  1VQ7 H;  2ZJP J;  4WF9 J;  2QEX H;  4U67 J;  3G4S H;  1VQO H;  3J7Z M;  3CMA H;  3PIP J;  3G6E H;  5GAD N;  3CCU H;  1YI2 H;  1W2B H;  1JJ2 H;  1VQ5 H;  1YHQ H;  5MLC O;  4IOC J;  1VQP H;  4WFA J;  1VQ4 H;  3CC7 H;  1YIT H;  3CC4 H;  3CCR H;  3CME H;  1K9M J;  3G71 H;  1K73 J;  1S72 H;  1KC8 J;  1VQK H;  3CCE H;  1YJ9 H;  3CCL H;  1Q81 J;  2QA4 H;  3CCJ H;  5DM6 J;  1KQS H;  1YJW H;  4IO9 J;  1Y69 K;  1Q7Y J;  1N8R J;  5H1S O;  3DLL J;  5HL7 J;  3PIO J;  3OW2 H;  1VQM H;  5JVG J;  4WFN J;  1Q82 J;  2ZJR J;  3CC2 H;  2OTJ H;  5JVH J;  1M1K J;  3I56 H;  1NJI J;  1WKI A;  2ZJQ J;  1VQ6 H;  3CCV H;  4WFB J;  1VQN H;  3CD6 H;  5GAE N;  4WCE J;  5GAG N;  3CCS H;  4UY8 M;  1QVG H;  3CF5 J;  5DM7 J;  3CPW H;  2OTL H;  3CCM H;  3CCQ H;  1YJN H;  1Q86 J;  1KD1 J;  1VQ8 H;  1M90 J;  4IOA J;  5AN9 F;  1VQ9 H;  2PA2 A;  1K8A J;  1YIJ H;  1QVF H;  1VQL H;  5GAH N;  3CXC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...