1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
b'HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
1PNJA 1Z9ZA 1SSHA 1UUEA 2NWMA 4F16A 2HCKA 1GBQA 1CKBA 4HCKA 2LNHB 2W10A 4J9GA 2F2WA 1X43A 1UFFA 3M0RA 2D8JA 3EG2A 3I35A 2A36A 3EG1A 4D8DA 1PRMC 1EFNA 4ESRA 2D1XA 1SEMA 2G6FX 3I5SA 2PZ1A 1AZGB 2QDLA 3IQLA 3GBQA 5IHKA 1UE9A 1NEBA 1UHCA 2KYBA 1WFWA 2KE9A 2V1RA 2KYMA 1JEGA 1X6BA 2DBKA 2RQRA 4AFQC 4F17A 3H0FA 4RTVA 1E7OA 2CDTA 1NLPC 1U3OA 1GCQC 3VS1A 4FSSA 4LNPA 4OMNA 1RI9A 4IIOA 5GJVB 4RUGA 2EVRA 2YT6A 4X1VA 3TVTA 2LCSA 2PNIA 1RLQC 3I5RA 4JJBA 1Y0MA 5IXFA 2KROA 2KGTA 2ESWA 2BZYA 1VYUA 3SHWA 1QLYA 1PKTA 2F2XA 2DE0X 1NYFA 1ZUUA 1AWJA 2EYWA 4HVVA 4M4ZA 4RTTA 3VS6A 3VS4A 4AFZC 1UTIA 2A28A 1WXUA 1UGVA 2F2VA 3FJ5A 1GBRA 1GFDA 1QWEA 1NM7A 2L2PA 4HVWA 2EGAA 4RTUA 4AFSC 2J6FA 2O88A 2SRCA 1OEBA 4RTYA 1AD5A 2DRKA 1BU1A 1IO6A 3R6NA 2GBQA 1VYTA 4RTWA 1WI7A 1T3LA 2JS0A 4JJDA 1PHTA 1WX6A 2FPEA 3EG0A 1M3CA 4JPBW 2BZXA 3VRYA 1YN8A 4J9IA 2KNBB 1PWTA 1OOTA 4OMOA 2JMAA 2CT3A 4J9HA 2FRYA 2D0NA 1HD3A 2L3SA 2J06A 2HEQA 2AKKA 1HJDA 2CUDA 4J9EA 2X3XD 5I11A 2DX1A 4Z8AA 3VS5A 2OAWA 2V1QA 2DL5A 1YWPA 1ARKA 2E5KA 1AWWA 3VS3A 2EYYA 1ABQA 2KRSA 2YUQA 2ROLA 3VS7A 2J05A 1NEGA 2J6KA 2H8HA 2LJ3A 3M0UA 5FW9A 3UA6A 4CC2A 1ZSGA 4D8KA 1XOVA 2VKNA 2DMOA 2RPNA 2CT4A 3QWYA 4AG1C 5IXBA 3VS2A 4KRTA 1ZUYA 2JM9A 1H8KA 1GCQA 4OMLA 3JV3A 2DA9A 2DL7A 2YDLA 2PTKA 5FWBA 2CH4A 1M3BA 1UDLA 2SEMA 3LH5A 4EIKA 4CC7A 5IHIA 1BK2A 1X2QA 3EHRA 2AZVA 4LUDA 2K3BA 4Z88A 2O9VA 1NLOC 4J9FA 2JMCA 3EG3A 1Y57A 3H0HA 4ORZA 1K9AA 4LN2A 1RLPC 3REBB 1X69A 2CSQA 4A63B 1AWOA 1KSWA 1MV3A 2DRMA 2DL4A 5GJWB 1MV0B 2EBPA 3C0CA 1Z9QA 4ZNXA 1WLPB 3CQTA 3EGUA 3SEMA 1UECA 3A98A 1QCFA 2RN8A 4OMQA 2L3QA 1NG2A 2DL8A 2CH4W 4CC4B 2GGRA 5L23A 1KIKA 1QKXA 2LQWA 3M0TA 4JZ4A 2LMJA 4RTXA 2O31A 1M27C 4CC3A 3M0PA 1BBZA 2J6OA 4JJCA 2MIOA 2L3PA 1AZEA 4GLMA 4DEYA 1RUWA 2EYXA 4HXJA 5EC7A 2XMFA 3H41A 4K11A 2MOXA 2FEIA 5HCKA 2CREA 2P4RA 1K0SA 1I0CA 2L0AA 1N5ZA 1SHFA 3THKA 1FYNA 1ZBJA 4RTZA 1UJYA 1PRLC 1GCPA 2J7IA 2DJQA 5IH2A 1JO8A 2DNUA 2KXDA 2A37A 2FPFA 2K9GA 1JXOA 4JZ3A 3M0SA 1AOJA 1AWXA 1OV3A 2YUNA 4OMPA 1KJWA 4F14A 1X2KA 1SRLA 2LZ6B 1AEYA 2KR3A 1T0JA 3PE0A 4HVUA 2M0YA 2BTTA 2EW3A 4AFUC 3NHNA 1ZX6A 1VYVA 4J9BA 3TSWA 4Z89A 1W70A 1V1CA 2KEAA 2ABLA 2DILA 1KFZA 4OMMA 1U06A 2KXCA 2MCNA 1B07A 2JS2A 2RNAA 2RF0A 2RMOA 2I0NA 1G83A 1TUDA 2RQTA 1TG0A 2M51A 1GFCA 2DL3A 2GQIA 1I1JA 5FWCA 1HSQA 2JT4A 2K7AA 2JXBA 2HSPA 2DYBA 2BZ8A 2VWFA 3RBBB 2A08A 1AVZC 2X3WD 4DEXA 2EKHA 2OI3A 2DM1A 2ENMA 2FRWA 4R0KA 2NUZA 1PKSA 1X6GA 2O2OA 1CKAA 2LX7A 1OPKA 2CSIA 3NMZC 2FO0A 1GRIA 2KT8A 1A0NB 4LE9A 2JW4A 4GBQA 2D8HA 2AZSA 2HDAA 1WIEA 1B3QA 1ZLMA 3QWXX 2C0IA 4E6RA 3ULRB 1YCSB 3I9QA 1UG1A 1YWOA 3PVLA 2ED1A 1JXMA 4J9DA 1ZUKA 2KRNA 3UA7A 3UF4A 4IIMA 1QWFA 2KT1A 1M8MA 3UATA 1WXTA 4Y92A 2AK5A 3RNJA 1CSKA 1BB9A 2K79A 5ECAA 1YP5A 2IIMA 3H0IA 3PVQA 1SPKA 3EHQA 1GL5A 1W1FA 3KFVA 2GTOA 2VVKA 1UHFA 1H92A 3U23A 1NYGA 1K0XA 1ABOA 2KRMA 2HBWA 4LUEA 3TSZA 2RQVA 3O5ZA 2OJ2A 5I22A 2FG0A 2EGEA 1H3HA 2EQIA 1K76A 2B86A 1E6HA 1FMKA 1W6XA 1J3TA 2C0TA 1JU5C 1T3SA 1G2BA 2LP5A 2JM8A 2LJ0A 1TUCA 2EPDA 1WDXA 1YNZA 2DVJA 2RQUA 2YSQA 2ROTA 2DF6A 5IHNA 1M3AA 1K1ZA 1QKWA 1E6GA 1X27A 4J9CA 4WCIA 1U5SA 2W0ZA 2K6DA 3VRZA 1K4US 3ZL7C 2DLPA 2CUBA 1S1NA 1SRMA 2ED0A 2LQNA 4AG2C 2EGCA 1T0HA 3NPFA 1VA7A 1M30A 2GTJA 2RQWA 1LCKA 2KBTA 1UJ0A 2EYZA 1SHGA 2FPDA 1I07A 4QT7A 2K2MA 2LJ1A 3VS0A 1WA7A 2O9SA 1OPLA 2JTEA 3NGPA 2ECZA 2GNCA 1JQQA 2YUPA 2C0OA 2DBMA 3M0QA 1MUZA 3REAB 2YUOA 1WYXA 2AKLA 1WXBA
chains in the Genus database with same CATH superfamily
2LNVA 2LQKA 3CC4A 3QBYA 3JB9G 1GBQA 2LNHB 1VQ5Q 2W10A 1RAGB 3RR6A 1B34B 1B7TA 2GFUA 2JTMA 1K73C 1BYMA 2XICA 2DKGA 1TS9A 3BY7A 5CO7A 3EG1A 4D8DA 1EFNA 2D1XA 2QG9B 2QAZA 3IQLA 4LDUA 3QZ9B 1NEBA 2RQRA 1VQLA 1PC0A 5GAOn 4AFQC 4BD3A 4IUPA 3A1PA 4IURA 5EG2A 1YI2A 4HCBA 1UEBA 4C92E 3BDUA 3JB9H 1E7OA 3CCLA 1U3OA 1VUBA 2CP6A 2NUTA 5CKBA 4RUGA 2EVRA 2YT6A 4XTVA 5A2QE 3BFMA 1RLQC 2L3RA 3I5RA 4J5YA 1N27A 2QDYB 1XQHA 3CCUA 1VQ4Q 2ESWA 3OBWA 4XTYA 3MHXA 3PGGA 5GANf 4UC4A 3MP1A 3MCAB 3OYYA 2EYWA 2DXBA 4HVVA 3OYDA 4HCCA 4A54A 1TSFA 2QXFA 3VS4A 3JAME 3QXEB 1D09B 4RG8A 4X34A 5IT9E 2A28A 2F2VA 1MMDA 4M7AE 3VKIA 1NM7A 2DTOA 4HVWA 2EGAA 4OB2B 4RKUE 1D1BA 3CCJQ 5A0GA 2J6FA 5CAIA 4WTOB 2RB6A 3QYHB 3E9FA 3OW2S 1IO6A 1QQJA 1GXIE 1VYTA 4F7UF 3L2VA 2JS0A 4C92G 4JJDA 2FPEA 4QW2A 2E6NA 3ME9A 2BUDA 5FLXE 2FRYA 4BY6B 4FT4A 2J06A 2LCCA 4WF2A 2Y4YA 2DXUA 1Q7YR 3VS5A 3HL8A 2CYZB 2DZCA 3KBGA 1NJIU 1VQPA 1YWPA 1ARKA 2E5KA 3OS5A 3X24B 2CZ0B 1IREB 2YUQA 2DEUA 4M7DF 2J05A 1RADB 2H8HA 1IHWA 1WHGA 2NUPB 4M7AG 1I81A 1ZSGA 5FRNA 3EFRA 1XOVA 3M55A 3LGFA 2XIDA 1LNXA 3HRTA 1VQ6T 1VQ9Q 4KRTA 1KC8U 1H8KA 1C1AA 4FM4B 3G71A 1WQ7A 5KYXA 3KXTA 3G7ZA 2E3HA 1VQMA 2PTKA 5GMKj 1UDLA 3LH5A 1X01A 2M0OA 3JCMh 1BK2A 3EHRA 2AZVA 5KYUA 3DB3A 3OMCA 4Z88A 1G8XA 4O5VA 4ORZA 1K9AA 1RLPC 2GCXA 2BKDN 2F5KA 2YXYA 4X9DA 1VQ7Q 1MV3A 3ER0A 2MK5A 4JRQA 4ZNXA 1VQ8Q 3JCMb 1WLPB 3SEMA 4ZGDB 1PD1A 1ZSZB 2EJGA 4JRKA 7AT1B 1QCFA 2EAYA 1RAEB 4OMQA 3OYMA 2YLCA 1NG2A 1B34A 2HNIA 2VXEA 3MO8A 1Q82C 4CC4B 3EGXB 1QKXA 2LQWA 2RI3A 5KCOA 2QQAA 3QO3A 3OY9A 2DFUA 4CC3A 3M0PA 3CCQQ 4N4HA 1BBZA 2J6OA 5J26A 2MIOA 4JS5A 1IGQA 2EKOA 2EJFA 1PSEA 4C92B 4DOVA 3CCMA 1KG1A 3G4SA 3FRNA 2PVOB 1RI0A 2D9TA 2MOXA 1U1TA 1KQ1A 3PNWC 1K0SA 4PJNA 1QVGP 2RA2A 3THKA 3FC3A 1ZA2B 1PRLC 2DEQA 1TOVA 1OU9A 1JO8A 3JCMV 3AHUA 2K9GA 2K2VA 1KQSP 4OP0A 2QQBA 2RHXA 3CPFA 1AOJA 3QDRB 1OV3A 3JB9D 3SWNB 1KJWA 2A0FB 2XU8A 2KR3A 1M2VB 4J6XA 3OQ5A 3EH1A 4XK8E 2RO0A 1YJ9A 1JJ2P 1MMAA 4AFUC 2EQJA 2E64A 3RIRA 1SG5A 3H6ZA 3E19A 2DILA 3JCMc 4JS4A 2MYSA 4XU3A 1B07A 2JS2A 2JJ9A 4BDYA 5GAN5 2JNGA 2GFAA 3RKWA 3VU3C 3CMEA 1C0MA 3CMAA 4XTUA 3CCVT 1U8RA 4A4EA 1TG0A 5GAMe 2RD1A 2DTHA 1GFCA 3URGA 1LJOA 2GQIA 2EWNA 3V8JA 3JCMQ 2OTJA 3CXCA 1HSQA 2JT4A 2PUOB 2HSPA 2VWFA 1WHKA 2MWPA 5LJ3e 2A08A 2PQWA 3HP9A 5GAOl 5I2MA 4N4GA 2O2OA 1Q7YU 2GQVA 2KT8A 4LE9A 3C12A 2QYZA 1YITT 4HT9A 2NUPA 2D8HA 2AZSA 1ZBXA 1B3QA 4FCYA 2QA4T 2C0IA 4C5EA 3SD4A 2JTFA 3EG9B 3FEOA 1YCSB 1YJWT 4M7DC 1UG1A 1JXMA 3FDRA 1UGQB 2KT1A 1M8MA 4C92D 4FIBA 2K79A 5ECAA 2IIMA 3EHQA 2K5FA 2LC4A 5HKCA 3QUIA 3LGLA 1H92A 2FZCB 1YIJA 3RDVA 2KRMA 1XJWB 1NJIC 2DYIA 4QVZA 3A8HB 1H3HA 1VQNQ 2RHUA 5LJ5e 1YJNT 3MPUB 2LP5A 1PSFA 3CC7A 1ZSZA 3HRSA 3CCET 2QTXA 5M9OA 2V26A 4M7AD 2RQUA 2ROTA 2DF6A 4C5HA 2BE9B 1KC8C 2W0ZA 1K4US 3ZL7C 2DLPA 3V7CA 1RL2A 3HRUA 1SRMA 3V7RA 3L2RA 4ME7A 2VC8A 3WXMB 3NPFA 1N6AA 2F69A 1VA7A 1M30A 4FL6A 3VJPA 4XQ3A 4F7UA 2DZ9A 4XTWA 4MDXA 1LCKA 1KQSS 3NFCA 3T9NA 2FPDA 3G6ET 3UWNA 1QVFP 5KE2A 2GNCA 1JQQA 2YUPA 3OYFA 1OU8A 5CKFA 4IKFA 1Q81R 1JJ2S 3QDFA 1VQOQ 3GLXA 3CCRT 2DETA 2DVEA 4F16A 2YRCA 2MI6A 3I55A 4XTXA 1M2VA 2B8AA 2K3YA 1SF9A 2RJFA 1UFFA 1VQ4A 5AT1B 3M0RA 3EG2A 2QASA 3I35A 2A36A 3CCST 1IXDA 4M78E 1X6OA 1SEMA 4PK4A 3S3NA 2G6FX 2LVMA 1M2OA 3M56A 5IHKA 1UHCA 2QQRA 2V1RA 1YHQA 2DBKA 3HKSA 3C95A 4AMCA 1WQWA 4P5NA 2JN0A 1I8FA 4KUIA 4C0ZA 4F17A 5FU6B 5D6WA 3H0FA 2PVDB 2CDTA 3TCJA 3VS1A 2BE7D 4OMNA 2XK0A 4D6WA 5GJVB 4DOWA 3CD6T 5FU7C 3SB2A 3TVTA 3CCVQ 2DXTA 2NLUA 4M75E 1UGSB 4JJBA 1G3TA 2KROA 2LRQA 2WSEE 5IAYA 2DE0X 1KHIA 4M4ZA 4LD6A 1ACMB 3VS6A 5GMKl 3OYLA 4PJOE 2FZKB 3PT9A 1WXUA 5GMKi 1GFDA 4XAXB 3EG9A 1YITQ 4HA8A 4AFSC 2SRCA 4J83A 1K9MR 2DRKA 1QVGA 2JOYA 1N8RR 1WI7A 1WYXA 1VQ9A 1BCMA 2HKQB 5GAOr 3OMGA 3A8GB 1QP2A 4J9IA 2R5MA 2KNBB 4C8QE 5GAOp 2OTLA 1KQSA 4FU6A 4J9HA 1WJQA 4M75G 3OYHA 5GAMg 4J9EA 2E6ZA 3MEAA 5GANh 5I11A 2DX1A 1Q7YC 4IUVA 2OAWA 2X4JA 3FIFA 1JJ2A 1AWWA 1O9SA 2EYYA 1ABQA 5LJ3g 3VS7A 1NEGA 2C06A 4PJOG 5FW9A 3X28B 2H3EB 3JB9F 3CXCP 4D8KA 2DIGA 3CCEQ 5CKEA 1KD1R 3QWYA 5DY9A 3OA6A 3VS2A 1QVFS 4JLIA 2JM9A 5KYYB 3CC4T 3O8VA 4OMLA 2LT4A 3CCQA 1EIFA 1WGSA 3JV3A 2YDLA 3MEUA 1G3WA 2X9HA 4CC7A 5IHIA 4CI0C 2DIQA 1I4K1 1QCNA 3DKMA 2FB7A 2V8JA 4J9FA 2JMCA 3EG3A 3GOXA 3EGDA 3BW1A 1QVPA 2L89A 1EX4A 1M8VA 3REBB 2X4XA 1AWOA 1M90R 1D3BB 2DL4A 1VQLT 1MV0B 1Z9QA 1M9SA 3CQTA 5GMKh 1YI2T 3TREA 4JUVA 1UECA 1Q81U 3CCLT 5LJ5g 4E7ZA 1NPPA 4PNOA 5J39A 1R77A 1KIKA 1JB0E 3M0TA 2QK0A 4JZ4A 2LMJA 1MGQA 3OYNA 3VYGA 3E1SA 3CCUT 2AIRB 2QEXA 3CC2T 1OZ3A 2L3PA 5GAMd 4C5IA 3E2UA 1AZEA 4DEYA 1VOMA 4M77E 5EC7A 3HSBA 2XMFA 3H41A 4K11A 4HKEA 2FEIA 1N9RA 2K4YA 5LJ3d 2P4RA 2LX9A 4C92F 2KDSA 5KYNA 5GANj 2L0AA 3OYAA 3V7SA 4M75B 4JJNK 2AT1B 1UJYA 3VV0A 1MHNA 1LOJA 3PFSA 2KXDA 2A37A 2FPFA 2R5AA 3DLLA 4ANJA 3J7AF 3CBPA 1AWXA 3CD6Q 4NL3A 2D0QB 1G5VA 1X2KA 1SRLA 2CS7A 4PJOB 1AEYA 1W4SA 1P92A 3L42A 5GAN4 8ATCB 4C5GA 2O4XB 3UDCA 3LWHA 4QQ6A 4RG2A 3OBYA 3NHNA 3ZEHA 4M7AF 1TUGB 4EMKB 1VYVA 2X51A 1V1CA 2MWOA 2ABLA 4M77G 4A4FA 4FT2A 1VQPT 1KFZA 4OMMA 1YCYA 2JUFA 2MCNA 3S6WA 3VUZA 1QVFA 2COWA 4ZTFA 4L59A 2PVGB 1S72Q 4E7SA 5FRMA 2RF0A 5CKDA 3JB9I 1OZ2A 2K5IA 1K9MU 1WZOA 5LJ5d 2RQTA 1N8RU 2M51A 2DL3A 1I1JA 1UGPB 3VUBA 2IG0A 2K7AA 1IZ6A 3G71T 2BZ8A 3CXCS 4KGZB 1YBYA 1AT1B 1VQMT 1XNIA 2OI3A 2FRWA 4R0KA 1G3YA 3WVEB 2YWWA 2ZGWA 3OS1A 2NUZA 1X6GA 1VQNA 4M78D 4E7LA 1OPKA 2HL3A 2F1LA 2X35A 2FO0A 4FW2A 2RK1A 4Y91A 2FHDA 5J3BA 1RAHB 4BY6C 3ULRB 4FW1A 4YTLA 3PVLA 2ED1A 1WHLA 1ZUKA 4L5GA 5CQYA 1D1AA 5GAMf 4LDXA 4OGCA 1QWFA 3UATA 2AK5A 3RNJA 2E3IA 3X26B 3PVQA 1WJRA 3N5BB 3V8LA 1W1FA 2CP5A 3QIIA 2MF2A 2VVKA 3CC4Q 5LJ3f 1K0XA 2P0QA 2KK4A 4M75D 3TSZA 3OYBA 2QI2A 2OJ2A 5I22A 2MAMA 5C0MA 2FG0A 4BE2A 2EGEA 3E9GA 4MZMA 3CCMT 2NYSA 2DO3A 2Y4XA 4MMLA 3G4ST 5CR2A 1D3BA 1T3SA 3CEYA 4PJOD 3C94A 2LJ0A 1TUCA 4PJLA 5LJ3j 3M54A 1VQLQ 2DVJA 1VQOA 2ZPEB 4ATOA 1ZHIA 2ZPGB 1K1ZA 1E6GA 4J9CA 1YI2Q 1U5SA 3SFMA 5HK0A 1LVKA 3CCLQ 4M77B 4M7AB 2FVUA 2YHTA 4OF1A 2E65A 2K57A 5GAN6 2ATCB 1WHJA 2GTJA 4C8QD 1ZSZC 1R0CB 2RH2A 2L5QA 1YJ9T 3CC2Q 2KBTA 1UJ0A 4JRIA 4QT7A 1BCOA 5LJ5f 1OPLA 4M75A 4ELYC 2C0OA 2DBMA 3M0QA 1MUZA 2YUOA 3QZ5B 4QVCA 1Q81C 2BIVA 2PUKB 4C92C 1PNJA 5KYWB 3CMET 3CCVA 3CMAT 1UGRB 3I56A 2F2WA 1WHHA 5D7UA 5LJ5j 2OTJT 2D8JA 4DQ2A 2XI9A 3LX7A 2CP7A 4PJMA 2KVQG 2CZ1B 4KGXB 3P8BB 3GBQA 1BI1A 4E47A 2DAQA 3SWNC 2RK2A 2KYBA 2VYTA 1WFWA 2KE9A 2KYMA 1MMNA 4M77C 4M7AC 1D0YA 1X75C 3LYIA 1VQPQ 2VASA 2WACA 3P8HA 3OYGA 4EPCA 3RESA 1NLPC 3JCMX 1GCQC 4FSSA 4Q5WA 1VQ6Q 4X1VA 2LCSA 2KI7A 2PNIA 1Q95G 1Q82R 2EQUA 4E7HA 1N9SA 1Y0MA 3JCMe 3G71Q 1PKTA 1TH7A 2F2XA 1NYFA 2CKKA 1ZUUA 4OVAA 4QQDA 1AWJA 1YIJT 2VUBA 1VQKA 1VQMQ 5DM7R 4EMGA 3GNGA 1KQ2A 4AFZC 1UTIA 1GBRA 1UGVA 2V8IA 4QQGA 4M77D 3JCMP 4RTUA 2HZYA 4KULA 3OS0A 3P8DA 3QPHA 1OEBA 3EGXA 3CC7T 1BU1A 1K9MC 5D6XA 3R6NA 4F04B 2EJ9A 1TWBA 2A7YA 4RTWA 1VQ5A 1N8RC 1IRXA 1PHTA 1WX6A 4XU2A 1QVGS 1OQKA 2BZXA 3VRYA 1OOTA 4XTZA 4C92A 4KH1B 2D0NA 1HD3A 2L3SA 3VYHB 2A3LA 2V1QA 2DL5A 2E4HA 3VS3A 4PFZA 3CCMQ 3G4SQ 2HQXA 3M0UA 2RI5A 3UA6A 4KT0E 4CC2A 2E41A 3M57A 3SWNA 2RPNA 4KH0B 4M77A 4AG1C 4M7AA 3RERA 3PIPA 1ZUYA 3I55T 1GCQA 1DJ7B 2DA9A 2DL7A 2E1HA 9ATCB 2SEMA 1X2QA 2K3BA 3CCJA 2MPXC 1YJ9Q 2FL7A 1D0ZA 3SDZA 1YHQT 4A63B 1KSWA 2QGFB 5GJWB 3RUXA 5KE3A 2EBPA 3C0CA 4KUDK 2XDDA 3EGUA 4BE0A 2HQHA 3A98A 2RJDA 5CVIA 2RN8A 2M1HA 2HD0A 1TU0B 2DL8A 1V29B 4J7IA 3CMAQ 3GNFB 2P4TA 4M78F 5C6SA 2O31A 3NTHA 1M27C 3MP6A 2RM4A 4M78G 4JJCA 4GLMA 1XTDA 2HKNA 4HXJA 1PD0A 3HPWA 5HCKA 3GP8A 4A4HA 2QA4Q 2K3XA 3M58A 1N5ZA 1SHFA 1YJWQ 1FYNA 5LL6S 1S72A 5L8RE 1GCPA 2J7IA 4ZN1A 2DJQA 1HYOA 5IH2A 2HMAA 2DNUA 5GAN2 3CBMA 4M75F 2IPOB 4ZGJB 1R0BG 3QKJA 2YUNA 5CCAA 2LZ6B 3FB9A 2OTLT 4E2FB 3PMIA 5FU6C 2VB6A 2XDPA 4HVUA 1C6VX 1Q82U 2LQ8A 2M0YA 1TXQA 1BI3A 2BTTA 4PJOF 3D7SB 4II1A 1YIJQ 4GLKA 2QQ9A 4BUGA 1OI1A 3M9QA 1VQ7A 1W70A 1YJNQ 2KEAA 1VQ8A 1QW1A 1U06A 2KXCA 4PKCC 5I21A 3TU4K 3KUFA 2RJCA 2RNAA 1M1KR 2RMOA 2I0NA 4NOYA 3CC7Q 4C8QF 5FWCA 4E7KA 3DB4A 4C8QG 2JXBA 2V8KA 2GF7A 4BI8B 4A53A 4BDZA 4V2SA 1M1FA 2ZAEA 5CIUA 3CCQT 1AVZC 1OX8A 2K5LA 2DM1A 1U1SA 5I2SA 3X25B 2ZPBB 3G6EQ 1PKSA 3HFNA 1QP3A 2LX7A 5A0DA 3GPLA 3OB9A 4FSXA 3NMZC 4JLGA 4DBQA 1A0NB 5IN1A 2VGMA 3L1AA 2JW4A 4GBQA 3JCMg 2HSEB 2KY9A 1WIEA 1QCOA 2RJEA 5GAN7 3QWXX 4E6RA 1K8AR 5KCHA 3FLGA 4M78B 2AHJB 3CCRQ 2KSSA 1QMCA 6AT1B 3JCMJ 1FMVA 4IUQA 3UF4A 4NS5A 4F7UE 3PMTA 4JDSA 4Y92A 1CSKA 1BB9A 3CPWA 2CGHA 1FWZA 1YP5A 3H0IA 3META 3I55Q 3CCSQ 2LDMA 3UT1A 2GTOA 1UHFA 4Y28E 1IB8A 1TTHB 3U23A 2ZPIB 4N0AC 2HBWA 4DBFA 3RMQA 1MNDA 3CC2A 3O5ZA 1Y96B 2QEXT 1LPLA 2DPPB 1K76A 3M5AA 1J3TA 1FX7A 3J80E 4KGVB 4FYWB 4RCCA 2YLBA 1G2BA 3EFOB 2ZPHB 3RMSA 2JM8A 4M7DE 1VIFA 3BDLA 4DBHA 4C0DB 1YHQQ 2D6FA 2EPDA 4RMOA 3J81E 5GAN8 1YNZA 2YSQA 2PU9B 1M3AA 4WCIA 4ELZC 4E7IA 2YRDA 3AT1B 4QKUA 1UB4A 5D6YA 2K6DA 3VRZA 5GAMh 2ED0A 1ZA1B 4F7UG 3L2WA 2EGCA 1T0HA 3MP8A 2RQWA 4M77F 1MNEA 5LJ3h 4M78C 2DXCA 4AT1B 4Z02A 3BE3A 4NL2A 2EYZA 1SHGA 1YFNA 1W2BA 1I07A 3M53A 3MJXA 3JCMW 4C8QB 3VS0A 1WA7A 2O9SA 3QG1A 3NGPA 2JTEA 3JCMd 1AHJB 1PM3A 3PTAA 1Q86R 4LXCA 2AKLA 1WXBA 1Z9ZA 4M7DG 2ZPFB 1SSHA 1UUEA 2E70A 3G1JA 1SSFA 2NWMA 1D0XA 4FYXB 1VQ6A 3QSUA 4IUTA 2HCKA 2RI2A 1CKBA 4HCKA 3WVDB 4J9GA 1K73R 1X43A 1F1BB 4M75C 2L8DA 1R8OB 2OTLQ 1PRMC 3QJ6A 4ESRA 5GANe 3I5SA 4C0DC 2PZ1A 1AZGB 2QDLA 2CP0A 1BIBA 1UE9A 4PJOC 1VQNT 1JEGA 4N0AA 1X6BA 4J6YA 4B9WA 2KMTA 5LJ5h 3QJYA 3X20B 5KYYA 2I2LA 4RTVA 3R6OA 3HTRA 1KD1U 4LNPA 1RI9A 1M1KU 4IIOA 1O75A 4EMKC 2RHZA 2RHIA 2RHYA 1WPYA 4DA4A 4C8QC 3MKDA 5IXFA 2KGTA 3TEEA 3QHSA 2BZYA 4OGEA 4R55A 1JBMA 1VYUA 3SHWA 2LT1A 1QLYA 5GAMj 4RTTA 2E5QA 1WHMA 4GY5A 3FJ5A 1QWEA 2EFIA 2L2PA 4M78A 4F7UB 1M90U 3OW2A 2LTOA 2O88A 2WSFE 4EDUA 5GMKe 4RTYA 1AD5A 1K8AU 2GBQA 1VQOT 1T3LA 4BB7A 3F70A 3EG0A 1M3CA 4JPBW 1YN8A 3OS2A 1PWTA 4OMOA 1NZ9A 2JMAA 2DD5A 2CT3A 4LDVA 3JB9J 2P84A 3CCUQ 4ZTJA 1Y71A 1Y96A 2QQSA 3JCMf 2HEQA 2AKKA 1HJDA 1OX9A 2CUDA 4M7DB 4TVRA 4E7JA 2X3XD 4Z8AA 2QEXQ 4J8OA 3L2QA 4LD9K 2XDBA 3EFOA 4BE1A 3OSSC 3A8OB 2KRSA 2ROLA 2J6KA 2LJ3A 5DLOA 2QGGA 3S3OA 1IHVA 4ZGEB 2VKNA 4HCZA 4PJOA 2M9UA 2DMOA 2HQEA 2CT4A 5GAN3 5IXBA 2O4XA 1NPRA 2XKOC 3I56T 4MMKA 1VIEA 1PG5B 4EMKA 2MMPA 3LLRA 5FWBA 5GAOm 4PLIA 1H3ZA 2CH4A 1M3BA 4EIKA 3L2UA 5KH6A 3ZBDA 3GF5A 2XHCA 4LUDA 1BI0A 4C8QA 4J6WA 1OYXA 2P0PA 2Z0WA 4XU0A 2O9VA 2VGNA 1NLOC 1YITA 4FYVB 1Y57A 2LCLA 3H0HA 4LN2A 8AT1B 1IGUA 4DBRA 2QA4A 3EFSA 4C0GA 1X69A 2CSQA 5AYFA 1H641 1YJWA 3CPWP 2CP2A 2DRMA 3M4GA 3OYKA 1D1CA 4PJJA 3OSVA 2QTVA 1Q86U 1G3SA 4N4IA 2L3QA 2CH4W 2R58A 2GGRA 2CZ7B 3ASKA 5L23A 1SKUB 4RTXA 1K73U 4PFPA 4B6MA 2P0KA 2EYQA 3OYJA 1RUWA 3CBOA 4L6V5 3RKXA 2DK3A 2EYXA 4OB3B 1RABB 1VQKT 2CP3A 1YJNA 2CREA 3LH0A 3M59A 1I0CA 3MEWA 3CCEA 1M1GA 1ZBJA 4RTZA 2OX7A 4M7DD 1JXOA 2COZA 1HXDA 2VV5A 2Y90A 4JZ3A 1VQ5T 3M0SA 4OB0B 4JRPA 4OMPA 4F14A 4A4GA 1W2BP 1T0JA 1RAIB 1Y07A 3PE0A 2WSCE 3Q1JA 2KQWA 3LWIA 2EW3A 3OYIA 2HL5C 3G6EA 1ZX6A 2XG8D 4J9BA 3TSWA 4VUBA 5DLQE 4Z89A 4R56A 1I5OB 4QVDA 5FU7B 3JSCA 2G3RA 5GANg 2EQMA 2CZ6B 1HK9A 1I5LA 2M16A 1KK7A 2ZCFB 1KD1C 2DJZA 3CCRA 4J7FA 2O01E 3EGDB 3C4SA 1M1KC 1BKBA 1G83A 4FYYB 1TUDA 1PCXA 4EMHA 1JRIA 3NTKA 2OAUA 2YRVA 4HT8A 2NUTB 1EZZB 3H8ZA 4PLLA 4C0FA 1VQ4T 3OYCA 3CCSA 2F5TX 4IUUA 2DYBA 4M7DA 3RBBB 1MMGA 4BI3A 2X3WD 4DEXA 1RAFB 2EKHA 1RAAB 2R57A 1RACB 2ENMA 3LW5E 4BI4A 3NTIA 4OB1B 3RKYA 1CKAA 3M4YA 2CSIA 2H3JA 1GRIA 3CCJT 2JZ2A 1M90C 3EH2A 2DTIA 1KHCA 2FYKA 2HDAA 5KYWA 2E10A 1ZLMA 1K8AC 3I9QA 1YWOA 1ZQ1A 4J9DA 5HY6A 4BACA 1NE8A 3CD6A 3CMEQ 2KRNA 3UA7A 4IIMA 2IVWA 3TQ7P 4PL6A 1WXTA 5GAOq 4PFOA 4RCBA 2E12A 2OTJQ 1SPKA 1GL5A 5FROA 3KFVA 3CPWS 3I56Q 4ZN3A 2EIFA 1NYGA 3FJPA 2HAXA 1ABOA 5GMKm 4LUEA 3OW2P 4XU1A 2RQVA 1NJIR 2X4WA 5CKHA 2ZZDA 4O6JA 4KBMB 2EQKA 3INZA 2EQIA 2B86A 1E6HA 4CRIA 1FMKA 1W6XA 2VXFA 2C0TA 1JU5C 1WJSA 2DD4A 1M4ZA 4MZPA 3MEVA 5HK3A 5GANd 3PIOA 2XD0A 3ZFJA 1WNLA 3A8LB 1BI2A 2M02A 4LDYA 1WDXA 1S72T 4A4KA 5IHNA 1OULA 1VQ9T 1KC8R 1FMWA 1FXXA 1QKWA 1X27A 1BIAA 4X9CA 1Y7XA 4LDWA 3UPUA 1NBEB 3S3MA 2CUBA 1M5Q1 1S1NA 2X4YA 2COYA 2LQNA 3A8MB 4AG2C 1V76A 3L2ZA 5KYXB 3DLMA 4OMFB 3HFOA 3V8KA 4MZTA 2JVVA 2KAFA 3JRZA 2K2MA 2LJ1A 5KYUB 3QYGB 3OYEA 3HHTB 5CQXA 3EAEA 1VQ7T 1VQKQ 2ECZA 4B9XA 3GIBA 2DERA 1W2BS 3H9NA 1VQ8T 3REAB 3A5ZB 5A0LA 5CK9A 4MDWA 2FZGB 1Q86C 2HBPA
chains in the Genus database with same CATH topology
1PNJA 1Z9ZA 1SSHA 1UUEA 2NWMA 4F16A 2HCKA 1GBQA 1CKBA 4HCKA 2LNHB 2W10A 4J9GA 2F2WA 1X43A 1UFFA 3M0RA 2D8JA 3EG2A 3I35A 2A36A 3EG1A 4D8DA 1PRMC 1EFNA 4ESRA 2D1XA 1SEMA 2G6FX 3I5SA 2PZ1A 1AZGB 2QDLA 3IQLA 3GBQA 5IHKA 1UE9A 1NEBA 1UHCA 2KYBA 1WFWA 2KE9A 2V1RA 2KYMA 1JEGA 1X6BA 2DBKA 2RQRA 4AFQC 4F17A 3H0FA 4RTVA 1E7OA 2CDTA 1NLPC 1U3OA 1GCQC 3VS1A 4FSSA 4LNPA 4OMNA 1RI9A 4IIOA 5GJVB 4RUGA 2EVRA 2YT6A 4X1VA 3TVTA 2LCSA 2PNIA 1RLQC 3I5RA 4JJBA 1Y0MA 5IXFA 2KROA 2KGTA 2ESWA 2BZYA 1VYUA 3SHWA 1QLYA 1PKTA 2F2XA 2DE0X 1NYFA 1ZUUA 1AWJA 2EYWA 4HVVA 4M4ZA 4RTTA 3VS6A 3VS4A 4AFZC 1UTIA 2A28A 1WXUA 1UGVA 2F2VA 3FJ5A 1GBRA 1GFDA 1QWEA 1NM7A 2L2PA 4HVWA 2EGAA 4RTUA 4AFSC 2J6FA 2O88A 2SRCA 1OEBA 4RTYA 1AD5A 2DRKA 1BU1A 1IO6A 3R6NA 2GBQA 1VYTA 4RTWA 1WI7A 1T3LA 2JS0A 4JJDA 1PHTA 1WX6A 2FPEA 3EG0A 1M3CA 4JPBW 2BZXA 3VRYA 1YN8A 4J9IA 2KNBB 1PWTA 1OOTA 4OMOA 2JMAA 2CT3A 4J9HA 2FRYA 2D0NA 1HD3A 2L3SA 2J06A 2HEQA 2AKKA 1HJDA 2CUDA 4J9EA 2X3XD 5I11A 2DX1A 4Z8AA 3VS5A 2OAWA 2V1QA 2DL5A 1YWPA 1ARKA 2E5KA 1AWWA 3VS3A 2EYYA 1ABQA 2KRSA 2YUQA 2ROLA 3VS7A 2J05A 1NEGA 2J6KA 2H8HA 2LJ3A 3M0UA 5FW9A 3UA6A 4CC2A 1ZSGA 4D8KA 1XOVA 2VKNA 2DMOA 2RPNA 2CT4A 3QWYA 4AG1C 5IXBA 3VS2A 4KRTA 1ZUYA 2JM9A 1H8KA 1GCQA 4OMLA 3JV3A 2DA9A 2DL7A 2YDLA 2PTKA 5FWBA 2CH4A 1M3BA 1UDLA 2SEMA 3LH5A 4EIKA 4CC7A 5IHIA 1BK2A 1X2QA 3EHRA 2AZVA 4LUDA 2K3BA 4Z88A 2O9VA 1NLOC 4J9FA 2JMCA 3EG3A 1Y57A 3H0HA 4ORZA 1K9AA 4LN2A 1RLPC 3REBB 1X69A 2CSQA 4A63B 1AWOA 1KSWA 1MV3A 2DRMA 2DL4A 5GJWB 1MV0B 2EBPA 3C0CA 1Z9QA 4ZNXA 1WLPB 3CQTA 3EGUA 3SEMA 1UECA 3A98A 1QCFA 2RN8A 4OMQA 2L3QA 1NG2A 2DL8A 2CH4W 4CC4B 2GGRA 5L23A 1KIKA 1QKXA 2LQWA 3M0TA 4JZ4A 2LMJA 4RTXA 2O31A 1M27C 4CC3A 3M0PA 1BBZA 2J6OA 4JJCA 2MIOA 2L3PA 1AZEA 4GLMA 4DEYA 1RUWA 2EYXA 4HXJA 5EC7A 2XMFA 3H41A 4K11A 2MOXA 2FEIA 5HCKA 2CREA 2P4RA 1K0SA 1I0CA 2L0AA 1N5ZA 1SHFA 3THKA 1FYNA 1ZBJA 4RTZA 1UJYA 1PRLC 1GCPA 2J7IA 2DJQA 5IH2A 1JO8A 2DNUA 2KXDA 2A37A 2FPFA 2K9GA 1JXOA 4JZ3A 3M0SA 1AOJA 1AWXA 1OV3A 2YUNA 4OMPA 1KJWA 4F14A 1X2KA 1SRLA 2LZ6B 1AEYA 2KR3A 1T0JA 3PE0A 4HVUA 2M0YA 2BTTA 2EW3A 4AFUC 3NHNA 1ZX6A 1VYVA 4J9BA 3TSWA 4Z89A 1W70A 1V1CA 2KEAA 2ABLA 2DILA 1KFZA 4OMMA 1U06A 2KXCA 2MCNA 1B07A 2JS2A 2RNAA 2RF0A 2RMOA 2I0NA 1G83A 1TUDA 2RQTA 1TG0A 2M51A 1GFCA 2DL3A 2GQIA 1I1JA 5FWCA 1HSQA 2JT4A 2K7AA 2JXBA 2HSPA 2DYBA 2BZ8A 2VWFA 3RBBB 2A08A 1AVZC 2X3WD 4DEXA 2EKHA 2OI3A 2DM1A 2ENMA 2FRWA 4R0KA 2NUZA 1PKSA 1X6GA 2O2OA 1CKAA 2LX7A 1OPKA 2CSIA 3NMZC 2FO0A 1GRIA 2KT8A 1A0NB 4LE9A 2JW4A 4GBQA 2D8HA 2AZSA 2HDAA 1WIEA 1B3QA 1ZLMA 3QWXX 2C0IA 4E6RA 3ULRB 1YCSB 3I9QA 1UG1A 1YWOA 3PVLA 2ED1A 1JXMA 4J9DA 1ZUKA 2KRNA 3UA7A 3UF4A 4IIMA 1QWFA 2KT1A 1M8MA 3UATA 1WXTA 4Y92A 2AK5A 3RNJA 1CSKA 1BB9A 2K79A 5ECAA 1YP5A 2IIMA 3H0IA 3PVQA 1SPKA 3EHQA 1GL5A 1W1FA 3KFVA 2GTOA 2VVKA 1UHFA 1H92A 3U23A 1NYGA 1K0XA 1ABOA 2KRMA 2HBWA 4LUEA 3TSZA 2RQVA 3O5ZA 2OJ2A 5I22A 2FG0A 2EGEA 1H3HA 2EQIA 1K76A 2B86A 1E6HA 1FMKA 1W6XA 1J3TA 2C0TA 1JU5C 1T3SA 1G2BA 2LP5A 2JM8A 2LJ0A 1TUCA 2EPDA 1WDXA 1YNZA 2DVJA 2RQUA 2YSQA 2ROTA 2DF6A 5IHNA 1M3AA 1K1ZA 1QKWA 1E6GA 1X27A 4J9CA 4WCIA 1U5SA 2W0ZA 2K6DA 3VRZA 1K4US 3ZL7C 2DLPA 2CUBA 1S1NA 1SRMA 2ED0A 2LQNA 4AG2C 2EGCA 1T0HA 3NPFA 1VA7A 1M30A 2GTJA 2RQWA 1LCKA 2KBTA 1UJ0A 2EYZA 1SHGA 2FPDA 1I07A 4QT7A 2K2MA 2LJ1A 3VS0A 1WA7A 2O9SA 1OPLA 2JTEA 3NGPA 2ECZA 2GNCA 1JQQA 2YUPA 2C0OA 2DBMA 3M0QA 1MUZA 3REAB 2YUOA 1WYXA 2AKLA 1WXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  1Z9Z A;  1SSH A;  1UUE A;  2NWM A;  4F16 A;  2HCK A;  1GBQ A;  1CKB A;  4HCK A;  2LNH B;  2W10 A;  4J9G A;  2F2W A;  1X43 A;  1UFF A;  3M0R A;  2D8J A;  3EG2 A;  3I35 A;  2A36 A;  3EG1 A;  4D8D A;  1PRM C;  1EFN A;  4ESR A;  2D1X A;  1SEM A;  2G6F X;  3I5S A;  2PZ1 A;  1AZG B;  2QDL A;  3IQL A;  3GBQ A;  5IHK A;  1UE9 A;  1NEB A;  1UHC A;  2KYB A;  1WFW A;  2KE9 A;  2V1R A;  2KYM A;  1JEG A;  1X6B A;  2DBK A;  2RQR A;  4AFQ C;  4F17 A;  3H0F A;  4RTV A;  1E7O A;  2CDT A;  1NLP C;  1U3O A;  1GCQ C;  3VS1 A;  4FSS A;  4LNP A;  4OMN A;  1RI9 A;  4IIO A;  5GJV B;  4RUG A;  2EVR A;  2YT6 A;  4X1V A;  3TVT A;  2LCS A;  2PNI A;  1RLQ C;  3I5R A;  4JJB A;  1Y0M A;  5IXF A;  2KRO A;  2KGT A;  2ESW A;  2BZY A;  1VYU A;  3SHW A;  1QLY A;  1PKT A;  2F2X A;  2DE0 X;  1NYF A;  1ZUU A;  1AWJ A;  2EYW A;  4HVV A;  4M4Z A;  4RTT A;  3VS6 A;  3VS4 A;  4AFZ C;  1UTI A;  2A28 A;  1WXU A;  1UGV A;  2F2V A;  3FJ5 A;  1GBR A;  1GFD A;  1QWE A;  1NM7 A;  2L2P A;  4HVW A;  2EGA A;  4RTU A;  4AFS C;  2J6F A;  2O88 A;  2SRC A;  1OEB A;  4RTY A;  1AD5 A;  2DRK A;  1BU1 A;  1IO6 A;  3R6N A;  2GBQ A;  1VYT A;  4RTW A;  1WI7 A;  1T3L A;  2JS0 A;  4JJD A;  1PHT A;  1WX6 A;  2FPE A;  3EG0 A;  1M3C A;  4JPB W;  2BZX A;  3VRY A;  1YN8 A;  4J9I A;  2KNB B;  1PWT A;  1OOT A;  4OMO A;  2JMA A;  2CT3 A;  4J9H A;  2FRY A;  2D0N A;  1HD3 A;  2L3S A;  2J06 A;  2HEQ A;  2AKK A;  1HJD A;  2CUD A;  4J9E A;  2X3X D;  5I11 A;  2DX1 A;  4Z8A A;  3VS5 A;  2OAW A;  2V1Q A;  2DL5 A;  1YWP A;  1ARK A;  2E5K A;  1AWW A;  3VS3 A;  2EYY A;  1ABQ A;  2KRS A;  2YUQ A;  2ROL A;  3VS7 A;  2J05 A;  1NEG A;  2J6K A;  2H8H A;  2LJ3 A;  3M0U A;  5FW9 A;  3UA6 A;  4CC2 A;  1ZSG A;  4D8K A;  1XOV A;  2VKN A;  2DMO A;  2RPN A;  2CT4 A;  3QWY A;  4AG1 C;  5IXB A;  3VS2 A;  4KRT A;  1ZUY A;  2JM9 A;  1H8K A;  1GCQ A;  4OML A;  3JV3 A;  2DA9 A;  2DL7 A;  2YDL A;  2PTK A;  5FWB A;  2CH4 A;  1M3B A;  1UDL A;  2SEM A;  3LH5 A;  4EIK A;  4CC7 A;  5IHI A;  1BK2 A;  1X2Q A;  3EHR A;  2AZV A;  4LUD A;  2K3B A;  4Z88 A;  2O9V A;  1NLO C;  4J9F A;  2JMC A;  3EG3 A;  1Y57 A;  3H0H A;  4ORZ A;  1K9A A;  4LN2 A;  1RLP C;  3REB B;  1X69 A;  2CSQ A;  4A63 B;  1AWO A;  1KSW A;  1MV3 A;  2DRM A;  2DL4 A;  5GJW B;  1MV0 B;  2EBP A;  3C0C A;  1Z9Q A;  4ZNX A;  1WLP B;  3CQT A;  3EGU A;  3SEM A;  1UEC A;  3A98 A;  1QCF A;  2RN8 A;  4OMQ A;  2L3Q A;  1NG2 A;  2DL8 A;  2CH4 W;  4CC4 B;  2GGR A;  5L23 A;  1KIK A;  1QKX A;  2LQW A;  3M0T A;  4JZ4 A;  2LMJ A;  4RTX A;  2O31 A;  1M27 C;  4CC3 A;  3M0P A;  1BBZ A;  2J6O A;  4JJC A;  2MIO A;  2L3P A;  1AZE A;  4GLM A;  4DEY A;  1RUW A;  2EYX A;  4HXJ A;  5EC7 A;  2XMF A;  3H41 A;  4K11 A;  2MOX A;  2FEI A;  5HCK A;  2CRE A;  2P4R A;  1K0S A;  1I0C A;  2L0A A;  1N5Z A;  1SHF A;  3THK A;  1FYN A;  1ZBJ A;  4RTZ A;  1UJY A;  1PRL C;  1GCP A;  2J7I A;  2DJQ A;  5IH2 A;  1JO8 A;  2DNU A;  2KXD A;  2A37 A;  2FPF A;  2K9G A;  1JXO A;  4JZ3 A;  3M0S A;  1AOJ A;  1AWX A;  1OV3 A;  2YUN A;  4OMP A;  1KJW A;  4F14 A;  1X2K A;  1SRL A;  2LZ6 B;  1AEY A;  2KR3 A;  1T0J A;  3PE0 A;  4HVU A;  2M0Y A;  2BTT A;  2EW3 A;  4AFU C;  3NHN A;  1ZX6 A;  1VYV A;  4J9B A;  3TSW A;  4Z89 A;  1W70 A;  1V1C A;  2KEA A;  2ABL A;  2DIL A;  1KFZ A;  4OMM A;  1U06 A;  2KXC A;  2MCN A;  1B07 A;  2JS2 A;  2RNA A;  2RF0 A;  2RMO A;  2I0N A;  1G83 A;  1TUD A;  2RQT A;  1TG0 A;  2M51 A;  1GFC A;  2DL3 A;  2GQI A;  1I1J A;  5FWC A;  1HSQ A;  2JT4 A;  2K7A A;  2JXB A;  2HSP A;  2DYB A;  2BZ8 A;  2VWF A;  3RBB B;  2A08 A;  1AVZ C;  2X3W D;  4DEX A;  2EKH A;  2OI3 A;  2DM1 A;  2ENM A;  2FRW A;  4R0K A;  2NUZ A;  1PKS A;  1X6G A;  2O2O A;  1CKA A;  2LX7 A;  1OPK A;  2CSI A;  3NMZ C;  2FO0 A;  1GRI A;  2KT8 A;  1A0N B;  4LE9 A;  2JW4 A;  4GBQ A;  2D8H A;  2AZS A;  2HDA A;  1WIE A;  1B3Q A;  1ZLM A;  3QWX X;  2C0I A;  4E6R A;  3ULR B;  1YCS B;  3I9Q A;  1UG1 A;  1YWO A;  3PVL A;  2ED1 A;  1JXM A;  4J9D A;  1ZUK A;  2KRN A;  3UA7 A;  3UF4 A;  4IIM A;  1QWF A;  2KT1 A;  1M8M A;  3UAT A;  1WXT A;  4Y92 A;  2AK5 A;  3RNJ A;  1CSK A;  1BB9 A;  2K79 A;  5ECA A;  1YP5 A;  2IIM A;  3H0I A;  3PVQ A;  1SPK A;  3EHQ A;  1GL5 A;  1W1F A;  3KFV A;  2GTO A;  2VVK A;  1UHF A;  1H92 A;  3U23 A;  1NYG A;  1K0X A;  1ABO A;  2KRM A;  2HBW A;  4LUE A;  3TSZ A;  2RQV A;  3O5Z A;  2OJ2 A;  5I22 A;  2FG0 A;  2EGE A;  1H3H A;  2EQI A;  1K76 A;  2B86 A;  1E6H A;  1FMK A;  1W6X A;  1J3T A;  2C0T A;  1JU5 C;  1T3S A;  1G2B A;  2LP5 A;  2JM8 A;  2LJ0 A;  1TUC A;  2EPD A;  1WDX A;  1YNZ A;  2DVJ A;  2RQU A;  2YSQ A;  2ROT A;  2DF6 A;  5IHN A;  1M3A A;  1K1Z A;  1QKW A;  1E6G A;  1X27 A;  4J9C A;  4WCI A;  1U5S A;  2W0Z A;  2K6D A;  3VRZ A;  1K4U S;  3ZL7 C;  2DLP A;  2CUB A;  1S1N A;  1SRM A;  2ED0 A;  2LQN A;  4AG2 C;  2EGC A;  1T0H A;  3NPF A;  1VA7 A;  1M30 A;  2GTJ A;  2RQW A;  1LCK A;  2KBT A;  1UJ0 A;  2EYZ A;  1SHG A;  2FPD A;  1I07 A;  4QT7 A;  2K2M A;  2LJ1 A;  3VS0 A;  1WA7 A;  2O9S A;  1OPL A;  2JTE A;  3NGP A;  2ECZ A;  2GNC A;  1JQQ A;  2YUP A;  2C0O A;  2DBM A;  3M0Q A;  1MUZ A;  3REA B;  2YUO A;  1WYX A;  2AKL A;  1WXB A; 
#chains in the Genus database with same CATH topology
 2LNV A;  2LQK A;  3CC4 A;  3QBY A;  3JB9 G;  1GBQ A;  2LNH B;  1VQ5 Q;  2W10 A;  1RAG B;  3RR6 A;  1B34 B;  1B7T A;  2GFU A;  2JTM A;  1K73 C;  1BYM A;  2XIC A;  2DKG A;  1TS9 A;  3BY7 A;  5CO7 A;  3EG1 A;  4D8D A;  1EFN A;  2D1X A;  2QG9 B;  2QAZ A;  3IQL A;  4LDU A;  3QZ9 B;  1NEB A;  2RQR A;  1VQL A;  1PC0 A;  5GAO n;  4AFQ C;  4BD3 A;  4IUP A;  3A1P A;  4IUR A;  5EG2 A;  1YI2 A;  4HCB A;  1UEB A;  4C92 E;  3BDU A;  3JB9 H;  1E7O A;  3CCL A;  1U3O A;  1VUB A;  2CP6 A;  2NUT A;  5CKB A;  4RUG A;  2EVR A;  2YT6 A;  4XTV A;  5A2Q E;  3BFM A;  1RLQ C;  2L3R A;  3I5R A;  4J5Y A;  1N27 A;  2QDY B;  1XQH A;  3CCU A;  1VQ4 Q;  2ESW A;  3OBW A;  4XTY A;  3MHX A;  3PGG A;  5GAN f;  4UC4 A;  3MP1 A;  3MCA B;  3OYY A;  2EYW A;  2DXB A;  4HVV A;  3OYD A;  4HCC A;  4A54 A;  1TSF A;  2QXF A;  3VS4 A;  3JAM E;  3QXE B;  1D09 B;  4RG8 A;  4X34 A;  5IT9 E;  2A28 A;  2F2V A;  1MMD A;  4M7A E;  3VKI A;  1NM7 A;  2DTO A;  4HVW A;  2EGA A;  4OB2 B;  4RKU E;  1D1B A;  3CCJ Q;  5A0G A;  2J6F A;  5CAI A;  4WTO B;  2RB6 A;  3QYH B;  3E9F A;  3OW2 S;  1IO6 A;  1QQJ A;  1GXI E;  1VYT A;  4F7U F;  3L2V A;  2JS0 A;  4C92 G;  4JJD A;  2FPE A;  4QW2 A;  2E6N A;  3ME9 A;  2BUD A;  5FLX E;  2FRY A;  4BY6 B;  4FT4 A;  2J06 A;  2LCC A;  4WF2 A;  2Y4Y A;  2DXU A;  1Q7Y R;  3VS5 A;  3HL8 A;  2CYZ B;  2DZC A;  3KBG A;  1NJI U;  1VQP A;  1YWP A;  1ARK A;  2E5K A;  3OS5 A;  3X24 B;  2CZ0 B;  1IRE B;  2YUQ A;  2DEU A;  4M7D F;  2J05 A;  1RAD B;  2H8H A;  1IHW A;  1WHG A;  2NUP B;  4M7A G;  1I81 A;  1ZSG A;  5FRN A;  3EFR A;  1XOV A;  3M55 A;  3LGF A;  2XID A;  1LNX A;  3HRT A;  1VQ6 T;  1VQ9 Q;  4KRT A;  1KC8 U;  1H8K A;  1C1A A;  4FM4 B;  3G71 A;  1WQ7 A;  5KYX A;  3KXT A;  3G7Z A;  2E3H A;  1VQM A;  2PTK A;  5GMK j;  1UDL A;  3LH5 A;  1X01 A;  2M0O A;  3JCM h;  1BK2 A;  3EHR A;  2AZV A;  5KYU A;  3DB3 A;  3OMC A;  4Z88 A;  1G8X A;  4O5V A;  4ORZ A;  1K9A A;  1RLP C;  2GCX A;  2BKD N;  2F5K A;  2YXY A;  4X9D A;  1VQ7 Q;  1MV3 A;  3ER0 A;  2MK5 A;  4JRQ A;  4ZNX A;  1VQ8 Q;  3JCM b;  1WLP B;  3SEM A;  4ZGD B;  1PD1 A;  1ZSZ B;  2EJG A;  4JRK A;  7AT1 B;  1QCF A;  2EAY A;  1RAE B;  4OMQ A;  3OYM A;  2YLC A;  1NG2 A;  1B34 A;  2HNI A;  2VXE A;  3MO8 A;  1Q82 C;  4CC4 B;  3EGX B;  1QKX A;  2LQW A;  2RI3 A;  5KCO A;  2QQA A;  3QO3 A;  3OY9 A;  2DFU A;  4CC3 A;  3M0P A;  3CCQ Q;  4N4H A;  1BBZ A;  2J6O A;  5J26 A;  2MIO A;  4JS5 A;  1IGQ A;  2EKO A;  2EJF A;  1PSE A;  4C92 B;  4DOV A;  3CCM A;  1KG1 A;  3G4S A;  3FRN A;  2PVO B;  1RI0 A;  2D9T A;  2MOX A;  1U1T A;  1KQ1 A;  3PNW C;  1K0S A;  4PJN A;  1QVG P;  2RA2 A;  3THK A;  3FC3 A;  1ZA2 B;  1PRL C;  2DEQ A;  1TOV A;  1OU9 A;  1JO8 A;  3JCM V;  3AHU A;  2K9G A;  2K2V A;  1KQS P;  4OP0 A;  2QQB A;  2RHX A;  3CPF A;  1AOJ A;  3QDR B;  1OV3 A;  3JB9 D;  3SWN B;  1KJW A;  2A0F B;  2XU8 A;  2KR3 A;  1M2V B;  4J6X A;  3OQ5 A;  3EH1 A;  4XK8 E;  2RO0 A;  1YJ9 A;  1JJ2 P;  1MMA A;  4AFU C;  2EQJ A;  2E64 A;  3RIR A;  1SG5 A;  3H6Z A;  3E19 A;  2DIL A;  3JCM c;  4JS4 A;  2MYS A;  4XU3 A;  1B07 A;  2JS2 A;  2JJ9 A;  4BDY A;  5GAN 5;  2JNG A;  2GFA A;  3RKW A;  3VU3 C;  3CME A;  1C0M A;  3CMA A;  4XTU A;  3CCV T;  1U8R A;  4A4E A;  1TG0 A;  5GAM e;  2RD1 A;  2DTH A;  1GFC A;  3URG A;  1LJO A;  2GQI A;  2EWN A;  3V8J A;  3JCM Q;  2OTJ A;  3CXC A;  1HSQ A;  2JT4 A;  2PUO B;  2HSP A;  2VWF A;  1WHK A;  2MWP A;  5LJ3 e;  2A08 A;  2PQW A;  3HP9 A;  5GAO l;  5I2M A;  4N4G A;  2O2O A;  1Q7Y U;  2GQV A;  2KT8 A;  4LE9 A;  3C12 A;  2QYZ A;  1YIT T;  4HT9 A;  2NUP A;  2D8H A;  2AZS A;  1ZBX A;  1B3Q A;  4FCY A;  2QA4 T;  2C0I A;  4C5E A;  3SD4 A;  2JTF A;  3EG9 B;  3FEO A;  1YCS B;  1YJW T;  4M7D C;  1UG1 A;  1JXM A;  3FDR A;  1UGQ B;  2KT1 A;  1M8M A;  4C92 D;  4FIB A;  2K79 A;  5ECA A;  2IIM A;  3EHQ A;  2K5F A;  2LC4 A;  5HKC A;  3QUI A;  3LGL A;  1H92 A;  2FZC B;  1YIJ A;  3RDV A;  2KRM A;  1XJW B;  1NJI C;  2DYI A;  4QVZ A;  3A8H B;  1H3H A;  1VQN Q;  2RHU A;  5LJ5 e;  1YJN T;  3MPU B;  2LP5 A;  1PSF A;  3CC7 A;  1ZSZ A;  3HRS A;  3CCE T;  2QTX A;  5M9O A;  2V26 A;  4M7A D;  2RQU A;  2ROT A;  2DF6 A;  4C5H A;  2BE9 B;  1KC8 C;  2W0Z A;  1K4U S;  3ZL7 C;  2DLP A;  3V7C A;  1RL2 A;  3HRU A;  1SRM A;  3V7R A;  3L2R A;  4ME7 A;  2VC8 A;  3WXM B;  3NPF A;  1N6A A;  2F69 A;  1VA7 A;  1M30 A;  4FL6 A;  3VJP A;  4XQ3 A;  4F7U A;  2DZ9 A;  4XTW A;  4MDX A;  1LCK A;  1KQS S;  3NFC A;  3T9N A;  2FPD A;  3G6E T;  3UWN A;  1QVF P;  5KE2 A;  2GNC A;  1JQQ A;  2YUP A;  3OYF A;  1OU8 A;  5CKF A;  4IKF A;  1Q81 R;  1JJ2 S;  3QDF A;  1VQO Q;  3GLX A;  3CCR T;  2DET A;  2DVE A;  4F16 A;  2YRC A;  2MI6 A;  3I55 A;  4XTX A;  1M2V A;  2B8A A;  2K3Y A;  1SF9 A;  2RJF A;  1UFF A;  1VQ4 A;  5AT1 B;  3M0R A;  3EG2 A;  2QAS A;  3I35 A;  2A36 A;  3CCS T;  1IXD A;  4M78 E;  1X6O A;  1SEM A;  4PK4 A;  3S3N A;  2G6F X;  2LVM A;  1M2O A;  3M56 A;  5IHK A;  1UHC A;  2QQR A;  2V1R A;  1YHQ A;  2DBK A;  3HKS A;  3C95 A;  4AMC A;  1WQW A;  4P5N A;  2JN0 A;  1I8F A;  4KUI A;  4C0Z A;  4F17 A;  5FU6 B;  5D6W A;  3H0F A;  2PVD B;  2CDT A;  3TCJ A;  3VS1 A;  2BE7 D;  4OMN A;  2XK0 A;  4D6W A;  5GJV B;  4DOW A;  3CD6 T;  5FU7 C;  3SB2 A;  3TVT A;  3CCV Q;  2DXT A;  2NLU A;  4M75 E;  1UGS B;  4JJB A;  1G3T A;  2KRO A;  2LRQ A;  2WSE E;  5IAY A;  2DE0 X;  1KHI A;  4M4Z A;  4LD6 A;  1ACM B;  3VS6 A;  5GMK l;  3OYL A;  4PJO E;  2FZK B;  3PT9 A;  1WXU A;  5GMK i;  1GFD A;  4XAX B;  3EG9 A;  1YIT Q;  4HA8 A;  4AFS C;  2SRC A;  4J83 A;  1K9M R;  2DRK A;  1QVG A;  2JOY A;  1N8R R;  1WI7 A;  1WYX A;  1VQ9 A;  1BCM A;  2HKQ B;  5GAO r;  3OMG A;  3A8G B;  1QP2 A;  4J9I A;  2R5M A;  2KNB B;  4C8Q E;  5GAO p;  2OTL A;  1KQS A;  4FU6 A;  4J9H A;  1WJQ A;  4M75 G;  3OYH A;  5GAM g;  4J9E A;  2E6Z A;  3MEA A;  5GAN h;  5I11 A;  2DX1 A;  1Q7Y C;  4IUV A;  2OAW A;  2X4J A;  3FIF A;  1JJ2 A;  1AWW A;  1O9S A;  2EYY A;  1ABQ A;  5LJ3 g;  3VS7 A;  1NEG A;  2C06 A;  4PJO G;  5FW9 A;  3X28 B;  2H3E B;  3JB9 F;  3CXC P;  4D8K A;  2DIG A;  3CCE Q;  5CKE A;  1KD1 R;  3QWY A;  5DY9 A;  3OA6 A;  3VS2 A;  1QVF S;  4JLI A;  2JM9 A;  5KYY B;  3CC4 T;  3O8V A;  4OML A;  2LT4 A;  3CCQ A;  1EIF A;  1WGS A;  3JV3 A;  2YDL A;  3MEU A;  1G3W A;  2X9H A;  4CC7 A;  5IHI A;  4CI0 C;  2DIQ A;  1I4K 1;  1QCN A;  3DKM A;  2FB7 A;  2V8J A;  4J9F A;  2JMC A;  3EG3 A;  3GOX A;  3EGD A;  3BW1 A;  1QVP A;  2L89 A;  1EX4 A;  1M8V A;  3REB B;  2X4X A;  1AWO A;  1M90 R;  1D3B B;  2DL4 A;  1VQL T;  1MV0 B;  1Z9Q A;  1M9S A;  3CQT A;  5GMK h;  1YI2 T;  3TRE A;  4JUV A;  1UEC A;  1Q81 U;  3CCL T;  5LJ5 g;  4E7Z A;  1NPP A;  4PNO A;  5J39 A;  1R77 A;  1KIK A;  1JB0 E;  3M0T A;  2QK0 A;  4JZ4 A;  2LMJ A;  1MGQ A;  3OYN A;  3VYG A;  3E1S A;  3CCU T;  2AIR B;  2QEX A;  3CC2 T;  1OZ3 A;  2L3P A;  5GAM d;  4C5I A;  3E2U A;  1AZE A;  4DEY A;  1VOM A;  4M77 E;  5EC7 A;  3HSB A;  2XMF A;  3H41 A;  4K11 A;  4HKE A;  2FEI A;  1N9R A;  2K4Y A;  5LJ3 d;  2P4R A;  2LX9 A;  4C92 F;  2KDS A;  5KYN A;  5GAN j;  2L0A A;  3OYA A;  3V7S A;  4M75 B;  4JJN K;  2AT1 B;  1UJY A;  3VV0 A;  1MHN A;  1LOJ A;  3PFS A;  2KXD A;  2A37 A;  2FPF A;  2R5A A;  3DLL A;  4ANJ A;  3J7A F;  3CBP A;  1AWX A;  3CD6 Q;  4NL3 A;  2D0Q B;  1G5V A;  1X2K A;  1SRL A;  2CS7 A;  4PJO B;  1AEY A;  1W4S A;  1P92 A;  3L42 A;  5GAN 4;  8ATC B;  4C5G A;  2O4X B;  3UDC A;  3LWH A;  4QQ6 A;  4RG2 A;  3OBY A;  3NHN A;  3ZEH A;  4M7A F;  1TUG B;  4EMK B;  1VYV A;  2X51 A;  1V1C A;  2MWO A;  2ABL A;  4M77 G;  4A4F A;  4FT2 A;  1VQP T;  1KFZ A;  4OMM A;  1YCY A;  2JUF A;  2MCN A;  3S6W A;  3VUZ A;  1QVF A;  2COW A;  4ZTF A;  4L59 A;  2PVG B;  1S72 Q;  4E7S A;  5FRM A;  2RF0 A;  5CKD A;  3JB9 I;  1OZ2 A;  2K5I A;  1K9M U;  1WZO A;  5LJ5 d;  2RQT A;  1N8R U;  2M51 A;  2DL3 A;  1I1J A;  1UGP B;  3VUB A;  2IG0 A;  2K7A A;  1IZ6 A;  3G71 T;  2BZ8 A;  3CXC S;  4KGZ B;  1YBY A;  1AT1 B;  1VQM T;  1XNI A;  2OI3 A;  2FRW A;  4R0K A;  1G3Y A;  3WVE B;  2YWW A;  2ZGW A;  3OS1 A;  2NUZ A;  1X6G A;  1VQN A;  4M78 D;  4E7L A;  1OPK A;  2HL3 A;  2F1L A;  2X35 A;  2FO0 A;  4FW2 A;  2RK1 A;  4Y91 A;  2FHD A;  5J3B A;  1RAH B;  4BY6 C;  3ULR B;  4FW1 A;  4YTL A;  3PVL A;  2ED1 A;  1WHL A;  1ZUK A;  4L5G A;  5CQY A;  1D1A A;  5GAM f;  4LDX A;  4OGC A;  1QWF A;  3UAT A;  2AK5 A;  3RNJ A;  2E3I A;  3X26 B;  3PVQ A;  1WJR A;  3N5B B;  3V8L A;  1W1F A;  2CP5 A;  3QII A;  2MF2 A;  2VVK A;  3CC4 Q;  5LJ3 f;  1K0X A;  2P0Q A;  2KK4 A;  4M75 D;  3TSZ A;  3OYB A;  2QI2 A;  2OJ2 A;  5I22 A;  2MAM A;  5C0M A;  2FG0 A;  4BE2 A;  2EGE A;  3E9G A;  4MZM A;  3CCM T;  2NYS A;  2DO3 A;  2Y4X A;  4MML A;  3G4S T;  5CR2 A;  1D3B A;  1T3S A;  3CEY A;  4PJO D;  3C94 A;  2LJ0 A;  1TUC A;  4PJL A;  5LJ3 j;  3M54 A;  1VQL Q;  2DVJ A;  1VQO A;  2ZPE B;  4ATO A;  1ZHI A;  2ZPG B;  1K1Z A;  1E6G A;  4J9C A;  1YI2 Q;  1U5S A;  3SFM A;  5HK0 A;  1LVK A;  3CCL Q;  4M77 B;  4M7A B;  2FVU A;  2YHT A;  4OF1 A;  2E65 A;  2K57 A;  5GAN 6;  2ATC B;  1WHJ A;  2GTJ A;  4C8Q D;  1ZSZ C;  1R0C B;  2RH2 A;  2L5Q A;  1YJ9 T;  3CC2 Q;  2KBT A;  1UJ0 A;  4JRI A;  4QT7 A;  1BCO A;  5LJ5 f;  1OPL A;  4M75 A;  4ELY C;  2C0O A;  2DBM A;  3M0Q A;  1MUZ A;  2YUO A;  3QZ5 B;  4QVC A;  1Q81 C;  2BIV A;  2PUK B;  4C92 C;  1PNJ A;  5KYW B;  3CME T;  3CCV A;  3CMA T;  1UGR B;  3I56 A;  2F2W A;  1WHH A;  5D7U A;  5LJ5 j;  2OTJ T;  2D8J A;  4DQ2 A;  2XI9 A;  3LX7 A;  2CP7 A;  4PJM A;  2KVQ G;  2CZ1 B;  4KGX B;  3P8B B;  3GBQ A;  1BI1 A;  4E47 A;  2DAQ A;  3SWN C;  2RK2 A;  2KYB A;  2VYT A;  1WFW A;  2KE9 A;  2KYM A;  1MMN A;  4M77 C;  4M7A C;  1D0Y A;  1X75 C;  3LYI A;  1VQP Q;  2VAS A;  2WAC A;  3P8H A;  3OYG A;  4EPC A;  3RES A;  1NLP C;  3JCM X;  1GCQ C;  4FSS A;  4Q5W A;  1VQ6 Q;  4X1V A;  2LCS A;  2KI7 A;  2PNI A;  1Q95 G;  1Q82 R;  2EQU A;  4E7H A;  1N9S A;  1Y0M A;  3JCM e;  3G71 Q;  1PKT A;  1TH7 A;  2F2X A;  1NYF A;  2CKK A;  1ZUU A;  4OVA A;  4QQD A;  1AWJ A;  1YIJ T;  2VUB A;  1VQK A;  1VQM Q;  5DM7 R;  4EMG A;  3GNG A;  1KQ2 A;  4AFZ C;  1UTI A;  1GBR A;  1UGV A;  2V8I A;  4QQG A;  4M77 D;  3JCM P;  4RTU A;  2HZY A;  4KUL A;  3OS0 A;  3P8D A;  3QPH A;  1OEB A;  3EGX A;  3CC7 T;  1BU1 A;  1K9M C;  5D6X A;  3R6N A;  4F04 B;  2EJ9 A;  1TWB A;  2A7Y A;  4RTW A;  1VQ5 A;  1N8R C;  1IRX A;  1PHT A;  1WX6 A;  4XU2 A;  1QVG S;  1OQK A;  2BZX A;  3VRY A;  1OOT A;  4XTZ A;  4C92 A;  4KH1 B;  2D0N A;  1HD3 A;  2L3S A;  3VYH B;  2A3L A;  2V1Q A;  2DL5 A;  2E4H A;  3VS3 A;  4PFZ A;  3CCM Q;  3G4S Q;  2HQX A;  3M0U A;  2RI5 A;  3UA6 A;  4KT0 E;  4CC2 A;  2E41 A;  3M57 A;  3SWN A;  2RPN A;  4KH0 B;  4M77 A;  4AG1 C;  4M7A A;  3RER A;  3PIP A;  1ZUY A;  3I55 T;  1GCQ A;  1DJ7 B;  2DA9 A;  2DL7 A;  2E1H A;  9ATC B;  2SEM A;  1X2Q A;  2K3B A;  3CCJ A;  2MPX C;  1YJ9 Q;  2FL7 A;  1D0Z A;  3SDZ A;  1YHQ T;  4A63 B;  1KSW A;  2QGF B;  5GJW B;  3RUX A;  5KE3 A;  2EBP A;  3C0C A;  4KUD K;  2XDD A;  3EGU A;  4BE0 A;  2HQH A;  3A98 A;  2RJD A;  5CVI A;  2RN8 A;  2M1H A;  2HD0 A;  1TU0 B;  2DL8 A;  1V29 B;  4J7I A;  3CMA Q;  3GNF B;  2P4T A;  4M78 F;  5C6S A;  2O31 A;  3NTH A;  1M27 C;  3MP6 A;  2RM4 A;  4M78 G;  4JJC A;  4GLM A;  1XTD A;  2HKN A;  4HXJ A;  1PD0 A;  3HPW A;  5HCK A;  3GP8 A;  4A4H A;  2QA4 Q;  2K3X A;  3M58 A;  1N5Z A;  1SHF A;  1YJW Q;  1FYN A;  5LL6 S;  1S72 A;  5L8R E;  1GCP A;  2J7I A;  4ZN1 A;  2DJQ A;  1HYO A;  5IH2 A;  2HMA A;  2DNU A;  5GAN 2;  3CBM A;  4M75 F;  2IPO B;  4ZGJ B;  1R0B G;  3QKJ A;  2YUN A;  5CCA A;  2LZ6 B;  3FB9 A;  2OTL T;  4E2F B;  3PMI A;  5FU6 C;  2VB6 A;  2XDP A;  4HVU A;  1C6V X;  1Q82 U;  2LQ8 A;  2M0Y A;  1TXQ A;  1BI3 A;  2BTT A;  4PJO F;  3D7S B;  4II1 A;  1YIJ Q;  4GLK A;  2QQ9 A;  4BUG A;  1OI1 A;  3M9Q A;  1VQ7 A;  1W70 A;  1YJN Q;  2KEA A;  1VQ8 A;  1QW1 A;  1U06 A;  2KXC A;  4PKC C;  5I21 A;  3TU4 K;  3KUF A;  2RJC A;  2RNA A;  1M1K R;  2RMO A;  2I0N A;  4NOY A;  3CC7 Q;  4C8Q F;  5FWC A;  4E7K A;  3DB4 A;  4C8Q G;  2JXB A;  2V8K A;  2GF7 A;  4BI8 B;  4A53 A;  4BDZ A;  4V2S A;  1M1F A;  2ZAE A;  5CIU A;  3CCQ T;  1AVZ C;  1OX8 A;  2K5L A;  2DM1 A;  1U1S A;  5I2S A;  3X25 B;  2ZPB B;  3G6E Q;  1PKS A;  3HFN A;  1QP3 A;  2LX7 A;  5A0D A;  3GPL A;  3OB9 A;  4FSX A;  3NMZ C;  4JLG A;  4DBQ A;  1A0N B;  5IN1 A;  2VGM A;  3L1A A;  2JW4 A;  4GBQ A;  3JCM g;  2HSE B;  2KY9 A;  1WIE A;  1QCO A;  2RJE A;  5GAN 7;  3QWX X;  4E6R A;  1K8A R;  5KCH A;  3FLG A;  4M78 B;  2AHJ B;  3CCR Q;  2KSS A;  1QMC A;  6AT1 B;  3JCM J;  1FMV A;  4IUQ A;  3UF4 A;  4NS5 A;  4F7U E;  3PMT A;  4JDS A;  4Y92 A;  1CSK A;  1BB9 A;  3CPW A;  2CGH A;  1FWZ A;  1YP5 A;  3H0I A;  3MET A;  3I55 Q;  3CCS Q;  2LDM A;  3UT1 A;  2GTO A;  1UHF A;  4Y28 E;  1IB8 A;  1TTH B;  3U23 A;  2ZPI B;  4N0A C;  2HBW A;  4DBF A;  3RMQ A;  1MND A;  3CC2 A;  3O5Z A;  1Y96 B;  2QEX T;  1LPL A;  2DPP B;  1K76 A;  3M5A A;  1J3T A;  1FX7 A;  3J80 E;  4KGV B;  4FYW B;  4RCC A;  2YLB A;  1G2B A;  3EFO B;  2ZPH B;  3RMS A;  2JM8 A;  4M7D E;  1VIF A;  3BDL A;  4DBH A;  4C0D B;  1YHQ Q;  2D6F A;  2EPD A;  4RMO A;  3J81 E;  5GAN 8;  1YNZ A;  2YSQ A;  2PU9 B;  1M3A A;  4WCI A;  4ELZ C;  4E7I A;  2YRD A;  3AT1 B;  4QKU A;  1UB4 A;  5D6Y A;  2K6D A;  3VRZ A;  5GAM h;  2ED0 A;  1ZA1 B;  4F7U G;  3L2W A;  2EGC A;  1T0H A;  3MP8 A;  2RQW A;  4M77 F;  1MNE A;  5LJ3 h;  4M78 C;  2DXC A;  4AT1 B;  4Z02 A;  3BE3 A;  4NL2 A;  2EYZ A;  1SHG A;  1YFN A;  1W2B A;  1I07 A;  3M53 A;  3MJX A;  3JCM W;  4C8Q B;  3VS0 A;  1WA7 A;  2O9S A;  3QG1 A;  3NGP A;  2JTE A;  3JCM d;  1AHJ B;  1PM3 A;  3PTA A;  1Q86 R;  4LXC A;  2AKL A;  1WXB A;  1Z9Z A;  4M7D G;  2ZPF B;  1SSH A;  1UUE A;  2E70 A;  3G1J A;  1SSF A;  2NWM A;  1D0X A;  4FYX B;  1VQ6 A;  3QSU A;  4IUT A;  2HCK A;  2RI2 A;  1CKB A;  4HCK A;  3WVD B;  4J9G A;  1K73 R;  1X43 A;  1F1B B;  4M75 C;  2L8D A;  1R8O B;  2OTL Q;  1PRM C;  3QJ6 A;  4ESR A;  5GAN e;  3I5S A;  4C0D C;  2PZ1 A;  1AZG B;  2QDL A;  2CP0 A;  1BIB A;  1UE9 A;  4PJO C;  1VQN T;  1JEG A;  4N0A A;  1X6B A;  4J6Y A;  4B9W A;  2KMT A;  5LJ5 h;  3QJY A;  3X20 B;  5KYY A;  2I2L A;  4RTV A;  3R6O A;  3HTR A;  1KD1 U;  4LNP A;  1RI9 A;  1M1K U;  4IIO A;  1O75 A;  4EMK C;  2RHZ A;  2RHI A;  2RHY A;  1WPY A;  4DA4 A;  4C8Q C;  3MKD A;  5IXF A;  2KGT A;  3TEE A;  3QHS A;  2BZY A;  4OGE A;  4R55 A;  1JBM A;  1VYU A;  3SHW A;  2LT1 A;  1QLY A;  5GAM j;  4RTT A;  2E5Q A;  1WHM A;  4GY5 A;  3FJ5 A;  1QWE A;  2EFI A;  2L2P A;  4M78 A;  4F7U B;  1M90 U;  3OW2 A;  2LTO A;  2O88 A;  2WSF E;  4EDU A;  5GMK e;  4RTY A;  1AD5 A;  1K8A U;  2GBQ A;  1VQO T;  1T3L A;  4BB7 A;  3F70 A;  3EG0 A;  1M3C A;  4JPB W;  1YN8 A;  3OS2 A;  1PWT A;  4OMO A;  1NZ9 A;  2JMA A;  2DD5 A;  2CT3 A;  4LDV A;  3JB9 J;  2P84 A;  3CCU Q;  4ZTJ A;  1Y71 A;  1Y96 A;  2QQS A;  3JCM f;  2HEQ A;  2AKK A;  1HJD A;  1OX9 A;  2CUD A;  4M7D B;  4TVR A;  4E7J A;  2X3X D;  4Z8A A;  2QEX Q;  4J8O A;  3L2Q A;  4LD9 K;  2XDB A;  3EFO A;  4BE1 A;  3OSS C;  3A8O B;  2KRS A;  2ROL A;  2J6K A;  2LJ3 A;  5DLO A;  2QGG A;  3S3O A;  1IHV A;  4ZGE B;  2VKN A;  4HCZ A;  4PJO A;  2M9U A;  2DMO A;  2HQE A;  2CT4 A;  5GAN 3;  5IXB A;  2O4X A;  1NPR A;  2XKO C;  3I56 T;  4MMK A;  1VIE A;  1PG5 B;  4EMK A;  2MMP A;  3LLR A;  5FWB A;  5GAO m;  4PLI A;  1H3Z A;  2CH4 A;  1M3B A;  4EIK A;  3L2U A;  5KH6 A;  3ZBD A;  3GF5 A;  2XHC A;  4LUD A;  1BI0 A;  4C8Q A;  4J6W A;  1OYX A;  2P0P A;  2Z0W A;  4XU0 A;  2O9V A;  2VGN A;  1NLO C;  1YIT A;  4FYV B;  1Y57 A;  2LCL A;  3H0H A;  4LN2 A;  8AT1 B;  1IGU A;  4DBR A;  2QA4 A;  3EFS A;  4C0G A;  1X69 A;  2CSQ A;  5AYF A;  1H64 1;  1YJW A;  3CPW P;  2CP2 A;  2DRM A;  3M4G A;  3OYK A;  1D1C A;  4PJJ A;  3OSV A;  2QTV A;  1Q86 U;  1G3S A;  4N4I A;  2L3Q A;  2CH4 W;  2R58 A;  2GGR A;  2CZ7 B;  3ASK A;  5L23 A;  1SKU B;  4RTX A;  1K73 U;  4PFP A;  4B6M A;  2P0K A;  2EYQ A;  3OYJ A;  1RUW A;  3CBO A;  4L6V 5;  3RKX A;  2DK3 A;  2EYX A;  4OB3 B;  1RAB B;  1VQK T;  2CP3 A;  1YJN A;  2CRE A;  3LH0 A;  3M59 A;  1I0C A;  3MEW A;  3CCE A;  1M1G A;  1ZBJ A;  4RTZ A;  2OX7 A;  4M7D D;  1JXO A;  2COZ A;  1HXD A;  2VV5 A;  2Y90 A;  4JZ3 A;  1VQ5 T;  3M0S A;  4OB0 B;  4JRP A;  4OMP A;  4F14 A;  4A4G A;  1W2B P;  1T0J A;  1RAI B;  1Y07 A;  3PE0 A;  2WSC E;  3Q1J A;  2KQW A;  3LWI A;  2EW3 A;  3OYI A;  2HL5 C;  3G6E A;  1ZX6 A;  2XG8 D;  4J9B A;  3TSW A;  4VUB A;  5DLQ E;  4Z89 A;  4R56 A;  1I5O B;  4QVD A;  5FU7 B;  3JSC A;  2G3R A;  5GAN g;  2EQM A;  2CZ6 B;  1HK9 A;  1I5L A;  2M16 A;  1KK7 A;  2ZCF B;  1KD1 C;  2DJZ A;  3CCR A;  4J7F A;  2O01 E;  3EGD B;  3C4S A;  1M1K C;  1BKB A;  1G83 A;  4FYY B;  1TUD A;  1PCX A;  4EMH A;  1JRI A;  3NTK A;  2OAU A;  2YRV A;  4HT8 A;  2NUT B;  1EZZ B;  3H8Z A;  4PLL A;  4C0F A;  1VQ4 T;  3OYC A;  3CCS A;  2F5T X;  4IUU A;  2DYB A;  4M7D A;  3RBB B;  1MMG A;  4BI3 A;  2X3W D;  4DEX A;  1RAF B;  2EKH A;  1RAA B;  2R57 A;  1RAC B;  2ENM A;  3LW5 E;  4BI4 A;  3NTI A;  4OB1 B;  3RKY A;  1CKA A;  3M4Y A;  2CSI A;  2H3J A;  1GRI A;  3CCJ T;  2JZ2 A;  1M90 C;  3EH2 A;  2DTI A;  1KHC A;  2FYK A;  2HDA A;  5KYW A;  2E10 A;  1ZLM A;  1K8A C;  3I9Q A;  1YWO A;  1ZQ1 A;  4J9D A;  5HY6 A;  4BAC A;  1NE8 A;  3CD6 A;  3CME Q;  2KRN A;  3UA7 A;  4IIM A;  2IVW A;  3TQ7 P;  4PL6 A;  1WXT A;  5GAO q;  4PFO A;  4RCB A;  2E12 A;  2OTJ Q;  1SPK A;  1GL5 A;  5FRO A;  3KFV A;  3CPW S;  3I56 Q;  4ZN3 A;  2EIF A;  1NYG A;  3FJP A;  2HAX A;  1ABO A;  5GMK m;  4LUE A;  3OW2 P;  4XU1 A;  2RQV A;  1NJI R;  2X4W A;  5CKH A;  2ZZD A;  4O6J A;  4KBM B;  2EQK A;  3INZ A;  2EQI A;  2B86 A;  1E6H A;  4CRI A;  1FMK A;  1W6X A;  2VXF A;  2C0T A;  1JU5 C;  1WJS A;  2DD4 A;  1M4Z A;  4MZP A;  3MEV A;  5HK3 A;  5GAN d;  3PIO A;  2XD0 A;  3ZFJ A;  1WNL A;  3A8L B;  1BI2 A;  2M02 A;  4LDY A;  1WDX A;  1S72 T;  4A4K A;  5IHN A;  1OUL A;  1VQ9 T;  1KC8 R;  1FMW A;  1FXX A;  1QKW A;  1X27 A;  1BIA A;  4X9C A;  1Y7X A;  4LDW A;  3UPU A;  1NBE B;  3S3M A;  2CUB A;  1M5Q 1;  1S1N A;  2X4Y A;  2COY A;  2LQN A;  3A8M B;  4AG2 C;  1V76 A;  3L2Z A;  5KYX B;  3DLM A;  4OMF B;  3HFO A;  3V8K A;  4MZT A;  2JVV A;  2KAF A;  3JRZ A;  2K2M A;  2LJ1 A;  5KYU B;  3QYG B;  3OYE A;  3HHT B;  5CQX A;  3EAE A;  1VQ7 T;  1VQK Q;  2ECZ A;  4B9X A;  3GIB A;  2DER A;  1W2B S;  3H9N A;  1VQ8 T;  3REA B;  3A5Z B;  5A0L A;  5CK9 A;  4MDW A;  2FZG B;  1Q86 C;  2HBP A; 
#chains in the Genus database with same CATH homology
 1PNJ A;  1Z9Z A;  1SSH A;  1UUE A;  2NWM A;  4F16 A;  2HCK A;  1GBQ A;  1CKB A;  4HCK A;  2LNH B;  2W10 A;  4J9G A;  2F2W A;  1X43 A;  1UFF A;  3M0R A;  2D8J A;  3EG2 A;  3I35 A;  2A36 A;  3EG1 A;  4D8D A;  1PRM C;  1EFN A;  4ESR A;  2D1X A;  1SEM A;  2G6F X;  3I5S A;  2PZ1 A;  1AZG B;  2QDL A;  3IQL A;  3GBQ A;  5IHK A;  1UE9 A;  1NEB A;  1UHC A;  2KYB A;  1WFW A;  2KE9 A;  2V1R A;  2KYM A;  1JEG A;  1X6B A;  2DBK A;  2RQR A;  4AFQ C;  4F17 A;  3H0F A;  4RTV A;  1E7O A;  2CDT A;  1NLP C;  1U3O A;  1GCQ C;  3VS1 A;  4FSS A;  4LNP A;  4OMN A;  1RI9 A;  4IIO A;  5GJV B;  4RUG A;  2EVR A;  2YT6 A;  4X1V A;  3TVT A;  2LCS A;  2PNI A;  1RLQ C;  3I5R A;  4JJB A;  1Y0M A;  5IXF A;  2KRO A;  2KGT A;  2ESW A;  2BZY A;  1VYU A;  3SHW A;  1QLY A;  1PKT A;  2F2X A;  2DE0 X;  1NYF A;  1ZUU A;  1AWJ A;  2EYW A;  4HVV A;  4M4Z A;  4RTT A;  3VS6 A;  3VS4 A;  4AFZ C;  1UTI A;  2A28 A;  1WXU A;  1UGV A;  2F2V A;  3FJ5 A;  1GBR A;  1GFD A;  1QWE A;  1NM7 A;  2L2P A;  4HVW A;  2EGA A;  4RTU A;  4AFS C;  2J6F A;  2O88 A;  2SRC A;  1OEB A;  4RTY A;  1AD5 A;  2DRK A;  1BU1 A;  1IO6 A;  3R6N A;  2GBQ A;  1VYT A;  4RTW A;  1WI7 A;  1T3L A;  2JS0 A;  4JJD A;  1PHT A;  1WX6 A;  2FPE A;  3EG0 A;  1M3C A;  4JPB W;  2BZX A;  3VRY A;  1YN8 A;  4J9I A;  2KNB B;  1PWT A;  1OOT A;  4OMO A;  2JMA A;  2CT3 A;  4J9H A;  2FRY A;  2D0N A;  1HD3 A;  2L3S A;  2J06 A;  2HEQ A;  2AKK A;  1HJD A;  2CUD A;  4J9E A;  2X3X D;  5I11 A;  2DX1 A;  4Z8A A;  3VS5 A;  2OAW A;  2V1Q A;  2DL5 A;  1YWP A;  1ARK A;  2E5K A;  1AWW A;  3VS3 A;  2EYY A;  1ABQ A;  2KRS A;  2YUQ A;  2ROL A;  3VS7 A;  2J05 A;  1NEG A;  2J6K A;  2H8H A;  2LJ3 A;  3M0U A;  5FW9 A;  3UA6 A;  4CC2 A;  1ZSG A;  4D8K A;  1XOV A;  2VKN A;  2DMO A;  2RPN A;  2CT4 A;  3QWY A;  4AG1 C;  5IXB A;  3VS2 A;  4KRT A;  1ZUY A;  2JM9 A;  1H8K A;  1GCQ A;  4OML A;  3JV3 A;  2DA9 A;  2DL7 A;  2YDL A;  2PTK A;  5FWB A;  2CH4 A;  1M3B A;  1UDL A;  2SEM A;  3LH5 A;  4EIK A;  4CC7 A;  5IHI A;  1BK2 A;  1X2Q A;  3EHR A;  2AZV A;  4LUD A;  2K3B A;  4Z88 A;  2O9V A;  1NLO C;  4J9F A;  2JMC A;  3EG3 A;  1Y57 A;  3H0H A;  4ORZ A;  1K9A A;  4LN2 A;  1RLP C;  3REB B;  1X69 A;  2CSQ A;  4A63 B;  1AWO A;  1KSW A;  1MV3 A;  2DRM A;  2DL4 A;  5GJW B;  1MV0 B;  2EBP A;  3C0C A;  1Z9Q A;  4ZNX A;  1WLP B;  3CQT A;  3EGU A;  3SEM A;  1UEC A;  3A98 A;  1QCF A;  2RN8 A;  4OMQ A;  2L3Q A;  1NG2 A;  2DL8 A;  2CH4 W;  4CC4 B;  2GGR A;  5L23 A;  1KIK A;  1QKX A;  2LQW A;  3M0T A;  4JZ4 A;  2LMJ A;  4RTX A;  2O31 A;  1M27 C;  4CC3 A;  3M0P A;  1BBZ A;  2J6O A;  4JJC A;  2MIO A;  2L3P A;  1AZE A;  4GLM A;  4DEY A;  1RUW A;  2EYX A;  4HXJ A;  5EC7 A;  2XMF A;  3H41 A;  4K11 A;  2MOX A;  2FEI A;  5HCK A;  2CRE A;  2P4R A;  1K0S A;  1I0C A;  2L0A A;  1N5Z A;  1SHF A;  3THK A;  1FYN A;  1ZBJ A;  4RTZ A;  1UJY A;  1PRL C;  1GCP A;  2J7I A;  2DJQ A;  5IH2 A;  1JO8 A;  2DNU A;  2KXD A;  2A37 A;  2FPF A;  2K9G A;  1JXO A;  4JZ3 A;  3M0S A;  1AOJ A;  1AWX A;  1OV3 A;  2YUN A;  4OMP A;  1KJW A;  4F14 A;  1X2K A;  1SRL A;  2LZ6 B;  1AEY A;  2KR3 A;  1T0J A;  3PE0 A;  4HVU A;  2M0Y A;  2BTT A;  2EW3 A;  4AFU C;  3NHN A;  1ZX6 A;  1VYV A;  4J9B A;  3TSW A;  4Z89 A;  1W70 A;  1V1C A;  2KEA A;  2ABL A;  2DIL A;  1KFZ A;  4OMM A;  1U06 A;  2KXC A;  2MCN A;  1B07 A;  2JS2 A;  2RNA A;  2RF0 A;  2RMO A;  2I0N A;  1G83 A;  1TUD A;  2RQT A;  1TG0 A;  2M51 A;  1GFC A;  2DL3 A;  2GQI A;  1I1J A;  5FWC A;  1HSQ A;  2JT4 A;  2K7A A;  2JXB A;  2HSP A;  2DYB A;  2BZ8 A;  2VWF A;  3RBB B;  2A08 A;  1AVZ C;  2X3W D;  4DEX A;  2EKH A;  2OI3 A;  2DM1 A;  2ENM A;  2FRW A;  4R0K A;  2NUZ A;  1PKS A;  1X6G A;  2O2O A;  1CKA A;  2LX7 A;  1OPK A;  2CSI A;  3NMZ C;  2FO0 A;  1GRI A;  2KT8 A;  1A0N B;  4LE9 A;  2JW4 A;  4GBQ A;  2D8H A;  2AZS A;  2HDA A;  1WIE A;  1B3Q A;  1ZLM A;  3QWX X;  2C0I A;  4E6R A;  3ULR B;  1YCS B;  3I9Q A;  1UG1 A;  1YWO A;  3PVL A;  2ED1 A;  1JXM A;  4J9D A;  1ZUK A;  2KRN A;  3UA7 A;  3UF4 A;  4IIM A;  1QWF A;  2KT1 A;  1M8M A;  3UAT A;  1WXT A;  4Y92 A;  2AK5 A;  3RNJ A;  1CSK A;  1BB9 A;  2K79 A;  5ECA A;  1YP5 A;  2IIM A;  3H0I A;  3PVQ A;  1SPK A;  3EHQ A;  1GL5 A;  1W1F A;  3KFV A;  2GTO A;  2VVK A;  1UHF A;  1H92 A;  3U23 A;  1NYG A;  1K0X A;  1ABO A;  2KRM A;  2HBW A;  4LUE A;  3TSZ A;  2RQV A;  3O5Z A;  2OJ2 A;  5I22 A;  2FG0 A;  2EGE A;  1H3H A;  2EQI A;  1K76 A;  2B86 A;  1E6H A;  1FMK A;  1W6X A;  1J3T A;  2C0T A;  1JU5 C;  1T3S A;  1G2B A;  2LP5 A;  2JM8 A;  2LJ0 A;  1TUC A;  2EPD A;  1WDX A;  1YNZ A;  2DVJ A;  2RQU A;  2YSQ A;  2ROT A;  2DF6 A;  5IHN A;  1M3A A;  1K1Z A;  1QKW A;  1E6G A;  1X27 A;  4J9C A;  4WCI A;  1U5S A;  2W0Z A;  2K6D A;  3VRZ A;  1K4U S;  3ZL7 C;  2DLP A;  2CUB A;  1S1N A;  1SRM A;  2ED0 A;  2LQN A;  4AG2 C;  2EGC A;  1T0H A;  3NPF A;  1VA7 A;  1M30 A;  2GTJ A;  2RQW A;  1LCK A;  2KBT A;  1UJ0 A;  2EYZ A;  1SHG A;  2FPD A;  1I07 A;  4QT7 A;  2K2M A;  2LJ1 A;  3VS0 A;  1WA7 A;  2O9S A;  1OPL A;  2JTE A;  3NGP A;  2ECZ A;  2GNC A;  1JQQ A;  2YUP A;  2C0O A;  2DBM A;  3M0Q A;  1MUZ A;  3REA B;  2YUO A;  1WYX A;  2AKL A;  1WXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...