1KG1A

Nmr structure of the nip1 elicitor protein from rhynchosporium secalis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
b'DRCRYTLCCDGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYRQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Necrosis Inducing Protein 1
publication title Solution Structure of the Plant Disease Resistance-triggering Protein NIP1 from the Fungus Rhynchosporium secalis Shows a Novel beta-Sheet Fold.
pubmed doi rcsb
source organism Rhynchosporium secalis
molecule tags Toxin
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.460 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kg1A02
1KG1A
chains in the Genus database with same CATH superfamily
3CD6T 2DK3A 3HRUA 5CKFA 3G4SQ 3REBB 2XKOC 5GANh 4M77G 3VJPA 1RADB 3JB9D 5IH2A 5FU7B 5GAMh 3CCVA 4C0GA 1OI1A 5KYWB 3CCQQ 2DERA 2QQBA 3V7CA 3V8LA 3CD6Q 4OB2B 3VRZA 4IUUA 4C92B 4C5GA 3CCEA 4IUQA 4M75E 1VQOA 2LT1A 1VQKA 2VUBA 1ZHIA 4A53A 1AZGB 1ACMB 2CZ7B 2EYWA 3VS6A 2CH4W 2RHZA 4JZ4A 1NJIU 1VIFA 1SG5A 4F7UA 5GAMg 3UWNA 2DE0X 2QGFB 1BK2A 3OSVA 1LCKA 1WZOA 1YHQT 1Q7YU 1Q82U 1VQMT 4C0FA 2JXBA 2KAFA 3OBYA 3CXCP 3JB9H 4AT1B 2C0TA 2CH4A 1BCOA 1UFFA 1SRMA 4KH0B 4A4EA 4VUBA 3SD4A 4M78B 2CKKA 4MZTA 2W0ZA 2KDSA 3RDVA 3OA6A 1GCQA 2DL3A 2MAMA 2RI2A 5A2QE 2COYA 1OYXA 1RL2A 3A8GB 4BI4A 1VQ9T 2DFUA 4IKFA 1VQMQ 2ENMA 2CP3A 2ZPIB 3CBMA 5A0LA 3JB9G 2E6ZA 2OX7A 5DM7R 3OS5A 2JZ2A 3VS5A 2K7AA 5LJ5h 4RTTA 2X4YA 2ED0A 1VQ9Q 5I11A 2JW4A 2ABLA 2F69A 2O31A 4NOYA 2KVQG 3X26B 1Q81U 1UGQB 2RHIA 2RJFA 3M55A 3EGDB 2NYSA 1M90U 2LX9A 2WSEE 5HK3A 2V8JA 3EG2A 2DRMA 2M0YA 3QWYA 4PJLA 1EIFA 2KMTA 1EX4A 2XIDA 5LJ5g 3MEAA 2GQVA 1C0MA 3VS7A 3TCJA 1R0BG 1FX7A 1K73C 4LDVA 3Q1JA 4J9EA 3PMTA 2B8AA 5KCHA 4M77C 2VASA 2ZPBB 1EFNA 3L1AA 1JEGA 5FU6C 4PJOB 4BY6B 1NYGA 1TOVA 2XI9A 4B9XA 5KYWA 1VQ6T 4LE9A 1YITA 4BI8B 1YBYA 4EMGA 1GXIE 3S6WA 2FPDA 1TUDA 4C92A 3META 1VQ8T 3CCUT 1QVGA 1X75C 4JDSA 3CC7A 4JS4A 3M9QA 2QQSA 1GCPA 3VUBA 3M58A 4BDZA 2GQIA 3OYNA 3CCMA 2COWA 3MEUA 2FYKA 1QVPA 1VQ6Q 3CPWS 2MCNA 3V7SA 1SHGA 4KRTA 4XU3A 4PKCC 2A37A 1YJNT 4F17A 3CCUQ 2YUOA 3VU3C 3KFVA 3J81E 1RAHB 3RKYA 1JU5C 1VQ4A 1WFWA 4Z89A 2L3RA 2YWWA 1VQNA 1WXBA 2FPEA 4M78A 1YI2T 3LH0A 4BE2A 4AG2C 2L89A 3MEVA 4XTWA 1YJNQ 3WVDB 2YHTA 1QVFA 4PLIA 4IUTA 1R77A 4HCBA 1Y07A 2QTXA 2A28A 4Z02A 5HY6A 2HBWA 3PTAA 2KGTA 1SKUB 1N27A 3JCMX 1YI2Q 1K9MR 3OYCA 5GMKi 1JBMA 2JJ9A 1TUGB 2YLCA 3TREA 2HBPA 2ED1A 1QWFA 1RAAB 4QQDA 4M75D 2L3QA 2XU8A 1OV3A 2DL4A 2XDDA 3JCMQ 2SRCA 2OAUA 1VYUA 1YJ9T 3QSUA 1MMDA 4K11A 4C8QB 3G4SA 2QQ9A 4JRIA 1NPRA 1KQSS 1K8AR 2QDYB 3RMSA 1BKBA 2XDBA 3OYBA 3S3NA 2RM4A 1O9SA 1YJ9Q 2O88A 2X3WD 1WHJA 3C4SA 4J9DA 3G71T 4HCZA 2RNAA 4FSSA 2HQXA 2YSQA 1X6OA 1RACB 2EQMA 2DMOA 4ORZA 1K73U 1BIBA 1EZZB 3OYEA 2I0NA 4PJOA 3H8ZA 3CCVT 4BY6C 3UDCA 1B7TA 3G1JA 3QJYA 2X4WA 2CT3A 1MMGA 2E5QA 4PK4A 3CEYA 2DRKA 3QYHB 3CCET 2VB6A 1VQOT 2QK0A 2K79A 4FT4A 4BACA 1YFNA 2DJZA 3URGA 5M9OA 1MMAA 1N8RR 3M4YA 5GANf 3FEOA 2AIRB 4M75B 2J06A 2J6OA 2KR3A 4FU6A 3HSBA 2KNBB 4FL6A 2PVDB 1JQQA 3L42A 5J26A 3VS2A 4N4HA 1T3LA 1YIJQ 3CCEQ 2PZ1A 2YUPA 4DBFA 3CCSQ 4DA4A 1TTHB 3JCMJ 4XTYA 3EH1A 3ZL7C 4M7AE 3OYHA 2VXFA 1S1NA 2VWFA 4R55A 4R0KA 2HQHA 3FRNA 4M7DF 5KYNA 4OMPA 2LDMA 2CP5A 1YWPA 1RABB 1UG1A 1OOTA 1KG1A 2QGGA 5KYUB 4E2FB 4FSXA 1N5ZA 5EG2A 3P8BB 4WF2A 1PD1A 1KIKA 3LYIA 1KD1U 1YWOA 1QP2A 4M7DA 3V8JA 1BI3A 1SRLA 3H9NA 2LVMA 4AFZC 4E47A 3RNJA 3OS2A 3EG3A 2EKHA 4AFUC 2EJGA 3CXCS 1KK7A 4DBRA 3AT1B 5CR2A 3M5AA 1I8FA 5L23A 4NL3A 3CCRA 1IB8A 3MPUB 1UUEA 2RQRA 3GIBA 2P84A 4C8QA 2EWNA 3PGGA 1AOJA 4ZTJA 3NHNA 3F70A 2CDTA 4ZTFA 3L2QA 3AHUA 2CZ6B 2JUFA 4BE1A 2KT8A 3M53A 1U06A 1KC8C 2BZYA 2E70A 3THKA 1YNZA 3ZBDA 1PKSA 3ULRB 2X4JA 5GAOq 2Y4YA 3CPWP 2QASA 3HFNA 3OYDA 2C0IA 4RKUE 2K9GA 1IXDA 1JXOA 2A36A 2VKNA 1M1GA 4F16A 2KK4A 3CBOA 2AZVA 4FYYB 1G5VA 1LOJA 3HTRA 1ZQ1A 1JO8A 2E1HA 5FW9A 5LJ3g 1W1FA 4EMKC 1RAIB 4RCCA 2XDPA 2AZSA 1YITT 2FHDA 2DD4A 1V76A 2IG0A 2XICA 5AT1B 1HXDA 2DD5A 1FMVA 2LNVA 2EGCA 4J9CA 2RA2A 2LC4A 1M1KR 3CC7T 1YJWQ 4MMKA 2EKOA 2L8DA 4L6V5 1BI1A 2RI3A 2RJEA 3JV3A 3LLRA 3TSZA 4KULA 3CCMT 1RLPC 2HD0A 2G6FX 1JRIA 4OGCA 4C5IA 3TU4K 3PE0A 1YITQ 4F7UG 3I35A 2M51A 4N4GA 5GAOl 4KGZB 2LTOA 1BIAA 3CC7Q 3H6ZA 1U1TA 2KY9A 3JCMW 1NEGA 1VQ4T 1PNJA 2W10A 3E9GA 1GBQA 3CCMQ 4MMLA 2FO0A 1YI2A 2F5TX 3WVEB 1VQNT 2E64A 2V1RA 1KJWA 2KI7A 4C5HA 2QQRA 5GAMe 3GP8A 1I1JA 2V8IA 3TSWA 3S3OA 1I07A 5KYYA 2J6FA 1WYXA 2K5IA 2WSCE 3QJ6A 4J9FA 1E7OA 1VQ4Q 4C92D 1OEBA 1Y0MA 3FJ5A 3LH5A 3OYKA 2Z0WA 2LCLA 1VQNQ 2YRDA 2JTFA 1K0SA 2O4XA 5GJVB 3EG0A 2PUOB 5GAN2 4JZ3A 2D9TA 2QI2A 2JS0A 2XK0A 1I5OB 2EGAA 4KT0E 1WDXA 2JM8A 1LJOA 3HP9A 2RHXA 4KUDK 1W2BP 1WIEA 1OU8A 4N0AA 2PVGB 4M78D 4DEYA 3RUXA 3VRYA 1D1CA 5FRNA 1H641 1RLQC 3MEWA 2FG0A 1KC8U 2RMOA 3O8VA 1Q86R 4ATOA 1AWOA 1NEBA 2X3XD 3VKIA 1PD0A 3LWHA 4XTZA 1RI9A 5HCKA 1X43A 2L3PA 3HHTB 4PJMA 2I2LA 1WHMA 1ZSGA 4LDYA 4ELZC 3L2WA 5LJ5e 2NUTB 2BZXA 3C94A 1QLYA 4LXCA 1YIJA 2CZ0B 1AZEA 3CCSA 4C92G 2K57A 1HD3A 3JCMV 3CMAA 3MP1A 1WHLA 1SSFA 2KE9A 4RG2A 1FYNA 1MHNA 2P0PA 3E2UA 4E7LA 5CKBA 1D0ZA 3RERA 3CC2A 1D1BA 1MV3A 4J7FA 1FXXA 3SWNB 5GAN4 2H3JA 4ZNXA 3L2VA 1T3SA 2EQKA 5I22A 3VYHB 3HKSA 2HQEA 1FMWA 4Z88A 4JS5A 3DLLA 3KXTA 3UT1A 3UPUA 5DLQE 1VQPA 4JLIA 3QPHA 1M4ZA 5IAYA 2DTIA 1N9SA 3WXMB 4CC4B 3SHWA 2RF0A 4M78G 1IHVA 1IZ6A 2LJ0A 3CCLA 2MF2A 4PJOD 3EFSA 3OMGA 2DETA 1FMKA 4DBQA 1WJRA 3FC3A 2PQWA 4C0DC 3RIRA 2AKLA 3R6OA 1VOMA 5GANd 2RI5A 1ZSZB 4IUVA 1XOVA 5IHNA 2YUQA 1KFZA 1OPLA 2F5KA 3NPFA 2EQJA 3N5BB 3HFOA 4KUIA 2GGRA 2ZZDA 3JRZA 4JRKA 3CPWA 2EGEA 1QCNA 3OSSC 3PT9A 4FYXB 1ZUYA 1A0NB 3CCRT 2D8HA 3OBWA 3CCJA 2V26A 2M02A 3LWIA 2EIFA 5D6YA 3VS1A 2JTEA 5CIUA 2K5LA 1VIEA 2WSFE 4RTUA 4A4KA 2GFAA 4QKUA 1NYFA 4FYWB 3QXEB 5KYXA 2J05A 4J6YA 3CCRQ 4HVWA 4M77F 4OMQA 3U23A 1X6BA 3NTIA 3OB9A 2RH2A 3QDFA 2HMAA 1YJWA 1GFDA 2CS7A 8AT1B 5FU7C 1TG0A 5CK9A 3OS0A 1VQ5A 4PJOG 2AHJB 3IQLA 4GLKA 4M7DD 4BUGA 2NUTA 2ZPGB 4M77A 1WI7A 3M54A 3EAEA 4C92C 1LNXA 1YN8A 1KSWA 1D0XA 5GJWB 4C8QD 4FW2A 1NE8A 4LD6A 2CGHA 5CAIA 2X4XA 3TQ7P 2QXFA 4J9BA 2M16A 3SWNA 2P4RA 4R56A 3I5RA 1BI2A 4OB0B 5GMKl 2D0QB 1KQSA 2K3BA 1X27A 1TSFA 3X20B 4M7AF 1WPYA 2E10A 2HEQA 4XQ3A 3UATA 1G83A 2RQWA 1I0CA 5LJ3j 2R57A 3QYGB 3JCMc 4A54A 1G8XA 2KT1A 5J39A 2V8KA 4OMMA 3INZA 1WXTA 4M78C 4ELYC 1E6GA 4RMOA 4RTZA 1GL5A 5IXFA 1K4US 4M7AA 3JB9F 4HA8A 4XTXA 1J3TA 2EYQA 1I81A 2KXCA 2DIQA 2BE9B 3CBPA 4M7DB 1ZSZA 1RI0A 2HKNA 1Q82R 1Q7YR 1QKXA 4M7DG 3P8DA 1WQWA 4A63B 3BY7A 3O5ZA 1Q86C 4II1A 2M0OA 1WX6A 2DJQA 1JJ2P 4BDYA 1MMNA 1M3AA 5CQXA 3H41A 4C8QG 1PM3A 4OMOA 4B6MA 1QWEA 3QBYA 3GF5A 3JB9I 5GMKj 1M3CA 1WXUA 1UHCA 4LD9K 4FM4B 3OYAA 1GBRA 4D6WA 1R0CB 4HVVA 4DQ2A 3QIIA 2ZAEA 1G3TA 3JCMf 1ZA2B 3M0RA 4IIOA 4EMHA 3DB3A 5I2MA 2DYBA 3I9QA 1Q81R 1WJSA 4M77E 2EAYA 2E4HA 3H0HA 3I55Q 2HZYA 3SB2A 2DBMA 2BZ8A 1M90R 2YRCA 4YTLA 4A4FA 1OU9A 4PJOC 1Y96B 2CSIA 5D6WA 1Y7XA 1QQJA 4JJDA 2PVOB 3OQ5A 1AWXA 2QEXA 1YIJT 2E5KA 4HT8A 4Y91A 1YCSB 5GAOm 3CCST 1W2BS 3CXCA 1MV0B 2F2VA 2MWPA 2NLUA 3NMZC 1QP3A 1PWTA 3CMAT 2A08A 1K9AA 1UGRB 3RKXA 1OZ3A 5D7UA 3V8KA 5GAOp 3EHQA 1WGSA 4M75G 3GPLA 5GAMf 4E7SA 3CC2T 2RPNA 5LJ3e 1NM7A 2DKGA 2ZGWA 2DA9A 5IN1A 3CMAQ 4C0ZA 5CVIA 2FB7A 4RTYA 1VQPT 2K6DA 1M2OA 2ZPFB 3QUIA 4IUPA 4D8KA 2E12A 1X01A 3MJXA 2K3YA 4OF1A 5I2SA 4ANJA 3CC2Q 2NUPA 4OB1B 1M8VA 3OYJA 2C06A 5KYYB 1AEYA 2LJ3A 3CCLT 3ZEHA 3CC4A 4Q5WA 5CKDA 2HL5C 1U8RA 1VQPQ 1WHHA 2DXUA 4Y28E 1UGVA 1ZLMA 4KGXB 4M7DC 2GF7A 4EDUA 2O4XB 4CC2A 5GANj 3CCLQ 1PRLC 4XTVA 4O6JA 2RHYA 2EJFA 3X28B 7AT1B 4FCYA 4C8QC 3CCJT 2DVJA 2EQIA 3NTKA 3M0PA 2DAQA 4OMLA 5LJ3h 4ZN1A 5HKCA 1PCXA 5LJ5f 2LCCA 3BFMA 1M30A 1RAFB 2DTOA 2M1HA 4F14A 1NBEB 1D3BA 4BD3A 2DM1A 2IPOB 8ATCB 3VS0A 5IHIA 1W70A 3JCMb 2OTLA 1QKWA 1WHKA 1UHFA 3CCJQ 3E19A 4C5EA 3PVLA 3E9FA 2J6KA 3C12A 4N4IA 1YJWT 3X24B 2RHUA 2KRMA 3CQTA 2RK2A 1V1CA 1Y96A 1VQ5T 1NG2A 1UEBA 2LZ6B 2HCKA 2D8JA 1AWWA 3C95A 1S72A 4F04B 1Z9ZA 4TVRA 4ZN3A 2O01E 1GRIA 2H8HA 1IREB 3GLXA 3EH2A 1P92A 1IGQA 2QG9B 3VV0A 4JUVA 2VV5A 4M75C 1VQ5Q 2F1LA 3SEMA 1OPKA 4PLLA 5GMKh 1K0XA 2F2WA 1WQ7A 2GTJA 1K73R 2JVVA 2NUZA 3EHRA 1K9MC 3REAB 5GAN6 5KH6A 4J9IA 2CT4A 5J3BA 1PKTA 1PSEA 2LT4A 2HKQB 2Y90A 5FROA 2LQ8A 2L0AA 2EYYA 4GY5A 4PFPA 4J5YA 1G2BA 2WACA 3NFCA 1WA7A 2F2XA 2O9VA 3I5SA 1ZBXA 3JSCA 1PG5B 2OTJA 3M56A 1NLPC 1Y71A 3H0IA 2CP0A 2ATCB 4Z8AA 4DOVA 4DBHA 2JM9A 3EG9B 3M59A 4M77D 2LCSA 1K8AC 1VYVA 2LP5A 4CC7A 3VYGA 3R6NA 1U3OA 4XK8E 2PU9B 1VYTA 4PNOA 4WCIA 5CKHA 4QQGA 5CO7A 2CP7A 2QAZA 1H8KA 3PFSA 1GFCA 3QHSA 2VGNA 4A4GA 2AT1B 3I56A 3DLMA 3QZ9B 1CKBA 2ZPEB 3I55A 5FWBA 2BTTA 2XMFA 2RB6A 2EJ9A 4AMCA 5KYXB 2VC8A 1KD1R 4FW1A 4N0AC 4OB3B 2GNCA 2YT6A 2K5FA 5AYFA 2R5MA 1K76A 3SFMA 3CMEA 1N8RC 2QTVA 1RAGB 3M0SA 4M7AD 2MMPA 1MGQA 1SEMA 3J7AF 1OZ2A 3MP6A 1F1BB 1UE9A 5FWCA 2D6FA 2DBKA 4V2SA 2DEUA 4O5VA 4IURA 1JJ2S 4M77B 1M3BA 1AWJA 3JCMg 1MNDA 3EFOA 4M4ZA 2LJ1A 5FU6B 2KROA 3EGXB 2QEXT 1D0YA 1UTIA 1U5SA 2RJDA 5GMKm 4QVDA 3OYYA 4OMFB 1XQHA 2EFIA 4F7UF 1IRXA 3MKDA 3MP8A 1KQ2A 2FVUA 3OW2P 1UGSB 2DPPB 1RUWA 5KE2A 3QG1A 1Y57A 1UECA 1BI0A 3DB4A 2QEXQ 3KBGA 2P0KA 2HDAA 3JCMd 3BDLA 2HSPA 2LX7A 2BE7D 5GANg 2GBQA 1BCMA 3UA6A 4IIMA 3NGPA 4QT7A 1IHWA 3M57A 3GOXA 1K9MU 2RN8A 4KH1B 1UDLA 2KEAA 1GCQC 3M0TA 3T9NA 2P4TA 2BIVA 4M7AB 2YDLA 1IGUA 4X9DA 4XTUA 1PC0A 3QWXX 3JB9J 1M8MA 3HPWA 3CC4T 4M7AG 2XD0A 1T0HA 1G3SA 5A0DA 1JB0E 2EQUA 3EG9A 2KXDA 3P8HA 4J8OA 4RTVA 5GAOr 1VA7A 3EGUA 3G6EA 4BE0A 2QDLA 1YHQQ 2HAXA 5FLXE 5GAMd 1UB4A 4HT9A 5GAOn 2DX1A 4E7KA 5ECAA 1TUCA 4CRIA 3L2UA 4RG8A 1K8AU 2D1XA 3FJPA 2L5QA 1X2KA 3CC4Q 3ME9A 1HJDA 3PVQA 2JTMA 2FZGB 4QQ6A 1OULA 3A8OB 4LNPA 2FZCB 2CUDA 2A7YA 4LN2A 1UJYA 4WTOB 3QKJA 3LGFA 2K2MA 2YLBA 1Z9QA 3OYMA 4LDXA 5IHKA 5D6XA 1M1KC 1AVZC 1WHGA 2DEQA 3HL8A 1B34B 1QW1A 2K3XA 1QCFA 1M2VB 4J7IA 4HXJA 5I21A 2OTLT 4UC4A 4PJNA 1VQ7A 1YCYA 2V1QA 2ECZA 1NZ9A 5CCAA 1O75A 4EIKA 1N8RU 1TU0B 3MCAB 2JT4A 4E7JA 1KHCA 1G3WA 3ZFJA 5LJ3f 4JLGA 1MNEA 4Y92A 2DYIA 4C92F 2DLPA 2YRVA 1WJQA 4FYVB 3OY9A 1E6HA 1S72T 2OTLQ 3EGXA 4XU2A 1IO6A 1V29B 2X51A 3MHXA 1R8OB 3OYLA 1W4SA 1PRMC 4D8DA 2OAWA 5LJ5d 2QA4A 2MPXC 1H92A 1KC8R 4F7UE 1HSQA 1RAEB 2DL7A 5DLOA 1S72Q 3OS1A 3PIOA 3SWNC 2CSQA 4X1VA 1JXMA 1X2QA 1SSHA 3A8HB 2DZCA 1ZA1B 4M78F 2MK5A 2NUPB 3CPFA 3VS3A 1VQ8Q 3ER0A 2RQVA 2VXEA 2OTJT 2MOXA 1UJ0A 2FZKB 1HK9A 2LRQA 1NJIR 4M7AC 2DXTA 2QQAA 2EVRA 4QW2A 3BDUA 1TS9A 2FEIA 2KRSA 3M4GA 1ZUUA 5GAN3 1ZSZC 1KD1C 1W2BA 3OYIA 3ASKA 3UF4A 1BBZA 2L3SA 2LQNA 2OTJQ 3RR6A 1G3YA 2MWOA 2DTHA 1C6VX 1TXQA 3OYFA 2K4YA 1HYOA 4JJBA 2HSEB 4L59A 3HRTA 4ME7A 2SEMA 4HKEA 4RTXA 2DF6A 4X9CA 2JN0A 4X34A 1QVGS 4L5GA 4E7IA 3I56T 3I55T 4AFSC 2HL3A 1VQLA 4GBQA 2RK1A 3VUZA 4PFZA 1D3BB 3H0FA 1UGPB 2KBTA 3A8LB 4GLMA 3EGDA 3JCMP 2LQWA 2FPFA 3GNGA 4DOWA 2PUKB 4PJJA 2KSSA 4LUDA 3L2RA 2JMCA 2IVWA 1B34A 1XNIA 4LDWA 5GAN7 2G3RA 1DJ7B 3RMQA 2E6NA 4PFOA 1M2VA 3CMET 3FB9A 3I56Q 3SDZA 1M1KU 3CCQA 3EFRA 4PJOF 2MI6A 1TWBA 2L2PA 4JJNK 4MDXA 3CD6A 3RBBB 1ZX6A 3BE3A 2DZ9A 3A1PA 3FLGA 3OW2A 2CP2A 4OMNA 4PL6A 4BB7A 1WLPB 2FRYA 4C92E 3CMEQ 5HK0A 3GBQA 1QVFS 2CREA 2E3HA 1VUBA 4LDUA 2CUBA 4EMKB 9ATCB 1PSFA 1QMCA 2B86A 3G71Q 3QO3A 1BYMA 3C0CA 3PNWC 1K1ZA 1SHFA 1VQKT 1N6AA 3LX7A 4JPBW 4P5NA 4HCKA 2EYZA 2ROTA 4OVAA 3CCVQ 2E41A 4XAXB 2J7IA 2PNIA 2YXYA 1C1AA 1ABOA 1KHIA 2BKDN 2RJCA 1YHQA 3M0QA 1VQMA 1TH7A 2KYBA 4M78E 4LUEA 1U1SA 2H3EB 4XU0A 1VQOQ 1XTDA 1VQKQ 4OP0A 3LW5E 3X25B 1WNLA 2KYMA 2JOYA 2VYTA 1CKAA 1D09B 2CP6A 2X9HA 1M27C 5A0GA 3PIPA 4ZGDB 4ZGJB 5FRMA 1VQ9A 1QCOA 3OW2S 2EPDA 2O2OA 1X6GA 3G6ET 4QVCA 2VGMA 2K2VA 1N9RA 4FIBA 2DL5A 2ZPHB 3KUFA 5GAMj 3L2ZA 1YP5A 2LMJA 5GMKe 1OX8A 4C8QF 2DNUA 2PTKA 4FT2A 4E6RA 5L8RE 1XJWB 1Q86U 2JNGA 2LNHB 2OJ2A 3A8MB 3G6EQ 4XU1A 3UA7A 3NTHA 2FL7A 4JJCA 4RCBA 1AD5A 1B07A 4DEXA 2CYZB 5KCOA 1D1AA 4AG1C 5IXBA 5DY9A 1CSKA 1KQ1A 1X69A 4QVZA 2E65A 1VQ7T 1MUZA 2AK5A 2DO3A 2C0OA 1AT1B 1M1FA 2DL8A 4KGVB 1B3QA 2RO0A 4PJOE 2CZ1B 3EG1A 2BUDA 3FIFA 3EFOB 3V7RA 1FWZA 2EBPA 3LGLA 3TVTA 2RD1A 2A3LA 1OQKA 4CI0C 2MIOA 2RQTA 2XG8D 2DXBA 3M0UA 4B9WA 2GCXA 3J80E 1VQ6A 1VQ7Q 2OI3A 2R5AA 4EMKA 2YUNA 4M75F 3E1SA 4CC3A 1SF9A 4ESRA 2QA4T 1VQ8A 3CCUA 1AHJB 2A0FB 3GNFB 5CKEA 1NJIC 3MO8A 3VS4A 4JRPA 2E3IA 1SPKA 4J9HA 2HNIA 5C6SA 5GAN8 2P0QA 5KE3A 4MDWA 5LJ5j 3JCMe 4E7HA 2NWMA 4E7ZA 2EYXA 4J6WA 3HRSA 1T0JA 4EPCA 1Q7YC 1Q82C 4M75A 4F7UB 2ESWA 4JRQA 2DVEA 3G7ZA 1YJNA 2QA4Q 3S3MA 4HCCA 2COZA 5LJ3d 3A98A 1LPLA 1QVGP 1M5Q1 1M9SA 2Y4XA 3OMCA 1Q95G 4RTWA 4ZGEB 2ZCFB 2EW3A 4RUGA 1JJ2A 1I5LA 3OYGA 4J6XA 5GANe 1NLOC 2GFUA 1H3ZA 2MYSA 1BB9A 1H3HA 4M7DE 3RKWA 2QYZA 4C0DB 1ABQA 4KBMB 4J83A 1KQSP 5CQYA 2KRNA 4AFQC 5KYUA 5LL6S 5C0MA 2R58A 2JMAA 2DXCA 3FDRA 4J9GA 2X35A 2LQKA 1ZUKA 1Q81C 3A5ZB 3BW1A 4NS5A 4BI3A 5IT9E 1NPPA 2O9SA 4MZPA 2AKKA 4MZMA 1M90C 2IIMA 4C8QE 1W6XA 3D7SB 2VVKA 1ARKA 2FRWA 4NL2A 3JAME 1QVFP 2JS2A 1VQLT 2ROLA 3JCMh 1YJ9A 2DILA 2D0NA 1BU1A 3TEEA 3QZ5B 1ZBJA 3RESA 1PHTA 2XHCA 3G4ST 1OX9A 4HVUA 4OGEA 2GTOA 2DIGA 2RQUA 2KQWA 1I4K1 5GAN5 3DKMA 1LVKA 3CCQT 3PMIA 1VQLQ 6AT1B 2M9UA 3QDRB 3G71A 4A4HA 5EC7A
chains in the Genus database with same CATH topology
3CD6T 1N8RU 3MCAB 2DK3A 3SB2A 4E7JA 1KHCA 1M1GA 3HRUA 1G3WA 2KK4A 5CKFA 3CBOA 3ZFJA 2XKOC 5LJ3f 5GANh 4JLGA 4YTLA 4A4FA 4M77G 3VJPA 4PJOC 4C92F 1Y96B 5D6WA 4M7DB 3JB9D 1G5VA 1Y7XA 1LOJA 5FU7B 1ZQ1A 2YRVA 2PVOB 5GAMh 3CCVA 1WJQA 3OQ5A 4C0GA 2E1HA 1OI1A 5LJ3g 3OY9A 1S72T 4EMKC 4RCCA 2QEXA 2XDPA 4XU2A 1V29B 1YIJT 1YITT 2QQBA 2FHDA 3V7CA 4HT8A 2DD4A 3MHXA 4Y91A 1R8OB 2IG0A 2XICA 3V8LA 5GAOm 3OYLA 3CCST 1HXDA 1W4SA 2DD5A 3CXCA 2NLUA 1W2BS 2MWPA 4OB2B 4IUUA 4C92B 1QP3A 2LNVA 4C5GA 3CCEA 4IUQA 2RA2A 2LC4A 4M75E 5LJ5d 2QA4A 1VQOA 2LT1A 3CMAT 3CC7T 4MMKA 1VQKA 2EKOA 2L8DA 4L6V5 1UGRB 1BI1A 2RI3A 2VUBA 2RJEA 3RKXA 1OZ3A 3V8KA 1ZHIA 4A53A 3LLRA 4F7UE 1WGSA 5GAOp 4KULA 4M75G 3GPLA 5GAMf 3CCMT 2HD0A 3CC2T 1JRIA 5DLOA 2CZ7B 3OS1A 3PIOA 4OGCA 3SWNC 4C5IA 3TU4K 2RHZA 5LJ3e 1NJIU 1VIFA 4F7UG 2DKGA 4N4GA 4F7UA 5GAMg 3A8HB 2ZGWA 3UWNA 5GAOl 2LTOA 1BIAA 5IN1A 3OSVA 2DZCA 3H6ZA 5CVIA 4C0ZA 4M78F 2FB7A 1YHQT 1U1TA 1Q7YU 1Q82U 2KY9A 3JCMW 1VQMT 1VQPT 2ZPFB 3QUIA 4C0FA 4IUPA 3CPFA 1VQ4T 3E9GA 2E12A 1X01A 2KAFA 2K3YA 3ER0A 4OF1A 4MMLA 3OBYA 5I2SA 1YI2A 3JB9H 2F5TX 4OB1B 1M8VA 2VXEA 3WVEB 1VQNT 2E64A 4A4EA 3OYJA 2OTJT 2C06A 4VUBA 3SD4A 1HK9A 4M78B 2LRQA 4C5HA 2QQRA 4M7AC 2DXTA 2CKKA 2QQAA 4MZTA 3ZEHA 3CCLT 5GAMe 3CC4A 3GP8A 2KDSA 4QW2A 2V8IA 3BDUA 3OYCA 3OA6A 3S3OA 4Q5WA 5CKDA 2MAMA 2RI2A 5A2QE 1OYXA 1RL2A 3A8GB 4BI4A 1VQ9T 1U8RA 4IKFA 2K5IA 2WSCE 3M4GA 3QJ6A 5GAN3 2DXUA 2ZPIB 1KD1C 1W2BA 4Y28E 3OYIA 4C92D 3OYKA 3ASKA 3CBMA 5A0LA 2LCLA 4M7DC 2GF7A 3JB9G 2E6ZA 4EDUA 1G3YA 2MWOA 5DM7R 2O4XB 3OS5A 2DTHA 2JZ2A 5GANj 3OYFA 2JTFA 5LJ5h 4XTVA 2K4YA 2X4YA 4L59A 2O4XA 3HRTA 4O6JA 4ME7A 5GAN2 2PUOB 2F69A 4HKEA 4NOYA 2KVQG 3X26B 1Q81U 2RHYA 4X9CA 2EJFA 1UGQB 3X28B 2JN0A 4X34A 1QVGS 4L5GA 2RHIA 2RJFA 4E7IA 2D9TA 3M55A 3I56T 4C8QC 3CCJT 2QI2A 3I55T 1VQLA 1M90U 2LX9A 3NTKA 2WSEE 2RK1A 2DAQA 2XK0A 3VUZA 5HK3A 2V8JA 1D3BB 1UGPB 5LJ3h 4ZN1A 3A8LB 4KT0E 5HKCA 3JCMP 1LJOA 3GNGA 5LJ5f 2LCCA 3BFMA 4DOWA 3HP9A 1YHQA 2PUKB 2DTOA 2M1HA 2KSSA 2RHXA 1EIFA 3L2RA 4KUDK 2KMTA 1D3BA 4BD3A 2IVWA 1B34A 2XIDA 4N0AA 2PVGB 1XNIA 4LDWA 5LJ5g 5GAN7 2G3RA 1DJ7B 3MEAA 2GQVA 2E6NA 4M78D 3RMQA 3RUXA 3CMET 3JCMb 5FRNA 3FB9A 1H641 2OTLA 1M1KU 3SDZA 3MEWA 3CCQA 3E19A 4C5EA 3TCJA 3E9FA 3EFRA 1KC8U 4PJOF 2MI6A 3C12A 1FX7A 3O8VA 4N4IA 5CCAA 3X24B 1YJWT 1K73C 4JJNK 4LDVA 3VKIA 4MDXA 3CD6A 3Q1JA 3LWHA 4XTZA 3PMTA 2RHUA 2B8AA 2DZ9A 3HHTB 3FLGA 5KCHA 4M77C 3OW2A 2ZPBB 2RK2A 2I2LA 4ELZC 1Y96A 4LDYA 3L2WA 1VQ5T 1UEBA 3L1AA 4PL6A 5FU6C 4BB7A 4PJOB 4BY6B 4C92E 5LJ5e 5HK0A 3C95A 1S72A 2XI9A 4B9XA 1VQ6T 4TVRA 3C94A 4ZN3A 2O01E 1QVFS 4E7HA 1YIJA 2CZ0B 4BI8B 1YITA 1VUBA 4LDUA 1YBYA 4EMKB 4EMGA 1GXIE 3S6WA 3CCSA 4C92G 2K57A 1IREB 4C92A 1PSFA 3GLXA 3META 3JCMV 1P92A 3CMAA 1VQ8T 3CCUT 3VV0A 1X75C 3MP1A 4JDSA 3CC7A 4JUVA 1QVGA 1SSFA 3QO3A 4JS4A 3M9QA 1BYMA 4RG2A 2VV5A 1MHNA 2P0PA 3PNWC 4E7LA 4M75C 5CKBA 2QQSA 3VUBA 3M58A 4BDZA 3RERA 1VQKT 3OYNA 3CCMA 1N6AA 4PLLA 3CC2A 3MEUA 5GMKh 2FYKA 3LX7A 1QVPA 4P5NA 4J7FA 3CPWS 3V7SA 1WQ7A 1FXXA 4OVAA 2JVVA 3SWNB 5GAN4 2H3JA 3L2VA 2EQKA 4XU3A 1K9MC 5GAN6 2E41A 4XAXB 3VYHB 4PKCC 5KH6A 3HKSA 1YJNT 2HQEA 5J3BA 4JS5A 1PSEA 1KHIA 2BKDN 2LT4A 2RJCA 3VU3C 2Y90A 5FROA 2LQ8A 3UT1A 5DLQE 3J81E 3KXTA 1TH7A 3UPUA 1VQPA 1VQMA 3RKYA 4M78E 4JLIA 1U1SA 4XU0A 1VQ4A 4GY5A 3QPHA 1XTDA 1M4ZA 5IAYA 4J5YA 2WACA 3NFCA 2DTIA 3LW5E 1WNLA 4OP0A 3X25B 2JOYA 1N9SA 2L3RA 3WXMB 2VYTA 1ZBXA 3JSCA 1VQNA 2OTJA 4M78G 3M56A 1Y71A 4M78A 1YI2T 1IZ6A 3LH0A 4BE2A 3CCLA 2L89A 3MEVA 4XTWA 2MF2A 4PJOD 4DOVA 3EFSA 5A0GA 3OMGA 3PIPA 4ZGDB 3WVDB 4ATOA 3M59A 4ZGJB 5FRMA 1WJRA 3FC3A 1VQ9A 4M77D 2YHTA 3OW2S 2PQWA 4C0DC 4PLIA 1QVFA 4IUTA 1K8AC 4HCBA 3RIRA 1Y07A 3G6ET 4QVCA 2VGMA 2QTXA 3R6OA 4Z02A 5GANd 2RI5A 5HY6A 3PTAA 4IUVA 1XOVA 3VYGA 2K2VA 1N9RA 4FIBA 2F5KA 2ZPHB 3JCMX 1N27A 4XK8E 3KUFA 2EQJA 3N5BB 2PU9B 1JBMA 3HFOA 3L2ZA 4PNOA 4KUIA 5GMKi 2ZZDA 5GAMj 5GMKe 2YLCA 4C8QF 3JRZA 5CKHA 4QQGA 5CO7A 3TREA 4JRKA 2HBPA 3CPWA 4FT2A 3PFSA 5L8RE 3QHSA 3OSSC 1Q86U 3PT9A 2JNGA 4QQDA 2VGNA 4A4GA 3A8MB 4M75D 2XU8A 4XU1A 3NTHA 3CCRT 3OBWA 3DLMA 2FL7A 3QZ9B 3JCMQ 2XDDA 2ZPEB 3I55A 3I56A 3CCJA 2OAUA 1YJ9T 3QSUA 3LWIA 2EIFA 5D6YA 4RCBA 4C8QB 3G4SA 2RB6A 5CIUA 2K5LA 1VIEA 2QQ9A 2WSFE 2EJ9A 2CYZB 4JRIA 4A4KA 2VC8A 2GFAA 4N0AC 4OB3B 5KCOA 1NPRA 2K5FA 5AYFA 5DY9A 1KQSS 3QXEB 2QDYB 2R5MA 3RMSA 1KQ1A 1BKBA 3SFMA 2XDBA 3OYBA 4QVZA 3CMEA 1N8RC 3S3NA 2RM4A 4J6YA 2E65A 1VQ7T 4M7AD 4M77F 1O9SA 2DO3A 1MGQA 2MMPA 1M1FA 3NTIA 3OB9A 5GANf 2RH2A 3C4SA 1YJWA 3G71T 2RO0A 4HCZA 3J7AF 1OZ2A 2CS7A 4M77E 4PJOE 3MP6A 2HQXA 2CZ1B 2BUDA 3FIFA 2D6FA 3V7RA 1X6OA 4V2SA 1FWZA 2EQMA 3LGLA 4O5VA 4IURA 2RD1A 5FU7C 5CK9A 3OS0A 1K73U 2A3LA 1JJ2S 1BIBA 4M77B 1VQ5A 4CI0C 4PJOG 3JCMg 2AHJB 4GLKA 3OYEA 4M7DD 4PJOA 4BUGA 3H8ZA 3CCVT 2XG8D 2DXBA 2ZPGB 2GCXA 5FU6B 4B9WA 3UDCA 4BY6C 4M77A 3J80E 2QEXT 1VQ6A 2R5AA 3QJYA 3M54A 3EAEA 4C92C 2X4WA 2RJDA 4EMKA 5GMKm 4M75F 3E1SA 2E5QA 4QVDA 3OYYA 3CEYA 4OMFB 3QYHB 3CCET 2QA4T 1LNXA 3CCUA 1VQOT 1VQ8A 1XQHA 2EFIA 4FT4A 1AHJB 3GNFB 5CKEA 4BACA 4F7UF 2DJZA 3URGA 1NJIC 3MO8A 4JRPA 5M9OA 4C8QD 2HNIA 5C6SA 3MP8A 5GAN8 3M4YA 1KQ2A 2P0QA 1NE8A 4LD6A 2CGHA 3FEOA 4MDWA 5KE3A 2FVUA 5CAIA 5LJ5j 4M75B 3JCMe 2X4XA 1UGSB 2DPPB 2QXFA 5KE2A 2M16A 3QG1A 4J6WA 3DB4A 1BI0A 3HRSA 4FU6A 3HSBA 3KBGA 2P0KA 4EPCA 1Q7YC 3JCMd 1Q82C 4FL6A 2PVDB 3SWNA 3BDLA 3L42A 4M75A 5J26A 4F7UB 5GANg 4R56A 4OB0B 1BI2A 1KQSA 5GMKl 2D0QB 4JRQA 2DVEA 4N4HA 3G7ZA 1YJNA 3X20B 3S3MA 1WPYA 4M7AF 2E10A 4XQ3A 4HCCA 5LJ3d 3M57A 4DA4A 5LJ3j 2R57A 3QYGB 3JCMc 4A54A 3GOXA 3JCMJ 1K9MU 4XTYA 1M5Q1 5J39A 1M9SA 2V8KA 4M7AE 3OYHA 3T9NA 2VXFA 2Y4XA 3INZA 4M78C 2P4TA 3OMCA 4R55A 2BIVA 4M7AB 4ELYC 4ZGEB 2ZCFB 4X9DA 4XTUA 3FRNA 4M7DF 1JJ2A 3JB9J 1I5LA 4RMOA 3OYGA 2LDMA 3HPWA 4J6XA 5GANe 3CC4T 2XD0A 4M7AG 1G3SA 5A0DA 4M7AA 1JB0E 2EQUA 3JB9F 4HA8A 3P8HA 4J8OA 1KG1A 2GFUA 4XTXA 5GAOr 2EYQA 1I81A 1H3ZA 4FSXA 4M7DE 2DIQA 5EG2A 3RKWA 3G6EA 3CBPA 4BE0A 4C0DB 3P8BB 4KBMB 4WF2A 2HAXA 4J83A 5FLXE 5CQYA 1UB4A 5GAMd 4HT9A 1RI0A 3LYIA 5GAOn 1KD1U 5LL6S 4E7KA 1QP2A 2R58A 5C0MA 3FDRA 2DXCA 4CRIA 4M7DG 2X35A 3P8DA 3L2UA 4RG8A 1K8AU 3FJPA 2LQKA 4M7DA 1Q81C 3A5ZB 3BW1A 4NS5A 3V8JA 4BI3A 1BI3A 1WQWA 2L5QA 5IT9E 1NPPA 3ME9A 2LVMA 2JTMA 3BY7A 4MZPA 4E47A 4QQ6A 1Q86C 4MZMA 4II1A 3OS2A 1M90C 3A8OB 2EJGA 4C8QE 3CXCS 2M0OA 2A7YA 5CR2A 3M5AA 1I8FA 3QKJA 4NL2A 4NL3A 3CCRA 3LGFA 3JAME 4BDYA 1VQLT 2YLBA 5CQXA 3JCMh 4C8QG 1YJ9A 3GIBA 3OYMA 4C8QA 2EWNA 3PGGA 3QBYA 4LDXA 4ZTJA 5D6XA 3TEEA 3F70A 3QZ5B 3GF5A 3JB9I 3RESA 5GMKj 2XHCA 3G4ST 1M1KC 4ZTFA 4OGEA 3L2QA 3AHUA 2CZ6B 2DEQA 2JUFA 3HL8A 4FM4B 4BE1A 3DLLA 1B34B 2DIGA 3M53A 1KC8C 4LD9K 1QW1A 2E70A 3OYAA 2K3XA 3ZBDA 4D6WA 2KQWA 1I4K1 2X4JA 4J7IA 5GAN5 2Y4YA 5I21A 5GAOq 2OTLT 3DKMA 4UC4A 3QIIA 4DQ2A 4A4HA 3HFNA 1VQ7A 1G3TA 3JCMf 3PMIA 3CCQT 3OYDA 4EMHA 1YCYA 3DB3A 4RKUE 5I2MA 2M9UA 3QDRB 1WJSA 2EAYA 3G71A 1NZ9A 1O75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG1 A; 
#chains in the Genus database with same CATH topology
 3CD6 T;  2DK3 A;  3HRU A;  5CKF A;  3G4S Q;  3REB B;  2XKO C;  5GAN h;  4M77 G;  3VJP A;  1RAD B;  3JB9 D;  5IH2 A;  5FU7 B;  5GAM h;  3CCV A;  4C0G A;  1OI1 A;  5KYW B;  3CCQ Q;  2DER A;  2QQB A;  3V7C A;  3V8L A;  3CD6 Q;  4OB2 B;  3VRZ A;  4IUU A;  4C92 B;  4C5G A;  3CCE A;  4IUQ A;  4M75 E;  1VQO A;  2LT1 A;  1VQK A;  2VUB A;  1ZHI A;  4A53 A;  1AZG B;  1ACM B;  2CZ7 B;  2EYW A;  3VS6 A;  2CH4 W;  2RHZ A;  4JZ4 A;  1NJI U;  1VIF A;  1SG5 A;  4F7U A;  5GAM g;  3UWN A;  2DE0 X;  2QGF B;  1BK2 A;  3OSV A;  1LCK A;  1WZO A;  1YHQ T;  1Q7Y U;  1Q82 U;  1VQM T;  4C0F A;  2JXB A;  2KAF A;  3OBY A;  3CXC P;  3JB9 H;  4AT1 B;  2C0T A;  2CH4 A;  1BCO A;  1UFF A;  1SRM A;  4KH0 B;  4A4E A;  4VUB A;  3SD4 A;  4M78 B;  2CKK A;  4MZT A;  2W0Z A;  2KDS A;  3RDV A;  3OA6 A;  1GCQ A;  2DL3 A;  2MAM A;  2RI2 A;  5A2Q E;  2COY A;  1OYX A;  1RL2 A;  3A8G B;  4BI4 A;  1VQ9 T;  2DFU A;  4IKF A;  1VQM Q;  2ENM A;  2CP3 A;  2ZPI B;  3CBM A;  5A0L A;  3JB9 G;  2E6Z A;  2OX7 A;  5DM7 R;  3OS5 A;  2JZ2 A;  3VS5 A;  2K7A A;  5LJ5 h;  4RTT A;  2X4Y A;  2ED0 A;  1VQ9 Q;  5I11 A;  2JW4 A;  2ABL A;  2F69 A;  2O31 A;  4NOY A;  2KVQ G;  3X26 B;  1Q81 U;  1UGQ B;  2RHI A;  2RJF A;  3M55 A;  3EGD B;  2NYS A;  1M90 U;  2LX9 A;  2WSE E;  5HK3 A;  2V8J A;  3EG2 A;  2DRM A;  2M0Y A;  3QWY A;  4PJL A;  1EIF A;  2KMT A;  1EX4 A;  2XID A;  5LJ5 g;  3MEA A;  2GQV A;  1C0M A;  3VS7 A;  3TCJ A;  1R0B G;  1FX7 A;  1K73 C;  4LDV A;  3Q1J A;  4J9E A;  3PMT A;  2B8A A;  5KCH A;  4M77 C;  2VAS A;  2ZPB B;  1EFN A;  3L1A A;  1JEG A;  5FU6 C;  4PJO B;  4BY6 B;  1NYG A;  1TOV A;  2XI9 A;  4B9X A;  5KYW A;  1VQ6 T;  4LE9 A;  1YIT A;  4BI8 B;  1YBY A;  4EMG A;  1GXI E;  3S6W A;  2FPD A;  1TUD A;  4C92 A;  3MET A;  1VQ8 T;  3CCU T;  1QVG A;  1X75 C;  4JDS A;  3CC7 A;  4JS4 A;  3M9Q A;  2QQS A;  1GCP A;  3VUB A;  3M58 A;  4BDZ A;  2GQI A;  3OYN A;  3CCM A;  2COW A;  3MEU A;  2FYK A;  1QVP A;  1VQ6 Q;  3CPW S;  2MCN A;  3V7S A;  1SHG A;  4KRT A;  4XU3 A;  4PKC C;  2A37 A;  1YJN T;  4F17 A;  3CCU Q;  2YUO A;  3VU3 C;  3KFV A;  3J81 E;  1RAH B;  3RKY A;  1JU5 C;  1VQ4 A;  1WFW A;  4Z89 A;  2L3R A;  2YWW A;  1VQN A;  1WXB A;  2FPE A;  4M78 A;  1YI2 T;  3LH0 A;  4BE2 A;  4AG2 C;  2L89 A;  3MEV A;  4XTW A;  1YJN Q;  3WVD B;  2YHT A;  1QVF A;  4PLI A;  4IUT A;  1R77 A;  4HCB A;  1Y07 A;  2QTX A;  2A28 A;  4Z02 A;  5HY6 A;  2HBW A;  3PTA A;  2KGT A;  1SKU B;  1N27 A;  3JCM X;  1YI2 Q;  1K9M R;  3OYC A;  5GMK i;  1JBM A;  2JJ9 A;  1TUG B;  2YLC A;  3TRE A;  2HBP A;  2ED1 A;  1QWF A;  1RAA B;  4QQD A;  4M75 D;  2L3Q A;  2XU8 A;  1OV3 A;  2DL4 A;  2XDD A;  3JCM Q;  2SRC A;  2OAU A;  1VYU A;  1YJ9 T;  3QSU A;  1MMD A;  4K11 A;  4C8Q B;  3G4S A;  2QQ9 A;  4JRI A;  1NPR A;  1KQS S;  1K8A R;  2QDY B;  3RMS A;  1BKB A;  2XDB A;  3OYB A;  3S3N A;  2RM4 A;  1O9S A;  1YJ9 Q;  2O88 A;  2X3W D;  1WHJ A;  3C4S A;  4J9D A;  3G71 T;  4HCZ A;  2RNA A;  4FSS A;  2HQX A;  2YSQ A;  1X6O A;  1RAC B;  2EQM A;  2DMO A;  4ORZ A;  1K73 U;  1BIB A;  1EZZ B;  3OYE A;  2I0N A;  4PJO A;  3H8Z A;  3CCV T;  4BY6 C;  3UDC A;  1B7T A;  3G1J A;  3QJY A;  2X4W A;  2CT3 A;  1MMG A;  2E5Q A;  4PK4 A;  3CEY A;  2DRK A;  3QYH B;  3CCE T;  2VB6 A;  1VQO T;  2QK0 A;  2K79 A;  4FT4 A;  4BAC A;  1YFN A;  2DJZ A;  3URG A;  5M9O A;  1MMA A;  1N8R R;  3M4Y A;  5GAN f;  3FEO A;  2AIR B;  4M75 B;  2J06 A;  2J6O A;  2KR3 A;  4FU6 A;  3HSB A;  2KNB B;  4FL6 A;  2PVD B;  1JQQ A;  3L42 A;  5J26 A;  3VS2 A;  4N4H A;  1T3L A;  1YIJ Q;  3CCE Q;  2PZ1 A;  2YUP A;  4DBF A;  3CCS Q;  4DA4 A;  1TTH B;  3JCM J;  4XTY A;  3EH1 A;  3ZL7 C;  4M7A E;  3OYH A;  2VXF A;  1S1N A;  2VWF A;  4R55 A;  4R0K A;  2HQH A;  3FRN A;  4M7D F;  5KYN A;  4OMP A;  2LDM A;  2CP5 A;  1YWP A;  1RAB B;  1UG1 A;  1OOT A;  1KG1 A;  2QGG A;  5KYU B;  4E2F B;  4FSX A;  1N5Z A;  5EG2 A;  3P8B B;  4WF2 A;  1PD1 A;  1KIK A;  3LYI A;  1KD1 U;  1YWO A;  1QP2 A;  4M7D A;  3V8J A;  1BI3 A;  1SRL A;  3H9N A;  2LVM A;  4AFZ C;  4E47 A;  3RNJ A;  3OS2 A;  3EG3 A;  2EKH A;  4AFU C;  2EJG A;  3CXC S;  1KK7 A;  4DBR A;  3AT1 B;  5CR2 A;  3M5A A;  1I8F A;  5L23 A;  4NL3 A;  3CCR A;  1IB8 A;  3MPU B;  1UUE A;  2RQR A;  3GIB A;  2P84 A;  4C8Q A;  2EWN A;  3PGG A;  1AOJ A;  4ZTJ A;  3NHN A;  3F70 A;  2CDT A;  4ZTF A;  3L2Q A;  3AHU A;  2CZ6 B;  2JUF A;  4BE1 A;  2KT8 A;  3M53 A;  1U06 A;  1KC8 C;  2BZY A;  2E70 A;  3THK A;  1YNZ A;  3ZBD A;  1PKS A;  3ULR B;  2X4J A;  5GAO q;  2Y4Y A;  3CPW P;  2QAS A;  3HFN A;  3OYD A;  2C0I A;  4RKU E;  2K9G A;  1IXD A;  1JXO A;  2A36 A;  2VKN A;  1M1G A;  4F16 A;  2KK4 A;  3CBO A;  2AZV A;  4FYY B;  1G5V A;  1LOJ A;  3HTR A;  1ZQ1 A;  1JO8 A;  2E1H A;  5FW9 A;  5LJ3 g;  1W1F A;  4EMK C;  1RAI B;  4RCC A;  2XDP A;  2AZS A;  1YIT T;  2FHD A;  2DD4 A;  1V76 A;  2IG0 A;  2XIC A;  5AT1 B;  1HXD A;  2DD5 A;  1FMV A;  2LNV A;  2EGC A;  4J9C A;  2RA2 A;  2LC4 A;  1M1K R;  3CC7 T;  1YJW Q;  4MMK A;  2EKO A;  2L8D A;  4L6V 5;  1BI1 A;  2RI3 A;  2RJE A;  3JV3 A;  3LLR A;  3TSZ A;  4KUL A;  3CCM T;  1RLP C;  2HD0 A;  2G6F X;  1JRI A;  4OGC A;  4C5I A;  3TU4 K;  3PE0 A;  1YIT Q;  4F7U G;  3I35 A;  2M51 A;  4N4G A;  5GAO l;  4KGZ B;  2LTO A;  1BIA A;  3CC7 Q;  3H6Z A;  1U1T A;  2KY9 A;  3JCM W;  1NEG A;  1VQ4 T;  1PNJ A;  2W10 A;  3E9G A;  1GBQ A;  3CCM Q;  4MML A;  2FO0 A;  1YI2 A;  2F5T X;  3WVE B;  1VQN T;  2E64 A;  2V1R A;  1KJW A;  2KI7 A;  4C5H A;  2QQR A;  5GAM e;  3GP8 A;  1I1J A;  2V8I A;  3TSW A;  3S3O A;  1I07 A;  5KYY A;  2J6F A;  1WYX A;  2K5I A;  2WSC E;  3QJ6 A;  4J9F A;  1E7O A;  1VQ4 Q;  4C92 D;  1OEB A;  1Y0M A;  3FJ5 A;  3LH5 A;  3OYK A;  2Z0W A;  2LCL A;  1VQN Q;  2YRD A;  2JTF A;  1K0S A;  2O4X A;  5GJV B;  3EG0 A;  2PUO B;  5GAN 2;  4JZ3 A;  2D9T A;  2QI2 A;  2JS0 A;  2XK0 A;  1I5O B;  2EGA A;  4KT0 E;  1WDX A;  2JM8 A;  1LJO A;  3HP9 A;  2RHX A;  4KUD K;  1W2B P;  1WIE A;  1OU8 A;  4N0A A;  2PVG B;  4M78 D;  4DEY A;  3RUX A;  3VRY A;  1D1C A;  5FRN A;  1H64 1;  1RLQ C;  3MEW A;  2FG0 A;  1KC8 U;  2RMO A;  3O8V A;  1Q86 R;  4ATO A;  1AWO A;  1NEB A;  2X3X D;  3VKI A;  1PD0 A;  3LWH A;  4XTZ A;  1RI9 A;  5HCK A;  1X43 A;  2L3P A;  3HHT B;  4PJM A;  2I2L A;  1WHM A;  1ZSG A;  4LDY A;  4ELZ C;  3L2W A;  5LJ5 e;  2NUT B;  2BZX A;  3C94 A;  1QLY A;  4LXC A;  1YIJ A;  2CZ0 B;  1AZE A;  3CCS A;  4C92 G;  2K57 A;  1HD3 A;  3JCM V;  3CMA A;  3MP1 A;  1WHL A;  1SSF A;  2KE9 A;  4RG2 A;  1FYN A;  1MHN A;  2P0P A;  3E2U A;  4E7L A;  5CKB A;  1D0Z A;  3RER A;  3CC2 A;  1D1B A;  1MV3 A;  4J7F A;  1FXX A;  3SWN B;  5GAN 4;  2H3J A;  4ZNX A;  3L2V A;  1T3S A;  2EQK A;  5I22 A;  3VYH B;  3HKS A;  2HQE A;  1FMW A;  4Z88 A;  4JS5 A;  3DLL A;  3KXT A;  3UT1 A;  3UPU A;  5DLQ E;  1VQP A;  4JLI A;  3QPH A;  1M4Z A;  5IAY A;  2DTI A;  1N9S A;  3WXM B;  4CC4 B;  3SHW A;  2RF0 A;  4M78 G;  1IHV A;  1IZ6 A;  2LJ0 A;  3CCL A;  2MF2 A;  4PJO D;  3EFS A;  3OMG A;  2DET A;  1FMK A;  4DBQ A;  1WJR A;  3FC3 A;  2PQW A;  4C0D C;  3RIR A;  2AKL A;  3R6O A;  1VOM A;  5GAN d;  2RI5 A;  1ZSZ B;  4IUV A;  1XOV A;  5IHN A;  2YUQ A;  1KFZ A;  1OPL A;  2F5K A;  3NPF A;  2EQJ A;  3N5B B;  3HFO A;  4KUI A;  2GGR A;  2ZZD A;  3JRZ A;  4JRK A;  3CPW A;  2EGE A;  1QCN A;  3OSS C;  3PT9 A;  4FYX B;  1ZUY A;  1A0N B;  3CCR T;  2D8H A;  3OBW A;  3CCJ A;  2V26 A;  2M02 A;  3LWI A;  2EIF A;  5D6Y A;  3VS1 A;  2JTE A;  5CIU A;  2K5L A;  1VIE A;  2WSF E;  4RTU A;  4A4K A;  2GFA A;  4QKU A;  1NYF A;  4FYW B;  3QXE B;  5KYX A;  2J05 A;  4J6Y A;  3CCR Q;  4HVW A;  4M77 F;  4OMQ A;  3U23 A;  1X6B A;  3NTI A;  3OB9 A;  2RH2 A;  3QDF A;  2HMA A;  1YJW A;  1GFD A;  2CS7 A;  8AT1 B;  5FU7 C;  1TG0 A;  5CK9 A;  3OS0 A;  1VQ5 A;  4PJO G;  2AHJ B;  3IQL A;  4GLK A;  4M7D D;  4BUG A;  2NUT A;  2ZPG B;  4M77 A;  1WI7 A;  3M54 A;  3EAE A;  4C92 C;  1LNX A;  1YN8 A;  1KSW A;  1D0X A;  5GJW B;  4C8Q D;  4FW2 A;  1NE8 A;  4LD6 A;  2CGH A;  5CAI A;  2X4X A;  3TQ7 P;  2QXF A;  4J9B A;  2M16 A;  3SWN A;  2P4R A;  4R56 A;  3I5R A;  1BI2 A;  4OB0 B;  5GMK l;  2D0Q B;  1KQS A;  2K3B A;  1X27 A;  1TSF A;  3X20 B;  4M7A F;  1WPY A;  2E10 A;  2HEQ A;  4XQ3 A;  3UAT A;  1G83 A;  2RQW A;  1I0C A;  5LJ3 j;  2R57 A;  3QYG B;  3JCM c;  4A54 A;  1G8X A;  2KT1 A;  5J39 A;  2V8K A;  4OMM A;  3INZ A;  1WXT A;  4M78 C;  4ELY C;  1E6G A;  4RMO A;  4RTZ A;  1GL5 A;  5IXF A;  1K4U S;  4M7A A;  3JB9 F;  4HA8 A;  4XTX A;  1J3T A;  2EYQ A;  1I81 A;  2KXC A;  2DIQ A;  2BE9 B;  3CBP A;  4M7D B;  1ZSZ A;  1RI0 A;  2HKN A;  1Q82 R;  1Q7Y R;  1QKX A;  4M7D G;  3P8D A;  1WQW A;  4A63 B;  3BY7 A;  3O5Z A;  1Q86 C;  4II1 A;  2M0O A;  1WX6 A;  2DJQ A;  1JJ2 P;  4BDY A;  1MMN A;  1M3A A;  5CQX A;  3H41 A;  4C8Q G;  1PM3 A;  4OMO A;  4B6M A;  1QWE A;  3QBY A;  3GF5 A;  3JB9 I;  5GMK j;  1M3C A;  1WXU A;  1UHC A;  4LD9 K;  4FM4 B;  3OYA A;  1GBR A;  4D6W A;  1R0C B;  4HVV A;  4DQ2 A;  3QII A;  2ZAE A;  1G3T A;  3JCM f;  1ZA2 B;  3M0R A;  4IIO A;  4EMH A;  3DB3 A;  5I2M A;  2DYB A;  3I9Q A;  1Q81 R;  1WJS A;  4M77 E;  2EAY A;  2E4H A;  3H0H A;  3I55 Q;  2HZY A;  3SB2 A;  2DBM A;  2BZ8 A;  1M90 R;  2YRC A;  4YTL A;  4A4F A;  1OU9 A;  4PJO C;  1Y96 B;  2CSI A;  5D6W A;  1Y7X A;  1QQJ A;  4JJD A;  2PVO B;  3OQ5 A;  1AWX A;  2QEX A;  1YIJ T;  2E5K A;  4HT8 A;  4Y91 A;  1YCS B;  5GAO m;  3CCS T;  1W2B S;  3CXC A;  1MV0 B;  2F2V A;  2MWP A;  2NLU A;  3NMZ C;  1QP3 A;  1PWT A;  3CMA T;  2A08 A;  1K9A A;  1UGR B;  3RKX A;  1OZ3 A;  5D7U A;  3V8K A;  5GAO p;  3EHQ A;  1WGS A;  4M75 G;  3GPL A;  5GAM f;  4E7S A;  3CC2 T;  2RPN A;  5LJ3 e;  1NM7 A;  2DKG A;  2ZGW A;  2DA9 A;  5IN1 A;  3CMA Q;  4C0Z A;  5CVI A;  2FB7 A;  4RTY A;  1VQP T;  2K6D A;  1M2O A;  2ZPF B;  3QUI A;  4IUP A;  4D8K A;  2E12 A;  1X01 A;  3MJX A;  2K3Y A;  4OF1 A;  5I2S A;  4ANJ A;  3CC2 Q;  2NUP A;  4OB1 B;  1M8V A;  3OYJ A;  2C06 A;  5KYY B;  1AEY A;  2LJ3 A;  3CCL T;  3ZEH A;  3CC4 A;  4Q5W A;  5CKD A;  2HL5 C;  1U8R A;  1VQP Q;  1WHH A;  2DXU A;  4Y28 E;  1UGV A;  1ZLM A;  4KGX B;  4M7D C;  2GF7 A;  4EDU A;  2O4X B;  4CC2 A;  5GAN j;  3CCL Q;  1PRL C;  4XTV A;  4O6J A;  2RHY A;  2EJF A;  3X28 B;  7AT1 B;  4FCY A;  4C8Q C;  3CCJ T;  2DVJ A;  2EQI A;  3NTK A;  3M0P A;  2DAQ A;  4OML A;  5LJ3 h;  4ZN1 A;  5HKC A;  1PCX A;  5LJ5 f;  2LCC A;  3BFM A;  1M30 A;  1RAF B;  2DTO A;  2M1H A;  4F14 A;  1NBE B;  1D3B A;  4BD3 A;  2DM1 A;  2IPO B;  8ATC B;  3VS0 A;  5IHI A;  1W70 A;  3JCM b;  2OTL A;  1QKW A;  1WHK A;  1UHF A;  3CCJ Q;  3E19 A;  4C5E A;  3PVL A;  3E9F A;  2J6K A;  3C12 A;  4N4I A;  1YJW T;  3X24 B;  2RHU A;  2KRM A;  3CQT A;  2RK2 A;  1V1C A;  1Y96 A;  1VQ5 T;  1NG2 A;  1UEB A;  2LZ6 B;  2HCK A;  2D8J A;  1AWW A;  3C95 A;  1S72 A;  4F04 B;  1Z9Z A;  4TVR A;  4ZN3 A;  2O01 E;  1GRI A;  2H8H A;  1IRE B;  3GLX A;  3EH2 A;  1P92 A;  1IGQ A;  2QG9 B;  3VV0 A;  4JUV A;  2VV5 A;  4M75 C;  1VQ5 Q;  2F1L A;  3SEM A;  1OPK A;  4PLL A;  5GMK h;  1K0X A;  2F2W A;  1WQ7 A;  2GTJ A;  1K73 R;  2JVV A;  2NUZ A;  3EHR A;  1K9M C;  3REA B;  5GAN 6;  5KH6 A;  4J9I A;  2CT4 A;  5J3B A;  1PKT A;  1PSE A;  2LT4 A;  2HKQ B;  2Y90 A;  5FRO A;  2LQ8 A;  2L0A A;  2EYY A;  4GY5 A;  4PFP A;  4J5Y A;  1G2B A;  2WAC A;  3NFC A;  1WA7 A;  2F2X A;  2O9V A;  3I5S A;  1ZBX A;  3JSC A;  1PG5 B;  2OTJ A;  3M56 A;  1NLP C;  1Y71 A;  3H0I A;  2CP0 A;  2ATC B;  4Z8A A;  4DOV A;  4DBH A;  2JM9 A;  3EG9 B;  3M59 A;  4M77 D;  2LCS A;  1K8A C;  1VYV A;  2LP5 A;  4CC7 A;  3VYG A;  3R6N A;  1U3O A;  4XK8 E;  2PU9 B;  1VYT A;  4PNO A;  4WCI A;  5CKH A;  4QQG A;  5CO7 A;  2CP7 A;  2QAZ A;  1H8K A;  3PFS A;  1GFC A;  3QHS A;  2VGN A;  4A4G A;  2AT1 B;  3I56 A;  3DLM A;  3QZ9 B;  1CKB A;  2ZPE B;  3I55 A;  5FWB A;  2BTT A;  2XMF A;  2RB6 A;  2EJ9 A;  4AMC A;  5KYX B;  2VC8 A;  1KD1 R;  4FW1 A;  4N0A C;  4OB3 B;  2GNC A;  2YT6 A;  2K5F A;  5AYF A;  2R5M A;  1K76 A;  3SFM A;  3CME A;  1N8R C;  2QTV A;  1RAG B;  3M0S A;  4M7A D;  2MMP A;  1MGQ A;  1SEM A;  3J7A F;  1OZ2 A;  3MP6 A;  1F1B B;  1UE9 A;  5FWC A;  2D6F A;  2DBK A;  4V2S A;  2DEU A;  4O5V A;  4IUR A;  1JJ2 S;  4M77 B;  1M3B A;  1AWJ A;  3JCM g;  1MND A;  3EFO A;  4M4Z A;  2LJ1 A;  5FU6 B;  2KRO A;  3EGX B;  2QEX T;  1D0Y A;  1UTI A;  1U5S A;  2RJD A;  5GMK m;  4QVD A;  3OYY A;  4OMF B;  1XQH A;  2EFI A;  4F7U F;  1IRX A;  3MKD A;  3MP8 A;  1KQ2 A;  2FVU A;  3OW2 P;  1UGS B;  2DPP B;  1RUW A;  5KE2 A;  3QG1 A;  1Y57 A;  1UEC A;  1BI0 A;  3DB4 A;  2QEX Q;  3KBG A;  2P0K A;  2HDA A;  3JCM d;  3BDL A;  2HSP A;  2LX7 A;  2BE7 D;  5GAN g;  2GBQ A;  1BCM A;  3UA6 A;  4IIM A;  3NGP A;  4QT7 A;  1IHW A;  3M57 A;  3GOX A;  1K9M U;  2RN8 A;  4KH1 B;  1UDL A;  2KEA A;  1GCQ C;  3M0T A;  3T9N A;  2P4T A;  2BIV A;  4M7A B;  2YDL A;  1IGU A;  4X9D A;  4XTU A;  1PC0 A;  3QWX X;  3JB9 J;  1M8M A;  3HPW A;  3CC4 T;  4M7A G;  2XD0 A;  1T0H A;  1G3S A;  5A0D A;  1JB0 E;  2EQU A;  3EG9 A;  2KXD A;  3P8H A;  4J8O A;  4RTV A;  5GAO r;  1VA7 A;  3EGU A;  3G6E A;  4BE0 A;  2QDL A;  1YHQ Q;  2HAX A;  5FLX E;  5GAM d;  1UB4 A;  4HT9 A;  5GAO n;  2DX1 A;  4E7K A;  5ECA A;  1TUC A;  4CRI A;  3L2U A;  4RG8 A;  1K8A U;  2D1X A;  3FJP A;  2L5Q A;  1X2K A;  3CC4 Q;  3ME9 A;  1HJD A;  3PVQ A;  2JTM A;  2FZG B;  4QQ6 A;  1OUL A;  3A8O B;  4LNP A;  2FZC B;  2CUD A;  2A7Y A;  4LN2 A;  1UJY A;  4WTO B;  3QKJ A;  3LGF A;  2K2M A;  2YLB A;  1Z9Q A;  3OYM A;  4LDX A;  5IHK A;  5D6X A;  1M1K C;  1AVZ C;  1WHG A;  2DEQ A;  3HL8 A;  1B34 B;  1QW1 A;  2K3X A;  1QCF A;  1M2V B;  4J7I A;  4HXJ A;  5I21 A;  2OTL T;  4UC4 A;  4PJN A;  1VQ7 A;  1YCY A;  2V1Q A;  2ECZ A;  1NZ9 A;  5CCA A;  1O75 A;  4EIK A;  1N8R U;  1TU0 B;  3MCA B;  2JT4 A;  4E7J A;  1KHC A;  1G3W A;  3ZFJ A;  5LJ3 f;  4JLG A;  1MNE A;  4Y92 A;  2DYI A;  4C92 F;  2DLP A;  2YRV A;  1WJQ A;  4FYV B;  3OY9 A;  1E6H A;  1S72 T;  2OTL Q;  3EGX A;  4XU2 A;  1IO6 A;  1V29 B;  2X51 A;  3MHX A;  1R8O B;  3OYL A;  1W4S A;  1PRM C;  4D8D A;  2OAW A;  5LJ5 d;  2QA4 A;  2MPX C;  1H92 A;  1KC8 R;  4F7U E;  1HSQ A;  1RAE B;  2DL7 A;  5DLO A;  1S72 Q;  3OS1 A;  3PIO A;  3SWN C;  2CSQ A;  4X1V A;  1JXM A;  1X2Q A;  1SSH A;  3A8H B;  2DZC A;  1ZA1 B;  4M78 F;  2MK5 A;  2NUP B;  3CPF A;  3VS3 A;  1VQ8 Q;  3ER0 A;  2RQV A;  2VXE A;  2OTJ T;  2MOX A;  1UJ0 A;  2FZK B;  1HK9 A;  2LRQ A;  1NJI R;  4M7A C;  2DXT A;  2QQA A;  2EVR A;  4QW2 A;  3BDU A;  1TS9 A;  2FEI A;  2KRS A;  3M4G A;  1ZUU A;  5GAN 3;  1ZSZ C;  1KD1 C;  1W2B A;  3OYI A;  3ASK A;  3UF4 A;  1BBZ A;  2L3S A;  2LQN A;  2OTJ Q;  3RR6 A;  1G3Y A;  2MWO A;  2DTH A;  1C6V X;  1TXQ A;  3OYF A;  2K4Y A;  1HYO A;  4JJB A;  2HSE B;  4L59 A;  3HRT A;  4ME7 A;  2SEM A;  4HKE A;  4RTX A;  2DF6 A;  4X9C A;  2JN0 A;  4X34 A;  1QVG S;  4L5G A;  4E7I A;  3I56 T;  3I55 T;  4AFS C;  2HL3 A;  1VQL A;  4GBQ A;  2RK1 A;  3VUZ A;  4PFZ A;  1D3B B;  3H0F A;  1UGP B;  2KBT A;  3A8L B;  4GLM A;  3EGD A;  3JCM P;  2LQW A;  2FPF A;  3GNG A;  4DOW A;  2PUK B;  4PJJ A;  2KSS A;  4LUD A;  3L2R A;  2JMC A;  2IVW A;  1B34 A;  1XNI A;  4LDW A;  5GAN 7;  2G3R A;  1DJ7 B;  3RMQ A;  2E6N A;  4PFO A;  1M2V A;  3CME T;  3FB9 A;  3I56 Q;  3SDZ A;  1M1K U;  3CCQ A;  3EFR A;  4PJO F;  2MI6 A;  1TWB A;  2L2P A;  4JJN K;  4MDX A;  3CD6 A;  3RBB B;  1ZX6 A;  3BE3 A;  2DZ9 A;  3A1P A;  3FLG A;  3OW2 A;  2CP2 A;  4OMN A;  4PL6 A;  4BB7 A;  1WLP B;  2FRY A;  4C92 E;  3CME Q;  5HK0 A;  3GBQ A;  1QVF S;  2CRE A;  2E3H A;  1VUB A;  4LDU A;  2CUB A;  4EMK B;  9ATC B;  1PSF A;  1QMC A;  2B86 A;  3G71 Q;  3QO3 A;  1BYM A;  3C0C A;  3PNW C;  1K1Z A;  1SHF A;  1VQK T;  1N6A A;  3LX7 A;  4JPB W;  4P5N A;  4HCK A;  2EYZ A;  2ROT A;  4OVA A;  3CCV Q;  2E41 A;  4XAX B;  2J7I A;  2PNI A;  2YXY A;  1C1A A;  1ABO A;  1KHI A;  2BKD N;  2RJC A;  1YHQ A;  3M0Q A;  1VQM A;  1TH7 A;  2KYB A;  4M78 E;  4LUE A;  1U1S A;  2H3E B;  4XU0 A;  1VQO Q;  1XTD A;  1VQK Q;  4OP0 A;  3LW5 E;  3X25 B;  1WNL A;  2KYM A;  2JOY A;  2VYT A;  1CKA A;  1D09 B;  2CP6 A;  2X9H A;  1M27 C;  5A0G A;  3PIP A;  4ZGD B;  4ZGJ B;  5FRM A;  1VQ9 A;  1QCO A;  3OW2 S;  2EPD A;  2O2O A;  1X6G A;  3G6E T;  4QVC A;  2VGM A;  2K2V A;  1N9R A;  4FIB A;  2DL5 A;  2ZPH B;  3KUF A;  5GAM j;  3L2Z A;  1YP5 A;  2LMJ A;  5GMK e;  1OX8 A;  4C8Q F;  2DNU A;  2PTK A;  4FT2 A;  4E6R A;  5L8R E;  1XJW B;  1Q86 U;  2JNG A;  2LNH B;  2OJ2 A;  3A8M B;  3G6E Q;  4XU1 A;  3UA7 A;  3NTH A;  2FL7 A;  4JJC A;  4RCB A;  1AD5 A;  1B07 A;  4DEX A;  2CYZ B;  5KCO A;  1D1A A;  4AG1 C;  5IXB A;  5DY9 A;  1CSK A;  1KQ1 A;  1X69 A;  4QVZ A;  2E65 A;  1VQ7 T;  1MUZ A;  2AK5 A;  2DO3 A;  2C0O A;  1AT1 B;  1M1F A;  2DL8 A;  4KGV B;  1B3Q A;  2RO0 A;  4PJO E;  2CZ1 B;  3EG1 A;  2BUD A;  3FIF A;  3EFO B;  3V7R A;  1FWZ A;  2EBP A;  3LGL A;  3TVT A;  2RD1 A;  2A3L A;  1OQK A;  4CI0 C;  2MIO A;  2RQT A;  2XG8 D;  2DXB A;  3M0U A;  4B9W A;  2GCX A;  3J80 E;  1VQ6 A;  1VQ7 Q;  2OI3 A;  2R5A A;  4EMK A;  2YUN A;  4M75 F;  3E1S A;  4CC3 A;  1SF9 A;  4ESR A;  2QA4 T;  1VQ8 A;  3CCU A;  1AHJ B;  2A0F B;  3GNF B;  5CKE A;  1NJI C;  3MO8 A;  3VS4 A;  4JRP A;  2E3I A;  1SPK A;  4J9H A;  2HNI A;  5C6S A;  5GAN 8;  2P0Q A;  5KE3 A;  4MDW A;  5LJ5 j;  3JCM e;  4E7H A;  2NWM A;  4E7Z A;  2EYX A;  4J6W A;  3HRS A;  1T0J A;  4EPC A;  1Q7Y C;  1Q82 C;  4M75 A;  4F7U B;  2ESW A;  4JRQ A;  2DVE A;  3G7Z A;  1YJN A;  2QA4 Q;  3S3M A;  4HCC A;  2COZ A;  5LJ3 d;  3A98 A;  1LPL A;  1QVG P;  1M5Q 1;  1M9S A;  2Y4X A;  3OMC A;  1Q95 G;  4RTW A;  4ZGE B;  2ZCF B;  2EW3 A;  4RUG A;  1JJ2 A;  1I5L A;  3OYG A;  4J6X A;  5GAN e;  1NLO C;  2GFU A;  1H3Z A;  2MYS A;  1BB9 A;  1H3H A;  4M7D E;  3RKW A;  2QYZ A;  4C0D B;  1ABQ A;  4KBM B;  4J83 A;  1KQS P;  5CQY A;  2KRN A;  4AFQ C;  5KYU A;  5LL6 S;  5C0M A;  2R58 A;  2JMA A;  2DXC A;  3FDR A;  4J9G A;  2X35 A;  2LQK A;  1ZUK A;  1Q81 C;  3A5Z B;  3BW1 A;  4NS5 A;  4BI3 A;  5IT9 E;  1NPP A;  2O9S A;  4MZP A;  2AKK A;  4MZM A;  1M90 C;  2IIM A;  4C8Q E;  1W6X A;  3D7S B;  2VVK A;  1ARK A;  2FRW A;  4NL2 A;  3JAM E;  1QVF P;  2JS2 A;  1VQL T;  2ROL A;  3JCM h;  1YJ9 A;  2DIL A;  2D0N A;  1BU1 A;  3TEE A;  3QZ5 B;  1ZBJ A;  3RES A;  1PHT A;  2XHC A;  3G4S T;  1OX9 A;  4HVU A;  4OGE A;  2GTO A;  2DIG A;  2RQU A;  2KQW A;  1I4K 1;  5GAN 5;  3DKM A;  1LVK A;  3CCQ T;  3PMI A;  1VQL Q;  6AT1 B;  2M9U A;  3QDR B;  3G71 A;  4A4H A;  5EC7 A; 
#chains in the Genus database with same CATH homology
 3CD6 T;  1N8R U;  3MCA B;  2DK3 A;  3SB2 A;  4E7J A;  1KHC A;  1M1G A;  3HRU A;  1G3W A;  2KK4 A;  5CKF A;  3CBO A;  3ZFJ A;  2XKO C;  5LJ3 f;  5GAN h;  4JLG A;  4YTL A;  4A4F A;  4M77 G;  3VJP A;  4PJO C;  4C92 F;  1Y96 B;  5D6W A;  4M7D B;  3JB9 D;  1G5V A;  1Y7X A;  1LOJ A;  5FU7 B;  1ZQ1 A;  2YRV A;  2PVO B;  5GAM h;  3CCV A;  1WJQ A;  3OQ5 A;  4C0G A;  2E1H A;  1OI1 A;  5LJ3 g;  3OY9 A;  1S72 T;  4EMK C;  4RCC A;  2QEX A;  2XDP A;  4XU2 A;  1V29 B;  1YIJ T;  1YIT T;  2QQB A;  2FHD A;  3V7C A;  4HT8 A;  2DD4 A;  3MHX A;  4Y91 A;  1R8O B;  2IG0 A;  2XIC A;  3V8L A;  5GAO m;  3OYL A;  3CCS T;  1HXD A;  1W4S A;  2DD5 A;  3CXC A;  2NLU A;  1W2B S;  2MWP A;  4OB2 B;  4IUU A;  4C92 B;  1QP3 A;  2LNV A;  4C5G A;  3CCE A;  4IUQ A;  2RA2 A;  2LC4 A;  4M75 E;  5LJ5 d;  2QA4 A;  1VQO A;  2LT1 A;  3CMA T;  3CC7 T;  4MMK A;  1VQK A;  2EKO A;  2L8D A;  4L6V 5;  1UGR B;  1BI1 A;  2RI3 A;  2VUB A;  2RJE A;  3RKX A;  1OZ3 A;  3V8K A;  1ZHI A;  4A53 A;  3LLR A;  4F7U E;  1WGS A;  5GAO p;  4KUL A;  4M75 G;  3GPL A;  5GAM f;  3CCM T;  2HD0 A;  3CC2 T;  1JRI A;  5DLO A;  2CZ7 B;  3OS1 A;  3PIO A;  4OGC A;  3SWN C;  4C5I A;  3TU4 K;  2RHZ A;  5LJ3 e;  1NJI U;  1VIF A;  4F7U G;  2DKG A;  4N4G A;  4F7U A;  5GAM g;  3A8H B;  2ZGW A;  3UWN A;  5GAO l;  2LTO A;  1BIA A;  5IN1 A;  3OSV A;  2DZC A;  3H6Z A;  5CVI A;  4C0Z A;  4M78 F;  2FB7 A;  1YHQ T;  1U1T A;  1Q7Y U;  1Q82 U;  2KY9 A;  3JCM W;  1VQM T;  1VQP T;  2ZPF B;  3QUI A;  4C0F A;  4IUP A;  3CPF A;  1VQ4 T;  3E9G A;  2E12 A;  1X01 A;  2KAF A;  2K3Y A;  3ER0 A;  4OF1 A;  4MML A;  3OBY A;  5I2S A;  1YI2 A;  3JB9 H;  2F5T X;  4OB1 B;  1M8V A;  2VXE A;  3WVE B;  1VQN T;  2E64 A;  4A4E A;  3OYJ A;  2OTJ T;  2C06 A;  4VUB A;  3SD4 A;  1HK9 A;  4M78 B;  2LRQ A;  4C5H A;  2QQR A;  4M7A C;  2DXT A;  2CKK A;  2QQA A;  4MZT A;  3ZEH A;  3CCL T;  5GAM e;  3CC4 A;  3GP8 A;  2KDS A;  4QW2 A;  2V8I A;  3BDU A;  3OYC A;  3OA6 A;  3S3O A;  4Q5W A;  5CKD A;  2MAM A;  2RI2 A;  5A2Q E;  1OYX A;  1RL2 A;  3A8G B;  4BI4 A;  1VQ9 T;  1U8R A;  4IKF A;  2K5I A;  2WSC E;  3M4G A;  3QJ6 A;  5GAN 3;  2DXU A;  2ZPI B;  1KD1 C;  1W2B A;  4Y28 E;  3OYI A;  4C92 D;  3OYK A;  3ASK A;  3CBM A;  5A0L A;  2LCL A;  4M7D C;  2GF7 A;  3JB9 G;  2E6Z A;  4EDU A;  1G3Y A;  2MWO A;  5DM7 R;  2O4X B;  3OS5 A;  2DTH A;  2JZ2 A;  5GAN j;  3OYF A;  2JTF A;  5LJ5 h;  4XTV A;  2K4Y A;  2X4Y A;  4L59 A;  2O4X A;  3HRT A;  4O6J A;  4ME7 A;  5GAN 2;  2PUO B;  2F69 A;  4HKE A;  4NOY A;  2KVQ G;  3X26 B;  1Q81 U;  2RHY A;  4X9C A;  2EJF A;  1UGQ B;  3X28 B;  2JN0 A;  4X34 A;  1QVG S;  4L5G A;  2RHI A;  2RJF A;  4E7I A;  2D9T A;  3M55 A;  3I56 T;  4C8Q C;  3CCJ T;  2QI2 A;  3I55 T;  1VQL A;  1M90 U;  2LX9 A;  3NTK A;  2WSE E;  2RK1 A;  2DAQ A;  2XK0 A;  3VUZ A;  5HK3 A;  2V8J A;  1D3B B;  1UGP B;  5LJ3 h;  4ZN1 A;  3A8L B;  4KT0 E;  5HKC A;  3JCM P;  1LJO A;  3GNG A;  5LJ5 f;  2LCC A;  3BFM A;  4DOW A;  3HP9 A;  1YHQ A;  2PUK B;  2DTO A;  2M1H A;  2KSS A;  2RHX A;  1EIF A;  3L2R A;  4KUD K;  2KMT A;  1D3B A;  4BD3 A;  2IVW A;  1B34 A;  2XID A;  4N0A A;  2PVG B;  1XNI A;  4LDW A;  5LJ5 g;  5GAN 7;  2G3R A;  1DJ7 B;  3MEA A;  2GQV A;  2E6N A;  4M78 D;  3RMQ A;  3RUX A;  3CME T;  3JCM b;  5FRN A;  3FB9 A;  1H64 1;  2OTL A;  1M1K U;  3SDZ A;  3MEW A;  3CCQ A;  3E19 A;  4C5E A;  3TCJ A;  3E9F A;  3EFR A;  1KC8 U;  4PJO F;  2MI6 A;  3C12 A;  1FX7 A;  3O8V A;  4N4I A;  5CCA A;  3X24 B;  1YJW T;  1K73 C;  4JJN K;  4LDV A;  3VKI A;  4MDX A;  3CD6 A;  3Q1J A;  3LWH A;  4XTZ A;  3PMT A;  2RHU A;  2B8A A;  2DZ9 A;  3HHT B;  3FLG A;  5KCH A;  4M77 C;  3OW2 A;  2ZPB B;  2RK2 A;  2I2L A;  4ELZ C;  1Y96 A;  4LDY A;  3L2W A;  1VQ5 T;  1UEB A;  3L1A A;  4PL6 A;  5FU6 C;  4BB7 A;  4PJO B;  4BY6 B;  4C92 E;  5LJ5 e;  5HK0 A;  3C95 A;  1S72 A;  2XI9 A;  4B9X A;  1VQ6 T;  4TVR A;  3C94 A;  4ZN3 A;  2O01 E;  1QVF S;  4E7H A;  1YIJ A;  2CZ0 B;  4BI8 B;  1YIT A;  1VUB A;  4LDU A;  1YBY A;  4EMK B;  4EMG A;  1GXI E;  3S6W A;  3CCS A;  4C92 G;  2K57 A;  1IRE B;  4C92 A;  1PSF A;  3GLX A;  3MET A;  3JCM V;  1P92 A;  3CMA A;  1VQ8 T;  3CCU T;  3VV0 A;  1X75 C;  3MP1 A;  4JDS A;  3CC7 A;  4JUV A;  1QVG A;  1SSF A;  3QO3 A;  4JS4 A;  3M9Q A;  1BYM A;  4RG2 A;  2VV5 A;  1MHN A;  2P0P A;  3PNW C;  4E7L A;  4M75 C;  5CKB A;  2QQS A;  3VUB A;  3M58 A;  4BDZ A;  3RER A;  1VQK T;  3OYN A;  3CCM A;  1N6A A;  4PLL A;  3CC2 A;  3MEU A;  5GMK h;  2FYK A;  3LX7 A;  1QVP A;  4P5N A;  4J7F A;  3CPW S;  3V7S A;  1WQ7 A;  1FXX A;  4OVA A;  2JVV A;  3SWN B;  5GAN 4;  2H3J A;  3L2V A;  2EQK A;  4XU3 A;  1K9M C;  5GAN 6;  2E41 A;  4XAX B;  3VYH B;  4PKC C;  5KH6 A;  3HKS A;  1YJN T;  2HQE A;  5J3B A;  4JS5 A;  1PSE A;  1KHI A;  2BKD N;  2LT4 A;  2RJC A;  3VU3 C;  2Y90 A;  5FRO A;  2LQ8 A;  3UT1 A;  5DLQ E;  3J81 E;  3KXT A;  1TH7 A;  3UPU A;  1VQP A;  1VQM A;  3RKY A;  4M78 E;  4JLI A;  1U1S A;  4XU0 A;  1VQ4 A;  4GY5 A;  3QPH A;  1XTD A;  1M4Z A;  5IAY A;  4J5Y A;  2WAC A;  3NFC A;  2DTI A;  3LW5 E;  1WNL A;  4OP0 A;  3X25 B;  2JOY A;  1N9S A;  2L3R A;  3WXM B;  2VYT A;  1ZBX A;  3JSC A;  1VQN A;  2OTJ A;  4M78 G;  3M56 A;  1Y71 A;  4M78 A;  1YI2 T;  1IZ6 A;  3LH0 A;  4BE2 A;  3CCL A;  2L89 A;  3MEV A;  4XTW A;  2MF2 A;  4PJO D;  4DOV A;  3EFS A;  5A0G A;  3OMG A;  3PIP A;  4ZGD B;  3WVD B;  4ATO A;  3M59 A;  4ZGJ B;  5FRM A;  1WJR A;  3FC3 A;  1VQ9 A;  4M77 D;  2YHT A;  3OW2 S;  2PQW A;  4C0D C;  4PLI A;  1QVF A;  4IUT A;  1K8A C;  4HCB A;  3RIR A;  1Y07 A;  3G6E T;  4QVC A;  2VGM A;  2QTX A;  3R6O A;  4Z02 A;  5GAN d;  2RI5 A;  5HY6 A;  3PTA A;  4IUV A;  1XOV A;  3VYG A;  2K2V A;  1N9R A;  4FIB A;  2F5K A;  2ZPH B;  3JCM X;  1N27 A;  4XK8 E;  3KUF A;  2EQJ A;  3N5B B;  2PU9 B;  1JBM A;  3HFO A;  3L2Z A;  4PNO A;  4KUI A;  5GMK i;  2ZZD A;  5GAM j;  5GMK e;  2YLC A;  4C8Q F;  3JRZ A;  5CKH A;  4QQG A;  5CO7 A;  3TRE A;  4JRK A;  2HBP A;  3CPW A;  4FT2 A;  3PFS A;  5L8R E;  3QHS A;  3OSS C;  1Q86 U;  3PT9 A;  2JNG A;  4QQD A;  2VGN A;  4A4G A;  3A8M B;  4M75 D;  2XU8 A;  4XU1 A;  3NTH A;  3CCR T;  3OBW A;  3DLM A;  2FL7 A;  3QZ9 B;  3JCM Q;  2XDD A;  2ZPE B;  3I55 A;  3I56 A;  3CCJ A;  2OAU A;  1YJ9 T;  3QSU A;  3LWI A;  2EIF A;  5D6Y A;  4RCB A;  4C8Q B;  3G4S A;  2RB6 A;  5CIU A;  2K5L A;  1VIE A;  2QQ9 A;  2WSF E;  2EJ9 A;  2CYZ B;  4JRI A;  4A4K A;  2VC8 A;  2GFA A;  4N0A C;  4OB3 B;  5KCO A;  1NPR A;  2K5F A;  5AYF A;  5DY9 A;  1KQS S;  3QXE B;  2QDY B;  2R5M A;  3RMS A;  1KQ1 A;  1BKB A;  3SFM A;  2XDB A;  3OYB A;  4QVZ A;  3CME A;  1N8R C;  3S3N A;  2RM4 A;  4J6Y A;  2E65 A;  1VQ7 T;  4M7A D;  4M77 F;  1O9S A;  2DO3 A;  1MGQ A;  2MMP A;  1M1F A;  3NTI A;  3OB9 A;  5GAN f;  2RH2 A;  3C4S A;  1YJW A;  3G71 T;  2RO0 A;  4HCZ A;  3J7A F;  1OZ2 A;  2CS7 A;  4M77 E;  4PJO E;  3MP6 A;  2HQX A;  2CZ1 B;  2BUD A;  3FIF A;  2D6F A;  3V7R A;  1X6O A;  4V2S A;  1FWZ A;  2EQM A;  3LGL A;  4O5V A;  4IUR A;  2RD1 A;  5FU7 C;  5CK9 A;  3OS0 A;  1K73 U;  2A3L A;  1JJ2 S;  1BIB A;  4M77 B;  1VQ5 A;  4CI0 C;  4PJO G;  3JCM g;  2AHJ B;  4GLK A;  3OYE A;  4M7D D;  4PJO A;  4BUG A;  3H8Z A;  3CCV T;  2XG8 D;  2DXB A;  2ZPG B;  2GCX A;  5FU6 B;  4B9W A;  3UDC A;  4BY6 C;  4M77 A;  3J80 E;  2QEX T;  1VQ6 A;  2R5A A;  3QJY A;  3M54 A;  3EAE A;  4C92 C;  2X4W A;  2RJD A;  4EMK A;  5GMK m;  4M75 F;  3E1S A;  2E5Q A;  4QVD A;  3OYY A;  3CEY A;  4OMF B;  3QYH B;  3CCE T;  2QA4 T;  1LNX A;  3CCU A;  1VQO T;  1VQ8 A;  1XQH A;  2EFI A;  4FT4 A;  1AHJ B;  3GNF B;  5CKE A;  4BAC A;  4F7U F;  2DJZ A;  3URG A;  1NJI C;  3MO8 A;  4JRP A;  5M9O A;  4C8Q D;  2HNI A;  5C6S A;  3MP8 A;  5GAN 8;  3M4Y A;  1KQ2 A;  2P0Q A;  1NE8 A;  4LD6 A;  2CGH A;  3FEO A;  4MDW A;  5KE3 A;  2FVU A;  5CAI A;  5LJ5 j;  4M75 B;  3JCM e;  2X4X A;  1UGS B;  2DPP B;  2QXF A;  5KE2 A;  2M16 A;  3QG1 A;  4J6W A;  3DB4 A;  1BI0 A;  3HRS A;  4FU6 A;  3HSB A;  3KBG A;  2P0K A;  4EPC A;  1Q7Y C;  3JCM d;  1Q82 C;  4FL6 A;  2PVD B;  3SWN A;  3BDL A;  3L42 A;  4M75 A;  5J26 A;  4F7U B;  5GAN g;  4R56 A;  4OB0 B;  1BI2 A;  1KQS A;  5GMK l;  2D0Q B;  4JRQ A;  2DVE A;  4N4H A;  3G7Z A;  1YJN A;  3X20 B;  3S3M A;  1WPY A;  4M7A F;  2E10 A;  4XQ3 A;  4HCC A;  5LJ3 d;  3M57 A;  4DA4 A;  5LJ3 j;  2R57 A;  3QYG B;  3JCM c;  4A54 A;  3GOX A;  3JCM J;  1K9M U;  4XTY A;  1M5Q 1;  5J39 A;  1M9S A;  2V8K A;  4M7A E;  3OYH A;  3T9N A;  2VXF A;  2Y4X A;  3INZ A;  4M78 C;  2P4T A;  3OMC A;  4R55 A;  2BIV A;  4M7A B;  4ELY C;  4ZGE B;  2ZCF B;  4X9D A;  4XTU A;  3FRN A;  4M7D F;  1JJ2 A;  3JB9 J;  1I5L A;  4RMO A;  3OYG A;  2LDM A;  3HPW A;  4J6X A;  5GAN e;  3CC4 T;  2XD0 A;  4M7A G;  1G3S A;  5A0D A;  4M7A A;  1JB0 E;  2EQU A;  3JB9 F;  4HA8 A;  3P8H A;  4J8O A;  1KG1 A;  2GFU A;  4XTX A;  5GAO r;  2EYQ A;  1I81 A;  1H3Z A;  4FSX A;  4M7D E;  2DIQ A;  5EG2 A;  3RKW A;  3G6E A;  3CBP A;  4BE0 A;  4C0D B;  3P8B B;  4KBM B;  4WF2 A;  2HAX A;  4J83 A;  5FLX E;  5CQY A;  1UB4 A;  5GAM d;  4HT9 A;  1RI0 A;  3LYI A;  5GAO n;  1KD1 U;  5LL6 S;  4E7K A;  1QP2 A;  2R58 A;  5C0M A;  3FDR A;  2DXC A;  4CRI A;  4M7D G;  2X35 A;  3P8D A;  3L2U A;  4RG8 A;  1K8A U;  3FJP A;  2LQK A;  4M7D A;  1Q81 C;  3A5Z B;  3BW1 A;  4NS5 A;  3V8J A;  4BI3 A;  1BI3 A;  1WQW A;  2L5Q A;  5IT9 E;  1NPP A;  3ME9 A;  2LVM A;  2JTM A;  3BY7 A;  4MZP A;  4E47 A;  4QQ6 A;  1Q86 C;  4MZM A;  4II1 A;  3OS2 A;  1M90 C;  3A8O B;  2EJG A;  4C8Q E;  3CXC S;  2M0O A;  2A7Y A;  5CR2 A;  3M5A A;  1I8F A;  3QKJ A;  4NL2 A;  4NL3 A;  3CCR A;  3LGF A;  3JAM E;  4BDY A;  1VQL T;  2YLB A;  5CQX A;  3JCM h;  4C8Q G;  1YJ9 A;  3GIB A;  3OYM A;  4C8Q A;  2EWN A;  3PGG A;  3QBY A;  4LDX A;  4ZTJ A;  5D6X A;  3TEE A;  3F70 A;  3QZ5 B;  3GF5 A;  3JB9 I;  3RES A;  5GMK j;  2XHC A;  3G4S T;  1M1K C;  4ZTF A;  4OGE A;  3L2Q A;  3AHU A;  2CZ6 B;  2DEQ A;  2JUF A;  3HL8 A;  4FM4 B;  4BE1 A;  3DLL A;  1B34 B;  2DIG A;  3M53 A;  1KC8 C;  4LD9 K;  1QW1 A;  2E70 A;  3OYA A;  2K3X A;  3ZBD A;  4D6W A;  2KQW A;  1I4K 1;  2X4J A;  4J7I A;  5GAN 5;  2Y4Y A;  5I21 A;  5GAO q;  2OTL T;  3DKM A;  4UC4 A;  3QII A;  4DQ2 A;  4A4H A;  3HFN A;  1VQ7 A;  1G3T A;  3JCM f;  3PMI A;  3CCQ T;  3OYD A;  4EMH A;  1YCY A;  3DB3 A;  4RKU E;  5I2M A;  2M9U A;  3QDR B;  1WJS A;  2EAY A;  3G71 A;  1NZ9 A;  1O75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...