1KD1M

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 32
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1kd1M02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1kd1M01
1YIJL 3CMAL 3CC4L 3CD6O 3CCUO 1YI2O 1NJIM 1VQNO 3CCSL 1VQKL 1YI2L 3G6EL 1VQOL 3I56L 1M90P 3G71O 3CC2O 1VQMO 1VQ7L 1VQ4O 1Q82M 1KQSN 3CMEO 1VQML 1VQLL 3I55O 1KD1P 1N8RP 1KC8P 1QVFN 1VQ6L 2QA4L 1VQ5L 1W2BK 1S72O 2OTJL 1Q81P 3CXCK 1JJ2K 2OTLL 3CC7O 1M1KP 3CCMO 1K9MP 1M90M 3CD6L 3CCRO 3CCML 3CCUL 1VQNL 1Q86P 1YITO 1KD1M 3OW2N 1N8RM 1KC8M 3CPWK 1Q7YP 2QEXO 1Q81M 3G71L 3CC2L 1VQ9O 1VQ4L 1K9MM 3CMEL 3I55L 1YJWO 1YJNO 1Q86M 1S72L 3CCEO 1K8AP 1VQ8O 3CC7L 1Q7YM 3G4SO 1NJIP 1QVGN 3CCQO 3G4SL 3CCRL 1YHQO 3CCJO 1YITL 3CCJL 1KQSK 3CMAO 2QEXL 3CC4O 1QVFK 1K8AM 1M1KM 1Q82P 1VQ9L 3CCSO 1VQKO 3CXCN 1JJ2N 3G6EO 1VQPO 1K73P 1VQOO 1YJWL 1YJNL 1VQPL 3I56O 3CCEL 1QVGK 3CCLO 1VQ7O 1VQ8L 3OW2K 1VQLO 3CCLL 3CPWN 1YJ9O 3CCQL 1VQ6O 2QA4O 1YHQL 1VQ5O 1YJ9L 2OTJO 3CCVO 1YIJO 1K73M 2OTLO 3CCVL 1W2BN
chains in the Genus database with same CATH superfamily
4XTKA 1YIJL 3CMAL 3CC4L 3CD6O 3CCUO 5FCLA 1YI2O 1NJIM 1VQNO 4P6IC 3CCSL 1VQKL 1YI2L 3G6EL 1VQOL 3I56L 1M90P 3NKDA 3G71O 3CC2O 1VQMO 1VQ7L 1VQ4O 1Q82M 5DLJA 1KQSN 3CMEO 1VQML 1VQLL 3I55O 1KD1P 1N8RP 1KC8P 1QVFN 1VQ6L 2QA4L 1VQ5L 1W2BK 1S72O 2OTJL 1Q81P 4N06A 3CXCK 1JJ2K 2OTLL 3CC7O 1M1KP 3CCMO 1K9MP 1M90M 5DS5A 3CD6L 3CCRO 3CCML 3CCUL 1VQNL 1Q86P 1YITO 1KD1M 3OW2N 1N8RM 1KC8M 3CPWK 1Q7YP 2QEXO 5DQTA 1Q81M 5DQZA 3G71L 3CC2L 1VQ9O 2YZSA 1VQ4L 1K9MM 3CMEL 3I55L 5DS4A 1YJWO 1YJNO 1Q86M 1S72L 3CCEO 1K8AP 1VQ8O 3CC7L 1Q7YM 3G4SO 1NJIP 1QVGN 3CCQO 3G4SL 3CCRL 1YHQO 3CCJO 1YITL 3CCJL 1KQSK 4W8KA 3CMAO 2QEXL 3CC4O 1QVFK 1K8AM 1M1KM 1Q82P 5DS6A 1VQ9L 3CCSO 1VQKO 3CXCN 1JJ2N 3G6EO 1VQPO 1K73P 1VQOO 1YJWL 1YJNL 1VQPL 3I56O 3CCEL 1QVGK 3CCLO 1VQ7O 1VQ8L 3OW2K 1VQLO 3CCLL 3CPWN 1YJ9O 3CCQL 1VQ6O 2QA4O 1YHQL 1VQ5O 1YJ9L 2OTJO 3GODA 3CCVO 1YIJO 1K73M 2OTLO 4QDLA 3CCVL 4WJ0A 1W2BN
chains in the Genus database with same CATH topology
4XTKA 1YIJL 3CMAL 3CC4L 3CD6O 3CCUO 5FCLA 1YI2O 1NJIM 1VQNO 4P6IC 3CCSL 1VQKL 1YI2L 3G6EL 1VQOL 3I56L 1M90P 3NKDA 3G71O 3CC2O 1VQMO 1VQ7L 1VQ4O 1Q82M 5DLJA 1KQSN 3CMEO 1VQML 1VQLL 3I55O 1KD1P 1N8RP 1KC8P 1QVFN 1VQ6L 2QA4L 1VQ5L 1W2BK 1S72O 2OTJL 1Q81P 4N06A 3CXCK 1JJ2K 2OTLL 3CC7O 1M1KP 3CCMO 1K9MP 1M90M 5DS5A 3CD6L 3CCRO 3CCML 3CCUL 1VQNL 1Q86P 1YITO 1KD1M 3OW2N 1N8RM 1KC8M 3CPWK 1Q7YP 2QEXO 5DQTA 1Q81M 5DQZA 3G71L 3CC2L 1VQ9O 2YZSA 1VQ4L 1K9MM 3CMEL 3I55L 5DS4A 1YJWO 1YJNO 1Q86M 1S72L 3CCEO 1K8AP 1VQ8O 3CC7L 1Q7YM 3G4SO 1NJIP 1QVGN 3CCQO 3G4SL 3CCRL 1YHQO 3CCJO 1YITL 3CCJL 1KQSK 4W8KA 3CMAO 2QEXL 3CC4O 1QVFK 1K8AM 1M1KM 1Q82P 5DS6A 1VQ9L 3CCSO 1VQKO 3CXCN 1JJ2N 3G6EO 1VQPO 1K73P 1VQOO 1YJWL 1YJNL 1VQPL 3I56O 3CCEL 1QVGK 3CCLO 1VQ7O 1VQ8L 3OW2K 1VQLO 3CCLL 3CPWN 1YJ9O 3CCQL 1VQ6O 2QA4O 1YHQL 1VQ5O 1YJ9L 2OTJO 3GODA 3CCVO 1YIJO 1K73M 2OTLO 4QDLA 3CCVL 4WJ0A 1W2BN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ L;  3CMA L;  3CC4 L;  3CD6 O;  3CCU O;  1YI2 O;  1NJI M;  1VQN O;  3CCS L;  1VQK L;  1YI2 L;  3G6E L;  1VQO L;  3I56 L;  1M90 P;  3G71 O;  3CC2 O;  1VQM O;  1VQ7 L;  1VQ4 O;  1Q82 M;  1KQS N;  3CME O;  1VQM L;  1VQL L;  3I55 O;  1KD1 P;  1N8R P;  1KC8 P;  1QVF N;  1VQ6 L;  2QA4 L;  1VQ5 L;  1W2B K;  1S72 O;  2OTJ L;  1Q81 P;  3CXC K;  1JJ2 K;  2OTL L;  3CC7 O;  1M1K P;  3CCM O;  1K9M P;  1M90 M;  3CD6 L;  3CCR O;  3CCM L;  3CCU L;  1VQN L;  1Q86 P;  1YIT O;  1KD1 M;  3OW2 N;  1N8R M;  1KC8 M;  3CPW K;  1Q7Y P;  2QEX O;  1Q81 M;  3G71 L;  3CC2 L;  1VQ9 O;  1VQ4 L;  1K9M M;  3CME L;  3I55 L;  1YJW O;  1YJN O;  1Q86 M;  1S72 L;  3CCE O;  1K8A P;  1VQ8 O;  3CC7 L;  1Q7Y M;  3G4S O;  1NJI P;  1QVG N;  3CCQ O;  3G4S L;  3CCR L;  1YHQ O;  3CCJ O;  1YIT L;  3CCJ L;  1KQS K;  3CMA O;  2QEX L;  3CC4 O;  1QVF K;  1K8A M;  1M1K M;  1Q82 P;  1VQ9 L;  3CCS O;  1VQK O;  3CXC N;  1JJ2 N;  3G6E O;  1VQP O;  1K73 P;  1VQO O;  1YJW L;  1YJN L;  1VQP L;  3I56 O;  3CCE L;  1QVG K;  3CCL O;  1VQ7 O;  1VQ8 L;  3OW2 K;  1VQL O;  3CCL L;  3CPW N;  1YJ9 O;  3CCQ L;  1VQ6 O;  2QA4 O;  1YHQ L;  1VQ5 O;  1YJ9 L;  2OTJ O;  3CCV O;  1YIJ O;  1K73 M;  2OTL O;  3CCV L;  1W2B N; 
#chains in the Genus database with same CATH topology
 4XTK A;  1YIJ L;  3CMA L;  3CC4 L;  3CD6 O;  3CCU O;  5FCL A;  1YI2 O;  1NJI M;  1VQN O;  4P6I C;  3CCS L;  1VQK L;  1YI2 L;  3G6E L;  1VQO L;  3I56 L;  1M90 P;  3NKD A;  3G71 O;  3CC2 O;  1VQM O;  1VQ7 L;  1VQ4 O;  1Q82 M;  5DLJ A;  1KQS N;  3CME O;  1VQM L;  1VQL L;  3I55 O;  1KD1 P;  1N8R P;  1KC8 P;  1QVF N;  1VQ6 L;  2QA4 L;  1VQ5 L;  1W2B K;  1S72 O;  2OTJ L;  1Q81 P;  4N06 A;  3CXC K;  1JJ2 K;  2OTL L;  3CC7 O;  1M1K P;  3CCM O;  1K9M P;  1M90 M;  5DS5 A;  3CD6 L;  3CCR O;  3CCM L;  3CCU L;  1VQN L;  1Q86 P;  1YIT O;  1KD1 M;  3OW2 N;  1N8R M;  1KC8 M;  3CPW K;  1Q7Y P;  2QEX O;  5DQT A;  1Q81 M;  5DQZ A;  3G71 L;  3CC2 L;  1VQ9 O;  2YZS A;  1VQ4 L;  1K9M M;  3CME L;  3I55 L;  5DS4 A;  1YJW O;  1YJN O;  1Q86 M;  1S72 L;  3CCE O;  1K8A P;  1VQ8 O;  3CC7 L;  1Q7Y M;  3G4S O;  1NJI P;  1QVG N;  3CCQ O;  3G4S L;  3CCR L;  1YHQ O;  3CCJ O;  1YIT L;  3CCJ L;  1KQS K;  4W8K A;  3CMA O;  2QEX L;  3CC4 O;  1QVF K;  1K8A M;  1M1K M;  1Q82 P;  5DS6 A;  1VQ9 L;  3CCS O;  1VQK O;  3CXC N;  1JJ2 N;  3G6E O;  1VQP O;  1K73 P;  1VQO O;  1YJW L;  1YJN L;  1VQP L;  3I56 O;  3CCE L;  1QVG K;  3CCL O;  1VQ7 O;  1VQ8 L;  3OW2 K;  1VQL O;  3CCL L;  3CPW N;  1YJ9 O;  3CCQ L;  1VQ6 O;  2QA4 O;  1YHQ L;  1VQ5 O;  1YJ9 L;  2OTJ O;  3GOD A;  3CCV O;  1YIJ O;  1K73 M;  2OTL O;  4QDL A;  3CCV L;  4WJ0 A;  1W2B N; 
#chains in the Genus database with same CATH homology
 4XTK A;  1YIJ L;  3CMA L;  3CC4 L;  3CD6 O;  3CCU O;  5FCL A;  1YI2 O;  1NJI M;  1VQN O;  4P6I C;  3CCS L;  1VQK L;  1YI2 L;  3G6E L;  1VQO L;  3I56 L;  1M90 P;  3NKD A;  3G71 O;  3CC2 O;  1VQM O;  1VQ7 L;  1VQ4 O;  1Q82 M;  5DLJ A;  1KQS N;  3CME O;  1VQM L;  1VQL L;  3I55 O;  1KD1 P;  1N8R P;  1KC8 P;  1QVF N;  1VQ6 L;  2QA4 L;  1VQ5 L;  1W2B K;  1S72 O;  2OTJ L;  1Q81 P;  4N06 A;  3CXC K;  1JJ2 K;  2OTL L;  3CC7 O;  1M1K P;  3CCM O;  1K9M P;  1M90 M;  5DS5 A;  3CD6 L;  3CCR O;  3CCM L;  3CCU L;  1VQN L;  1Q86 P;  1YIT O;  1KD1 M;  3OW2 N;  1N8R M;  1KC8 M;  3CPW K;  1Q7Y P;  2QEX O;  5DQT A;  1Q81 M;  5DQZ A;  3G71 L;  3CC2 L;  1VQ9 O;  2YZS A;  1VQ4 L;  1K9M M;  3CME L;  3I55 L;  5DS4 A;  1YJW O;  1YJN O;  1Q86 M;  1S72 L;  3CCE O;  1K8A P;  1VQ8 O;  3CC7 L;  1Q7Y M;  3G4S O;  1NJI P;  1QVG N;  3CCQ O;  3G4S L;  3CCR L;  1YHQ O;  3CCJ O;  1YIT L;  3CCJ L;  1KQS K;  4W8K A;  3CMA O;  2QEX L;  3CC4 O;  1QVF K;  1K8A M;  1M1K M;  1Q82 P;  5DS6 A;  1VQ9 L;  3CCS O;  1VQK O;  3CXC N;  1JJ2 N;  3G6E O;  1VQP O;  1K73 P;  1VQO O;  1YJW L;  1YJN L;  1VQP L;  3I56 O;  3CCE L;  1QVG K;  3CCL O;  1VQ7 O;  1VQ8 L;  3OW2 K;  1VQL O;  3CCL L;  3CPW N;  1YJ9 O;  3CCQ L;  1VQ6 O;  2QA4 O;  1YHQ L;  1VQ5 O;  1YJ9 L;  2OTJ O;  3GOD A;  3CCV O;  1YIJ O;  1K73 M;  2OTL O;  4QDL A;  3CCV L;  4WJ0 A;  1W2B N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...