1KIKA

Sh3 domain of lymphocyte specific kinase (lck)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
b'NLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
publication title Structure determination of human Lck unique and SH3 domains by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 8
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kikA00
3VRYA 1W6XA 2AZVA 1ZBJA 4X1VA 3NPFA 2BTTA 1SPKA 3U23A 1QWFA 4RTTA 4E6RA 1T0HA 2DILA 3VS7A 4HCKA 2JS2A 2DL7A 1K1ZA 1GCQA 2KGTA 4D8DA 1T3SA 2EYYA 1M3BA 4ZNXA 3ULRB 4R0KA 1M3CA 2YUNA 3R6NA 2MCNA 2KYMA 2L3PA 1AD5A 4OMMA 2C0TA 1GCQC 4AG1C 5IHKA 1YP5A 2KRNA 4HVUA 1MUZA 5IHNA 3VS2A 2CDTA 2DVJA 1Z9ZA 1ZUYA 1AZEA 4AFQC 4J9GA 2FPDA 4LE9A 2J7IA 2KE9A 4KRTA 4F14A 4OMPA 1JXOA 1NG2A 4GLMA 1WYXA 2AK5A 4WCIA 2LJ1A 4CC2A 1KIKA 2GTOA 1K76A 2D8HA 3C0CA 1BK2A 3M0RA 1RUWA 2DE0X 1UECA 2ENMA 4JJBA 2BZXA 2L0AA 1GRIA 3RBBB 1H3HA 1SRLA 1ZUKA 1MV3A 4DEXA 1E6HA 1UJYA 1T0JA 2DL5A 2LX7A 3ZL7C 2YT6A 1LCKA 3IQLA 3EHRA 4CC7A 4J9FA 1WI7A 2LJ3A 1OV3A 2I0NA 2RQWA 1WXTA 1ZLMA 3TVTA 1OPLA 1RLPC 1M3AA 4AFUC 3CQTA 1WLPB 3O5ZA 1X43A 5EC7A 3SEMA 1H92A 2O31A 1B3QA 2DJQA 2ED0A 2EBPA 4ESRA 2JMCA 2JTEA 1YWPA 1VYTA 4OMQA 2FEIA 2V1QA 2J05A 5FWBA 1WXUA 2D1XA 2EYWA 4AFSC 5I11A 4CC3A 1NLPC 2CSQA 1Y0MA 2PZ1A 1CKAA 4Z88A 1E6GA 1E7OA 1PWTA 2CREA 2RQVA 3JV3A 2DYBA 2CUDA 2JW4A 3H41A 4J9CA 1X69A 2L3SA 5IXBA 2RNAA 4LUDA 4M4ZA 1QKXA 2EYXA 2YDLA 1W70A 1PHTA 1MV0B 1FMKA 2J06A 1HSQA 1NLOC 2RPNA 2ESWA 1GBQA 2CSIA 2QDLA 1TG0A 1GBRA 1W1FA 1NYGA 2EPDA 4Z89A 2DBMA 2PTKA 4J9BA 4IIMA 1WX6A 5FWCA 1UG1A 2EYZA 2OI3A 1NEBA 2LP5A 3EHQA 2AKKA 1OPKA 1ABQA 1YN8A 1KFZA 3NGPA 1B07A 3M0TA 2DL4A 1S1NA 2KT1A 2M51A 2KR3A 2V1RA 4K11A 2JMAA 2ROLA 3VS3A 1ARKA 1ZSGA 1UJ0A 2JS0A 1AWWA 2VWFA 2RF0A 1X6BA 2K9GA 1UUEA 1JU5C 1SHGA 2OJ2A 2MOXA 3EG3A 1ABOA 2LJ0A 3RNJA 3H0FA 2FPFA 1AWOA 3EG0A 4HVVA 1GFCA 2JXBA 2IIMA 1TUDA 2KROA 3QWXX 1JQQA 1WFWA 2KNBB 4FSSA 2MIOA 3I35A 2RQRA 2DL8A 2ABLA 1U3OA 2A08A 2HSPA 2ROTA 2NWMA 3M0PA 2BZ8A 1A0NB 2LQWA 1PKSA 2HEQA 2D8JA 1Z9QA 2EW3A 4OMLA 1AEYA 4RTWA 4F16A 4D8KA 4LNPA 4J9IA 2L3QA 3NHNA 1SSHA 2LCSA 2C0OA 4AG2C 1RLQC 1GL5A 1V1CA 5IH2A 3UATA 2K2MA 3VS0A 1PKTA 2DF6A 2K7AA 2FPEA 4DEYA 2O9SA 2DLPA 2AZSA 1WDXA 1M27C 1VYVA 2GQIA 2CUBA 1NM7A 4IIOA 1N5ZA 1UHCA 4GBQA 2JM8A 1G2BA 1VA7A 3PVLA 2M0YA 1CSKA 2DM1A 2EGEA 1XOVA 2YUPA 1HD3A 1QKWA 1Y57A 1UE9A 3LH5A 2BZYA 1AWXA 2L2PA 2OAWA 3THKA 1H8KA 4JZ4A 2VKNA 1QCFA 2LZ6B 4CC4B 3TSWA 2DBKA 2GBQA 4JJDA 3A98A 2B86A 2DX1A 3KFVA 2DRKA 3H0HA 2A36A 5GJVB 2EKHA 4RTXA 4RUGA 1HJDA 3M0UA 1SEMA 2JT4A 3EG2A 2RMOA 1AZGB 3I9QA 2LQNA 2VVKA 3VS6A 5ECAA 4OMOA 1I1JA 2HCKA 2KXCA 3QWYA 1YNZA 2O88A 1RI9A 5I22A 4RTYA 2ED1A 4RTUA 2GGRA 1WIEA 3EG1A 4J9DA 2FO0A 1PRMC 2A28A 1YCSB 4A63B 3VS1A 3FJ5A 2SRCA 1ZUUA 1PRLC 5FW9A 2F2VA 5GJWB 1UDLA 5IXFA 2GTJA 3REBB 2LMJA 1EFNA 1T3LA 4JZ3A 1BU1A 2DMOA 2J6OA 2XMFA 4Z8AA 2EVRA 2KBTA 1U5SA 2X3WD 4J9EA 1K0SA 4OMNA 2KT8A 2FG0A 2FRYA 4J9HA 2JM9A 3H0IA 2O9VA 5L23A 2CH4W 2LNHB 2KXDA 2P4RA 2PNIA 3VS4A 2DRMA 1TUCA 2AKLA 1FYNA 1QLYA 2W10A 1I07A 2YUOA 3VRZA 1K0XA 2SEMA 1AVZC 2HBWA 1JO8A 1VYUA 2YSQA 1X27A 2K3BA 3SHWA 1U06A 1YWOA 2F2XA 1M8MA 1UHFA 2KRMA 3I5RA 3PVQA 2J6FA 1X6GA 2DL3A 1BBZA 1OEBA 3NMZC 3PE0A 1CKBA 2K6DA 4EIKA 2K79A 2ECZA 2EGAA 1GFDA 4JPBW 4LUEA 1K9AA 2EQIA 3VS5A 3UF4A 2A37A 1I0CA 3M0QA 1AOJA 2CT4A 3I5SA 1SRMA 2NUZA 3REAB 2HDAA 2CT3A 4JJCA 4AFZC 2KYBA 2KRSA 1OOTA 2D0NA 3GBQA 1NYFA 1BB9A 1JXMA 1UTIA 2J6KA 2W0ZA 1X2QA 4F17A 1SHFA 1IO6A 2FRWA 2RQTA 3TSZA 1UGVA 1X2KA 1ZX6A 1WXBA 2X3XD 1PNJA 2YUQA 3M0SA 4LN2A 5HCKA 2GNCA 2F2WA 4RTVA 1NEGA 1WA7A 1KJWA 2E5KA 2G6FX 5IHIA 1JEGA 2O2OA 1QWEA 2H8HA 2C0IA 2RN8A 1KSWA 2EGCA 1K4US 2DNUA 3UA7A 3UA6A 2DA9A 2KEAA 4QT7A 2CH4A 1M30A 4Y92A 1GCPA 4HXJA 3EGUA 1J3TA 1G83A 1UFFA 4RTZA 4HVWA 2RQUA 4ORZA 1AWJA
chains in the Genus database with same CATH superfamily
1OI1A 4XTXA 3J7AF 3G4SQ 2ZZDA 1KG1A 4RTTA 4M78B 5CIUA 2DILA 5GAN8 4D8DA 2GFAA 4Y28E 3KXTA 2AIRB 4R0KA 3E1SA 3JCMQ 2JUFA 2AT1B 3MEWA 3R6NA 2C0TA 4OB3B 1GCQC 1AT1B 4B9WA 1D0XA 2OTLT 3CXCA 1YITA 4HVUA 3J81E 2K5LA 3CC7A 4DA4A 2CDTA 3CMAQ 3CCVT 1ZUYA 2LCCA 1MMDA 3A8OB 2JOYA 4DOWA 2E1HA 2J7IA 1K73C 2KE9A 1OU8A 4BY6C 2E70A 4F14A 1X01A 3N5BB 3CCLT 4LDUA 2MYSA 3OW2A 5GMKi 5J26A 3O8VA 1I4K1 4JRQA 1H641 3UDCA 4KGXB 4MZMA 2DE0X 2ENMA 3HHTB 4JJBA 1QQJA 3RBBB 1ZUKA 1E6HA 2YRVA 5FROA 1UJYA 5CKBA 3BFMA 3RKYA 3EHRA 2Y4YA 4C92F 5A2QE 5D7UA 2LDMA 2MMPA 3TVTA 2CZ6B 2R57A 2PVGB 4NL2A 3CBOA 2LT4A 1S72T 2DERA 1YIJT 3PTAA 2P0QA 1B3QA 4E2FB 3HSBA 5EG2A 2EBPA 1KQ1A 3EFOB 2ATCB 2GFUA 1BI0A 4ESRA 2C06A 2LT1A 2JTEA 1YWPA 2PUOB 3OYGA 1OU9A 2FEIA 5I11A 1Q82C 1G5VA 5CKEA 4HT8A 2X35A 5GMKm 4O6JA 3NFCA 2L3RA 2XI9A 5FU7C 2VB6A 2FHDA 2LVMA 2RQVA 3JV3A 3A8HB 3OYKA 3FC3A 4HCBA 3TEEA 2CUDA 4B9XA 1M1KU 2VXEA 1LVKA 3EG9B 3CC2Q 5IXBA 4M4ZA 4AT1B 3EFOA 5GAN6 3SWNC 2QK0A 3MEAA 3META 1MV0B 3OMGA 5GAOn 4F7UE 1NLOC 2X4JA 3CC4T 3JCMP 2GF7A 1GBQA 2CSIA 3CCQA 5KYNA 1GBRA 2DK3A 4DQ2A 2EPDA 1UEBA 3QDFA 1ZBXA 4N4HA 2EYZA 3EH1A 1VQMQ 1VQ9A 3EHQA 2ZPHB 3EGXB 2FZKB 4JRIA 5A0LA 3OYBA 4PKCC 1S1NA 2KR3A 3E2UA 4CRIA 1UJ0A 1IREB 2K5IA 4WTOB 4E47A 2RF0A 1D09B 2OJ2A 2MOXA 1D0ZA 4JUVA 3EAEA 4IURA 2Y4XA 3RMQA 2MI6A 1W4SA 5GAMg 3P8DA 3EG0A 1WPYA 3FIFA 3JCMW 1M8VA 3QWXX 1JQQA 1LPLA 3G4ST 2GCXA 3VJPA 4PJNA 1M2OA 1EZZB 2CYZB 2RQRA 3CBPA 5KE2A 2A08A 2LX9A 3FEOA 3M0PA 2EJ9A 1I8FA 4FYWB 3TQ7P 2KDSA 4F04B 4M7DB 3LW5E 2X4WA 2X51A 1AEYA 4RTWA 1YHQA 4M75C 2R5AA 4F16A 1N8RC 4KH1B 1XQHA 4J9IA 2EQMA 3C94A 2LCSA 3A8LB 2M0OA 4BI8B 1RLQC 1GL5A 2WSCE 5IT9E 3UATA 2QQRA 3CMAT 2X4YA 2ZPFB 5J39A 3I56A 1PKTA 2DF6A 3MP1A 3URGA 2ZPIB 2KVQG 5LJ5g 1M27C 3OQ5A 1MNEA 4GBQA 1M2VB 1KQSP 2DM1A 1BCOA 2YUPA 1NZ9A 2RJFA 3LH5A 3JB9I 4C8QG 1AWXA 2EWNA 3V8KA 3H8ZA 5KCHA 4PJOE 1Y96A 5CK9A 3CPWS 2DPPB 1QCFA 4FL6A 4KH0B 3CCJA 1OQKA 1SG5A 2DIQA 1VQ8A 3QHSA 3TSWA 1ZSZB 1VIEA 3NTKA 2ZAEA 1VQPT 1TH7A 3KFVA 5AT1B 3H0HA 1VQOA 2A36A 2DVEA 2I2LA 2DTOA 5GJVB 1M5Q1 2PVDB 4C8QA 4GY5A 4RUGA 4QVZA 4HT9A 1M2VA 2BE7D 1SEMA 3EG2A 1K9MR 5ECAA 1I1JA 3CCUQ 4NS5A 3CCEA 4UC4A 4BACA 2GQVA 2RHZA 2JTMA 4JRKA 3EG1A 1PRMC 2A28A 2CKKA 2EYQA 4A63B 1Q86C 4M7AE 3MO8A 4MDWA 2K2VA 2YRCA 2F2VA 5L8RE 2QG9B 2LMJA 1T3LA 2J6OA 2QAZA 3WVEB 1VQNT 2BUDA 4OMNA 2KT8A 3A5ZB 2FG0A 3M4GA 5LJ5f 3H0IA 1YJWQ 2CH4W 2XK0A 3CC2T 1QVFP 4FSXA 2QI2A 4A4EA 2AKLA 1FYNA 4FU6A 2SEMA 1AVZC 1JO8A 1VYUA 4C92B 3SHWA 3GNFB 4M78C 2KRMA 4Z02A 4JLIA 3NMZC 4YTLA 1VQLQ 3R6OA 2K6DA 4EIKA 5GMKh 1D0YA 3X24B 3EH2A 1QVGS 4LUEA 2CZ0B 4MZPA 2E64A 1QW1A 2A37A 2E5QA 1AOJA 5KYWB 2HDAA 3FLGA 2KYBA 2D0NA 4R56A 1LNXA 4IKFA 1SHFA 3MPUB 8AT1B 2X3XD 3DB3A 1Q81C 3QXEB 1N9SA 1JJ2S 7AT1B 1OYXA 4IUPA 4LN2A 1JJ2A 5HCKA 2GNCA 2YWWA 4C5HA 3CCVA 3INZA 5IHIA 1OX9A 4EPCA 2H8HA 2QEXT 2RN8A 2EGCA 1TWBA 3M56A 1KC8C 3EGDA 5IAYA 2ZPBB 2F69A 3UA6A 1W2BS 4BE0A 2KEAA 4JS4A 2EJGA 2P84A 1KHCA 2LNVA 3MCAB 3JCMX 1G83A 1YJ9Q 3MEUA 3VRYA 1W6XA 3SFMA 5GAOr 3OS1A 2BTTA 5KYXA 3U23A 4C0DB 4E6RA 3OYIA 3VS7A 2JS2A 2DL7A 1K1ZA 3AHUA 3WVDB 2EYYA 1WZOA 2OTJQ 4OMMA 1YIJA 5IHKA 4ZN1A 3L2UA 1YP5A 1K9MU 3LH0A 1MUZA 3JCMb 2CS7A 1Z9ZA 3C12A 2E4HA 1FX7A 4J9GA 5GMKe 2FPDA 4LE9A 3RERA 2O4XB 3HFNA 3M54A 3OSSC 2QDYB 4KRTA 3I55Q 4N4IA 1Y71A 4M77C 2H3JA 4LXCA 3CD6A 3G1JA 2RH2A 1QP3A 3M4YA 1KIKA 1VQ6A 1R8OB 1G3TA 3CCUT 3M0RA 4IUVA 5GANg 1PSFA 2P4TA 2JTFA 1R0CB 3CCMA 5GMKj 3HP9A 1OX8A 4X34A 2COYA 2P0PA 2LX7A 4HKEA 3CC4A 1TU0B 3IQLA 4J9FA 1WI7A 3JB9G 1OV3A 2I0NA 1ZLMA 1OPLA 1RLPC 1M3AA 1IGQA 4J6WA 5CQXA 1RADB 4FT4A 4AFUC 2NYSA 3O5ZA 2XG8D 2PUKB 2CZ7B 4CI0C 1YJWT 4KGZB 3SEMA 1H92A 2DJQA 4M7AF 2RJCA 2JMCA 1Y07A 1VYTA 4C8QD 1VQ7Q 4E7LA 1RAGB 2V1QA 5FWBA 3M59A 2D1XA 4JS5A 4M75E 3RDVA 3VYHB 1YI2Q 2HMAA 4RCBA 4C8QF 4Z88A 1E6GA 1NPRA 1E7OA 1PWTA 1WHGA 1WNLA 1VQLT 2DYBA 2DFUA 3F70A 2K3XA 1TTHB 4XU1A 3OBWA 1K73U 3G4SA 3GOXA 2RI3A 4XK8E 4M7DC 1BI1A 4IUUA 2RNAA 1UB4A 3JCMJ 2EYXA 2HZYA 4BD3A 1N8RR 3VU3C 1C6VX 2ZPGB 3JCMg 2IG0A 4L59A 2KI7A 4BE2A 4E7ZA 1FMKA 2J06A 5GANf 2BKDN 4QW2A 2HNIA 1WQWA 3MJXA 1SSFA 3MP8A 1UGPB 2QDLA 4DBQA 2QTXA 5GAOp 4Z89A 2M9UA 4J9BA 4IIMA 2FZCB 2OI3A 1I81A 5FRMA 2LP5A 5GAN5 1OPKA 1ABQA 1YN8A 2YRDA 2E3HA 2KT1A 2V1RA 4X9DA 2DXCA 4FYYB 2K4YA 3BE3A 2K9GA 1GXIE 1ABOA 4QVDA 3KUFA 3G6EA 1ZSZC 2FPFA 1UGQB 2V8IA 1GFCA 1YITQ 2JXBA 1TUDA 1YJ9T 4PFZA 5HY6A 3LYIA 5D6XA 1WFWA 2KNBB 3CC7Q 4FSSA 1VQPA 4C92D 2DJZA 3FJPA 2HKNA 2BE9B 2HSPA 5DLOA 1HYOA 2LQWA 4ME7A 2HEQA 2D8JA 4J6YA 2OTJT 4OMLA 4RG8A 2OAUA 6AT1B 3JCMf 2M02A 4F7UG 4GLKA 3G71Q 4LNPA 2HQHA 2E41A 1M90R 1VQ5Q 1RAIB 1PD1A 3ZBDA 4AG2C 1V1CA 5KE3A 3RR6A 3QYGB 1KD1R 4ZN3A 1VQKQ 4M78E 3CMEQ 3HKSA 1Q7YC 4F7UA 1OZ3A 3I55T 1WDXA 4OF1A 1VYVA 2GQIA 1KQSS 1UHCA 3CCRA 1VQNA 3PVLA 1NJIC 5A0DA 1CSKA 3L1AA 3E19A 1Y57A 4C92C 3CC2A 4XTYA 2K5FA 5D6YA 3THKA 4J83A 4JZ4A 2O01E 1RAHB 2KK4A 3CPFA 1D1AA 3A98A 4QQDA 5LJ3g 4E7SA 4ELZC 3VKIA 4EMKB 4RTXA 3V8LA 1HJDA 1X6OA 2RJDA 1YJNA 3OMCA 3Q1JA 1K8AR 4TVRA 2Y90A 2HSEB 2HCKA 2KXCA 5KYYA 2CP5A 5I22A 2ED1A 3PT9A 4RTUA 1BKBA 1XJWB 2Z0WA 4J9DA 2FO0A 1Q81R 4XTWA 1VQ7T 3VS1A 2SRCA 1N8RU 1G3YA 1MHNA 2JN0A 1ZUUA 1YI2T 4XU0A 5GJWB 3REBB 4EMKA 3OYNA 1EFNA 4C0FA 4L6V5 2XMFA 2EVRA 2KBTA 1U5SA 1BIAA 5D6WA 3M55A 3CXCP 1PM3A 2ZCFB 1QVFS 1KHIA 2EJFA 1VQ9Q 2P4RA 2L5QA 2DRMA 2QEXA 1TUCA 5I21A 4KUIA 4PJOG 1M1KC 1K0XA 1Q95G 2HBWA 3X28B 2PQWA 3X25B 4N0AC 2K3BA 3D7SB 4C0DC 4C0GA 1PSEA 3I5RA 3PVQA 3OW2P 1X6GA 1OEBA 1CKBA 5A0GA 3JB9D 2K79A 5LJ3f 4JLGA 1GFDA 4PJOA 4FT2A 2KAFA 1N27A 2EQIA 4OP0A 3OA6A 4M7AB 1Y96B 1PCXA 3UF4A 4M77E 3JB9F 3M0QA 3I5SA 3CBMA 1SRMA 2NUZA 3REAB 3GPLA 4RCCA 3QIIA 1VQ4Q 1LOJA 2KRSA 4XQ3A 2QA4Q 1NYFA 1BB9A 2W0ZA 4ZGDB 4A4FA 4M7AG 4C8QB 1G3SA 5FLXE 1ZX6A 1YHQQ 1PNJA 1YITT 1I5LA 2QXFA 3OYFA 1HK9A 1NE8A 3GLXA 4KUDK 1NEGA 3X20B 3ME9A 2MF2A 3L42A 1M90U 3CC7T 2E5KA 4M7AA 1B34B 1Y7XA 4IUTA 1QWEA 2XDDA 3I56Q 3CPWA 2D0QB 1KSWA 1KD1U 5GAMf 1ZHIA 5DM7R 2DNUA 3ZFJA 4OVAA 4XTZA 2DA9A 4E7JA 2FYKA 3HRTA 4EDUA 1M30A 4Y92A 2RHXA 2V8JA 3PGGA 3M53A 1YFNA 1GCPA 2DIGA 3G71T 4OMFB 4HVWA 4A4HA 1VQ5T 1OZ2A 4X1VA 5KYUB 3OSVA 1QWFA 3CCJQ 1T0HA 1VQKT 1B34A 3L2VA 1VQ8Q 4HCKA 1GCQA 3CMET 1FMWA 2JZ2A 1M3BA 4ZNXA 3OYJA 3ULRB 1PC0A 1SF9A 2QQAA 2YUNA 4M7DE 2VASA 1D1CA 3DLMA 3S3OA 2KYMA 3LX7A 3QJ6A 3L2RA 1K8AU 3CCEQ 1MMNA 2K3YA 1VIFA 3DB4A 3VS2A 2DVJA 2E6NA 5CVIA 1DJ7B 5KYUA 1AZEA 4C5EA 2JNGA 4AFQC 1Q81U 3QO3A 4BUGA 5GAMd 1ZQ1A 1NBEB 4OMPA 1JXOA 3AT1B 3QJYA 2AK5A 4LDXA 2CP3A 1I5OB 2DD4A 2V26A 4EMHA 1U1SA 1K76A 4LDWA 5C0MA 3H9NA 1VQMT 1GRIA 1QVGA 3HTRA 5FU7B 3FDRA 3JB9H 1SRLA 1M9SA 1MV3A 4DEXA 1T0JA 4FIBA 2YT6A 1LCKA 4F7UF 3EGDB 2RQWA 3OYDA 5M9OA 1M1FA 1IHVA 3CQTA 3ZEHA 1PG5B 2IPOB 2OTLA 2HQXA 1X43A 3QPHA 3HRUA 3HPWA 4BI3A 1K73R 3HL8A 3JSCA 2RK1A 1EIFA 3T9NA 2ED0A 5LJ5d 4Q5WA 3A8GB 3PNWC 5KYXB 4XAXB 2RI2A 2EYWA 1Y0MA 2PZ1A 1YCYA 3CCLA 3A8MB 2CREA 1W2BA 3SWNA 2RB6A 4ANJA 4DBFA 3H41A 1OULA 2RI5A 1B7TA 3OYEA 1X69A 2CGHA 3CCVQ 1QKXA 2YDLA 1PHTA 5KCOA 1VQ4T 3DLLA 5LJ5h 2QA4T 2VYTA 4J7FA 3PIOA 2RPNA 1W1FA 1NYGA 1YHQT 1S72A 1MGQA 1WX6A 2ZPEB 1UG1A 4M77F 4PLIA 1Q82R 4OB1B 1KFZA 2NLUA 1WGSA 4ZGEB 3J80E 1B07A 3I56T 3ER0A 2DL4A 4K11A 2JMAA 4PL6A 4FM4B 1ZSGA 1AWWA 2VWFA 2IVWA 2DTIA 4FYVB 1UUEA 4PJOD 2LJ0A 3RNJA 3H0FA 1D3BB 3M5AA 4NL3A 4M75G 3CCSQ 4XU2A 1AWOA 4HCCA 4XTUA 4HVVA 5CCAA 1IGUA 4PJOF 2KROA 2COZA 3L2WA 1H3ZA 2MIOA 1ZA2B 2EQKA 1VQ8T 2DL8A 4M75A 5CR2A 1U3OA 2ROTA 4PFOA 4V2SA 2D9TA 2BZ8A 3CD6Q 1A0NB 1PKSA 2EW3A 4DBHA 1VQ6Q 1D3BA 3VV0A 4M7AD 4KT0E 2L3QA 4Y91A 3NHNA 1RL2A 2C0OA 3V8JA 5IH2A 3CCMQ 3L2QA 1K9MC 3MHXA 4DEYA 2DLPA 2AZSA 2CP7A 3RIRA 3CC4Q 4J5YA 1TSFA 1NM7A 2KY9A 4IIOA 4II1A 3OS2A 1G2BA 1VA7A 1IB8A 2CP6A 1XNIA 1RI0A 4PJLA 1HD3A 1UE9A 5LJ5e 4JRPA 4BDZA 2RHIA 2L2PA 3GF5A 2OAWA 2LZ6B 4CC4B 1WHLA 2FL7A 2DBKA 4MMLA 4JJDA 5GAN7 2DX1A 4ZTJA 2RHUA 5HK0A 2EKHA 3X26B 1VOMA 3OY9A 2XDBA 2VUBA 2X9HA 2JT4A 3OS5A 2VGNA 3I9QA 5LJ5j 2LQNA 2VVKA 4FCYA 1BYMA 2PVOB 4OMOA 5KH6A 2DKGA 2LRQA 2JJ9A 3QWYA 1YNZA 4PJMA 4C8QC 4JDSA 3M9QA 2O88A 1RI9A 5CQYA 2GGRA 2HL3A 3CMAA 2XD0A 1WIEA 3QBYA 5FU6B 2DEUA 1O9SA 4JJNK 3RUXA 5CAIA 3L2ZA 5FW9A 1C1AA 1UDLA 5IXFA 3JCMc 4M78G 4JZ3A 1BU1A 3DKMA 4Z8AA 3CXCS 3OYMA 5CO7A 1K0SA 2RD1A 1Q7YU 3UT1A 2FRYA 4J9HA 2JM9A 2O9VA 2NUPA 4A54A 5L23A 4B6MA 2DXUA 1Q82U 4NOYA 3LGFA 1XTDA 3VS4A 1NJIU 1G3WA 4M78A 1QLYA 2WSEE 4QQ6A 1I07A 2YUOA 3VRZA 1D1BA 4F7UB 1RAEB 4KULA 2QQSA 1X27A 4HCZA 1BI3A 3OW2S 1YWOA 2F2XA 3QDRB 1UHFA 5GANd 4FW1A 2DL3A 3G6EQ 1BBZA 3G71A 1Q86R 1TUGB 3JRZA 2EFIA 2QYZA 2ECZA 3HFOA 1VQ5A 1QVPA 2EGAA 2B8AA 4A53A 4L5GA 4JPBW 1K9AA 4PLLA 3VUBA 3VS5A 3PMIA 2DZ9A 1VQKA 4J7IA 2K57A 3CMEA 1VQPQ 4OGCA 4JJCA 4AFZC 1JXMA 1LJOA 1UTIA 2J6KA 4BDYA 2MK5A 3GIBA 2LCLA 1KQSA 5GAN2 1WXBA 3BDLA 3CCST 5GAOl 1VUBA 2RM4A 5GANh 1WQ7A 4ELYC 5KYYB 5CKDA 1FWZA 2G6FX 1JEGA 2DO3A 3BY7A 2X4XA 2HQEA 3CD6T 1R77A 2MWPA 3CCRQ 4BE1A 5GAN4 3SDZA 1VQNQ 4OGEA 4E7IA 2CH4A 1VQ6T 2QGFB 2A0FB 2V8KA 1J3TA 4PFPA 3JCMd 2RQUA 4M77B 1AWJA 1VQMA 3LLRA 2AZVA 1ZBJA 3NPFA 3P8HA 1JRIA 1SPKA 2RK2A 3CCMT 2KGTA 5CKFA 1T3SA 3LGLA 4M77G 4AMCA 1SKUB 1M3CA 2DAQA 3C4SA 2MCNA 2L3PA 3SD4A 4A4GA 1AD5A 3CCQQ 1YJNQ 4R55A 4AG1C 2WACA 1KC8R 2OX7A 2LC4A 4PJOB 1WHMA 3RMSA 2KRNA 4M75D 4M77A 3EG9A 1QVFA 5IHNA 2HAXA 2DTHA 1MMGA 2VXFA 2KSSA 5AYFA 3JCMh 2XHCA 4E7HA 4M75F 4P5NA 2D6FA 5HKCA 5DLQE 1QP2A 3TCJA 1NG2A 4GLMA 2DZCA 1WYXA 4WCIA 1F1BB 4BB7A 2RO0A 2E3IA 1UGRB 2LJ1A 2WSFE 4CC2A 2GTOA 3M58A 2D8HA 3C0CA 8ATCB 3HRSA 1BK2A 2R5MA 1RUWA 2COWA 1U8RA 1RAFB 1UECA 2BZXA 2VV5A 2L0AA 3EGXA 2QEXQ 1H3HA 2LQKA 2ZGWA 1WHHA 1VQ4A 4EMGA 2QA4A 1RACB 1BIBA 2DL5A 3S3NA 3ZL7C 5GANe 4CC7A 3LWIA 4WF2A 2LJ3A 1WXTA 4IUQA 4ATOA 2LTOA 2RJEA 1WLPB 1Q86U 2YXYA 4FYXB 5EC7A 1ZA1B 1P92A 2YLBA 5I2SA 4M7DG 2O31A 1RABB 2YLCA 4RKUE 1IZ6A 2E12A 2MPXC 3BDUA 4OMQA 3PMTA 2J05A 3UPUA 5GANj 1WXUA 3EFSA 4AFSC 2MWOA 4CC3A 1NLPC 2CSQA 3TU4K 4M7DA 1HXDA 1CKAA 5GAOq 1M1GA 3CEYA 3G6ET 2EAYA 2JW4A 2PU9B 2L89A 3CCUA 2VC8A 1R0BG 5LJ3d 4J9CA 3OYLA 4LD9K 4BY6B 2H3EB 2L3SA 4LUDA 1KQ2A 1IRXA 1EX4A 3NTIA 4PK4A 1W70A 4QVCA 1V29B 3QG1A 1WJSA 1HSQA 4A4KA 2ESWA 1VQOQ 4PJJA 5GAN3 1TG0A 3TREA 3JCMe 2KMTA 2DBMA 2PTKA 3VYGA 2M16A 4M78D 5FWCA 1YJWA 1NEBA 4MMKA 2AKKA 1QCOA 1M4ZA 2G3RA 3NGPA 3OB9A 4M78F 1ZSZA 3M0TA 4RMOA 1IHWA 2M51A 5LJ3h 3VS3A 1ARKA 2FVUA 2ROLA 2VGMA 3V7SA 2JS0A 3OS0A 1X6BA 1M90C 1N6AA 3CCRT 1JU5C 1SHGA 3EG3A 4C8QE 1JB0E 2P0KA 3OYAA 1VQLA 2QQBA 3G7ZA 5C6SA 1KD1C 3P8BB 3GP8A 2HBPA 4RG2A 1KC8U 2IIMA 5GAOm 4LD6A 3KBGA 4VUBA 3JAME 4KGVB 3I35A 3V7RA 4XTVA 5FRNA 4D6WA 1C0MA 2DETA 2ABLA 2JVVA 2E6ZA 2NWMA 1BI2A 1NPPA 2R58A 1AHJB 1TOVA 5FU6C 1Z9QA 1BCMA 3CCQT 1YJNT 4C0ZA 3SWNB 4XU3A 2EQUA 1PD0A 2DEQA 4D8KA 2A7YA 4C92G 5CKHA 5GAMh 1O75A 1SSHA 3H6ZA 1MMAA 3A1PA 3UWNA 1VQ9T 2CP2A 2EQJA 2NUTB 2K2MA 3VS0A 2K7AA 2XICA 2FPEA 1K8AC 5LL6S 2O9SA 4X9CA 1RAAB 3QYHB 4C92A 2DYIA 2CUBA 1N5ZA 2LQ8A 3V7CA 2JM8A 1JBMA 5DY9A 2M0YA 4PNOA 2EGEA 3LWHA 1XOVA 2QTVA 1QKWA 2OTLQ 4MZTA 2BZYA 1YJ9A 3SB2A 1KK7A 1H8KA 2E65A 2HD0A 2VKNA 2RHYA 1ACMB 5KYWA 2NUTA 4ZTFA 2DXBA 4KBMB 3CPWP 2GBQA 2B86A 2DRKA 4OB2B 1U1TA 3QSUA 2F5TX 2CZ1B 2QGGA 3CCLQ 1QMCA 2FZGB 4C92E 2OTJA 3M0UA 3S6WA 4M77D 2RMOA 3C95A 9ATCB 1AZGB 4DBRA 3M57A 3VS6A 5LJ3e 1Q7YR 3NTHA 3OYYA 5I2MA 5IN1A 4RTYA 1NJIR 1WHJA 1YCSB 3QZ5B 3FJ5A 3OBYA 3QZ9B 1YBYA 2E10A 4FW2A 4M75B 5GMKl 2QQ9A 2XKOC 3I55A 1PRLC 1FXXA 5HK3A 2GTJA 3GNGA 3RKWA 1N9RA 1IXDA 2DMOA 3CCSA 5LJ3j 2X3WD 4J9EA 1S72Q 2MAMA 2EKOA 1YIJQ 3BW1A 4EMKC 1TS9A 3MP6A 4N0AA 2LNHB 2KXDA 2PNIA 4LDYA 1MNDA 2M1HA 3CCJT 3PFSA 2L8DA 2W10A 2EIFA 5GAMe 1V76A 4E7KA 2YSQA 1U06A 3OYCA 1M8MA 1VQOT 1UGSB 2J6FA 3PE0A 3VUZA 2XIDA 2F5KA 1QCNA 4LDVA 2HKQB 3QKJA 3CCET 4C5GA 1QVGP 4QKUA 1I0CA 2A3LA 2BIVA 1X75C 2CT4A 2RA2A 2FB7A 2XU8A 1VQ7A 4M7DD 2QASA 2CT3A 5GAMj 2KQWA 3QUIA 4J8OA 2O4XA 4PJOC 1OOTA 3MEVA 3GBQA 1YI2A 2HL5C 4DOVA 1G8XA 1X2QA 4M7DF 4F17A 1IO6A 3ASKA 1TXQA 2FRWA 3JB9J 2DD5A 2RQTA 4ZGJB 3PIPA 3TSZA 5J3BA 1UGVA 1X2KA 4O5VA 1M1KR 3OYHA 2YUQA 3M0SA 4HA8A 3E9GA 4J6XA 4RTVA 2F2WA 3RKXA 4OB0B 4C5IA 1JJ2P 3RESA 3EFRA 1WA7A 1KJWA 2O2OA 2CP0A 2C0IA 2F1LA 1WJQA 2YHTA 1FMVA 1WJRA 2XDPA 3FB9A 1K4US 3E9FA 3UA7A 4MDXA 4M7AC 2DXTA 4QT7A 4BI4A 1WHKA 3JCMV 4N4GA 3WXMB 1W2BP 4HXJA 3EGUA 3S3MA 3FRNA 1UFFA 4RTZA 2AHJB 3MKDA 4ORZA 4QQGA 2NUPB
chains in the Genus database with same CATH topology
3VRYA 1W6XA 2AZVA 1ZBJA 4X1VA 3NPFA 2BTTA 1SPKA 3U23A 1QWFA 4RTTA 4E6RA 1T0HA 2DILA 3VS7A 4HCKA 2JS2A 2DL7A 1K1ZA 1GCQA 2KGTA 4D8DA 1T3SA 2EYYA 1M3BA 4ZNXA 3ULRB 4R0KA 1M3CA 2YUNA 3R6NA 2MCNA 2KYMA 2L3PA 1AD5A 4OMMA 2C0TA 1GCQC 4AG1C 5IHKA 1YP5A 2KRNA 4HVUA 1MUZA 5IHNA 3VS2A 2CDTA 2DVJA 1Z9ZA 1ZUYA 1AZEA 4AFQC 4J9GA 2FPDA 4LE9A 2J7IA 2KE9A 4KRTA 4F14A 4OMPA 1JXOA 1NG2A 4GLMA 1WYXA 2AK5A 4WCIA 2LJ1A 4CC2A 1KIKA 2GTOA 1K76A 2D8HA 3C0CA 1BK2A 3M0RA 1RUWA 2DE0X 1UECA 2ENMA 4JJBA 2BZXA 2L0AA 1GRIA 3RBBB 1H3HA 1SRLA 1ZUKA 1MV3A 4DEXA 1E6HA 1UJYA 1T0JA 2DL5A 2LX7A 3ZL7C 2YT6A 1LCKA 3IQLA 3EHRA 4CC7A 4J9FA 1WI7A 2LJ3A 1OV3A 2I0NA 2RQWA 1WXTA 1ZLMA 3TVTA 1OPLA 1RLPC 1M3AA 4AFUC 3CQTA 1WLPB 3O5ZA 1X43A 5EC7A 3SEMA 1H92A 2O31A 1B3QA 2DJQA 2ED0A 2EBPA 4ESRA 2JMCA 2JTEA 1YWPA 1VYTA 4OMQA 2FEIA 2V1QA 2J05A 5FWBA 1WXUA 2D1XA 2EYWA 4AFSC 5I11A 4CC3A 1NLPC 2CSQA 1Y0MA 2PZ1A 1CKAA 4Z88A 1E6GA 1E7OA 1PWTA 2CREA 2RQVA 3JV3A 2DYBA 2CUDA 2JW4A 3H41A 4J9CA 1X69A 2L3SA 5IXBA 2RNAA 4LUDA 4M4ZA 1QKXA 2EYXA 2YDLA 1W70A 1PHTA 1MV0B 1FMKA 2J06A 1HSQA 1NLOC 2RPNA 2ESWA 1GBQA 2CSIA 2QDLA 1TG0A 1GBRA 1W1FA 1NYGA 2EPDA 4Z89A 2DBMA 2PTKA 4J9BA 4IIMA 1WX6A 5FWCA 1UG1A 2EYZA 2OI3A 1NEBA 2LP5A 3EHQA 2AKKA 1OPKA 1ABQA 1YN8A 1KFZA 3NGPA 1B07A 3M0TA 2DL4A 1S1NA 2KT1A 2M51A 2KR3A 2V1RA 4K11A 2JMAA 2ROLA 3VS3A 1ARKA 1ZSGA 1UJ0A 2JS0A 1AWWA 2VWFA 2RF0A 1X6BA 2K9GA 1UUEA 1JU5C 1SHGA 2OJ2A 2MOXA 3EG3A 1ABOA 2LJ0A 3RNJA 3H0FA 2FPFA 1AWOA 3EG0A 4HVVA 1GFCA 2JXBA 2IIMA 1TUDA 2KROA 3QWXX 1JQQA 1WFWA 2KNBB 4FSSA 2MIOA 3I35A 2RQRA 2DL8A 2ABLA 1U3OA 2A08A 2HSPA 2ROTA 2NWMA 3M0PA 2BZ8A 1A0NB 2LQWA 1PKSA 2HEQA 2D8JA 1Z9QA 2EW3A 4OMLA 1AEYA 4RTWA 4F16A 4D8KA 4LNPA 4J9IA 2L3QA 3NHNA 1SSHA 2LCSA 2C0OA 4AG2C 1RLQC 1GL5A 1V1CA 5IH2A 3UATA 2K2MA 3VS0A 1PKTA 2DF6A 2K7AA 2FPEA 4DEYA 2O9SA 2DLPA 2AZSA 1WDXA 1M27C 1VYVA 2GQIA 2CUBA 1NM7A 4IIOA 1N5ZA 1UHCA 4GBQA 2JM8A 1G2BA 1VA7A 3PVLA 2M0YA 1CSKA 2DM1A 2EGEA 1XOVA 2YUPA 1HD3A 1QKWA 1Y57A 1UE9A 3LH5A 2BZYA 1AWXA 2L2PA 2OAWA 3THKA 1H8KA 4JZ4A 2VKNA 1QCFA 2LZ6B 4CC4B 3TSWA 2DBKA 2GBQA 4JJDA 3A98A 2B86A 2DX1A 3KFVA 2DRKA 3H0HA 2A36A 5GJVB 2EKHA 4RTXA 4RUGA 1HJDA 3M0UA 1SEMA 2JT4A 3EG2A 2RMOA 1AZGB 3I9QA 2LQNA 2VVKA 3VS6A 5ECAA 4OMOA 1I1JA 2HCKA 2KXCA 3QWYA 1YNZA 2O88A 1RI9A 5I22A 4RTYA 2ED1A 4RTUA 2GGRA 1WIEA 3EG1A 4J9DA 2FO0A 1PRMC 2A28A 1YCSB 4A63B 3VS1A 3FJ5A 2SRCA 1ZUUA 1PRLC 5FW9A 2F2VA 5GJWB 1UDLA 5IXFA 2GTJA 3REBB 2LMJA 1EFNA 1T3LA 4JZ3A 1BU1A 2DMOA 2J6OA 2XMFA 4Z8AA 2EVRA 2KBTA 1U5SA 2X3WD 4J9EA 1K0SA 4OMNA 2KT8A 2FG0A 2FRYA 4J9HA 2JM9A 3H0IA 2O9VA 5L23A 2CH4W 2LNHB 2KXDA 2P4RA 2PNIA 3VS4A 2DRMA 1TUCA 2AKLA 1FYNA 1QLYA 2W10A 1I07A 2YUOA 3VRZA 1K0XA 2SEMA 1AVZC 2HBWA 1JO8A 1VYUA 2YSQA 1X27A 2K3BA 3SHWA 1U06A 1YWOA 2F2XA 1M8MA 1UHFA 2KRMA 3I5RA 3PVQA 2J6FA 1X6GA 2DL3A 1BBZA 1OEBA 3NMZC 3PE0A 1CKBA 2K6DA 4EIKA 2K79A 2ECZA 2EGAA 1GFDA 4JPBW 4LUEA 1K9AA 2EQIA 3VS5A 3UF4A 2A37A 1I0CA 3M0QA 1AOJA 2CT4A 3I5SA 1SRMA 2NUZA 3REAB 2HDAA 2CT3A 4JJCA 4AFZC 2KYBA 2KRSA 1OOTA 2D0NA 3GBQA 1NYFA 1BB9A 1JXMA 1UTIA 2J6KA 2W0ZA 1X2QA 4F17A 1SHFA 1IO6A 2FRWA 2RQTA 3TSZA 1UGVA 1X2KA 1ZX6A 1WXBA 2X3XD 1PNJA 2YUQA 3M0SA 4LN2A 5HCKA 2GNCA 2F2WA 4RTVA 1NEGA 1WA7A 1KJWA 2E5KA 2G6FX 5IHIA 1JEGA 2O2OA 1QWEA 2H8HA 2C0IA 2RN8A 1KSWA 2EGCA 1K4US 2DNUA 3UA7A 3UA6A 2DA9A 2KEAA 4QT7A 2CH4A 1M30A 4Y92A 1GCPA 4HXJA 3EGUA 1J3TA 1G83A 1UFFA 4RTZA 4HVWA 2RQUA 4ORZA 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRY A;  1W6X A;  2AZV A;  1ZBJ A;  4X1V A;  3NPF A;  2BTT A;  1SPK A;  3U23 A;  1QWF A;  4RTT A;  4E6R A;  1T0H A;  2DIL A;  3VS7 A;  4HCK A;  2JS2 A;  2DL7 A;  1K1Z A;  1GCQ A;  2KGT A;  4D8D A;  1T3S A;  2EYY A;  1M3B A;  4ZNX A;  3ULR B;  4R0K A;  1M3C A;  2YUN A;  3R6N A;  2MCN A;  2KYM A;  2L3P A;  1AD5 A;  4OMM A;  2C0T A;  1GCQ C;  4AG1 C;  5IHK A;  1YP5 A;  2KRN A;  4HVU A;  1MUZ A;  5IHN A;  3VS2 A;  2CDT A;  2DVJ A;  1Z9Z A;  1ZUY A;  1AZE A;  4AFQ C;  4J9G A;  2FPD A;  4LE9 A;  2J7I A;  2KE9 A;  4KRT A;  4F14 A;  4OMP A;  1JXO A;  1NG2 A;  4GLM A;  1WYX A;  2AK5 A;  4WCI A;  2LJ1 A;  4CC2 A;  1KIK A;  2GTO A;  1K76 A;  2D8H A;  3C0C A;  1BK2 A;  3M0R A;  1RUW A;  2DE0 X;  1UEC A;  2ENM A;  4JJB A;  2BZX A;  2L0A A;  1GRI A;  3RBB B;  1H3H A;  1SRL A;  1ZUK A;  1MV3 A;  4DEX A;  1E6H A;  1UJY A;  1T0J A;  2DL5 A;  2LX7 A;  3ZL7 C;  2YT6 A;  1LCK A;  3IQL A;  3EHR A;  4CC7 A;  4J9F A;  1WI7 A;  2LJ3 A;  1OV3 A;  2I0N A;  2RQW A;  1WXT A;  1ZLM A;  3TVT A;  1OPL A;  1RLP C;  1M3A A;  4AFU C;  3CQT A;  1WLP B;  3O5Z A;  1X43 A;  5EC7 A;  3SEM A;  1H92 A;  2O31 A;  1B3Q A;  2DJQ A;  2ED0 A;  2EBP A;  4ESR A;  2JMC A;  2JTE A;  1YWP A;  1VYT A;  4OMQ A;  2FEI A;  2V1Q A;  2J05 A;  5FWB A;  1WXU A;  2D1X A;  2EYW A;  4AFS C;  5I11 A;  4CC3 A;  1NLP C;  2CSQ A;  1Y0M A;  2PZ1 A;  1CKA A;  4Z88 A;  1E6G A;  1E7O A;  1PWT A;  2CRE A;  2RQV A;  3JV3 A;  2DYB A;  2CUD A;  2JW4 A;  3H41 A;  4J9C A;  1X69 A;  2L3S A;  5IXB A;  2RNA A;  4LUD A;  4M4Z A;  1QKX A;  2EYX A;  2YDL A;  1W70 A;  1PHT A;  1MV0 B;  1FMK A;  2J06 A;  1HSQ A;  1NLO C;  2RPN A;  2ESW A;  1GBQ A;  2CSI A;  2QDL A;  1TG0 A;  1GBR A;  1W1F A;  1NYG A;  2EPD A;  4Z89 A;  2DBM A;  2PTK A;  4J9B A;  4IIM A;  1WX6 A;  5FWC A;  1UG1 A;  2EYZ A;  2OI3 A;  1NEB A;  2LP5 A;  3EHQ A;  2AKK A;  1OPK A;  1ABQ A;  1YN8 A;  1KFZ A;  3NGP A;  1B07 A;  3M0T A;  2DL4 A;  1S1N A;  2KT1 A;  2M51 A;  2KR3 A;  2V1R A;  4K11 A;  2JMA A;  2ROL A;  3VS3 A;  1ARK A;  1ZSG A;  1UJ0 A;  2JS0 A;  1AWW A;  2VWF A;  2RF0 A;  1X6B A;  2K9G A;  1UUE A;  1JU5 C;  1SHG A;  2OJ2 A;  2MOX A;  3EG3 A;  1ABO A;  2LJ0 A;  3RNJ A;  3H0F A;  2FPF A;  1AWO A;  3EG0 A;  4HVV A;  1GFC A;  2JXB A;  2IIM A;  1TUD A;  2KRO A;  3QWX X;  1JQQ A;  1WFW A;  2KNB B;  4FSS A;  2MIO A;  3I35 A;  2RQR A;  2DL8 A;  2ABL A;  1U3O A;  2A08 A;  2HSP A;  2ROT A;  2NWM A;  3M0P A;  2BZ8 A;  1A0N B;  2LQW A;  1PKS A;  2HEQ A;  2D8J A;  1Z9Q A;  2EW3 A;  4OML A;  1AEY A;  4RTW A;  4F16 A;  4D8K A;  4LNP A;  4J9I A;  2L3Q A;  3NHN A;  1SSH A;  2LCS A;  2C0O A;  4AG2 C;  1RLQ C;  1GL5 A;  1V1C A;  5IH2 A;  3UAT A;  2K2M A;  3VS0 A;  1PKT A;  2DF6 A;  2K7A A;  2FPE A;  4DEY A;  2O9S A;  2DLP A;  2AZS A;  1WDX A;  1M27 C;  1VYV A;  2GQI A;  2CUB A;  1NM7 A;  4IIO A;  1N5Z A;  1UHC A;  4GBQ A;  2JM8 A;  1G2B A;  1VA7 A;  3PVL A;  2M0Y A;  1CSK A;  2DM1 A;  2EGE A;  1XOV A;  2YUP A;  1HD3 A;  1QKW A;  1Y57 A;  1UE9 A;  3LH5 A;  2BZY A;  1AWX A;  2L2P A;  2OAW A;  3THK A;  1H8K A;  4JZ4 A;  2VKN A;  1QCF A;  2LZ6 B;  4CC4 B;  3TSW A;  2DBK A;  2GBQ A;  4JJD A;  3A98 A;  2B86 A;  2DX1 A;  3KFV A;  2DRK A;  3H0H A;  2A36 A;  5GJV B;  2EKH A;  4RTX A;  4RUG A;  1HJD A;  3M0U A;  1SEM A;  2JT4 A;  3EG2 A;  2RMO A;  1AZG B;  3I9Q A;  2LQN A;  2VVK A;  3VS6 A;  5ECA A;  4OMO A;  1I1J A;  2HCK A;  2KXC A;  3QWY A;  1YNZ A;  2O88 A;  1RI9 A;  5I22 A;  4RTY A;  2ED1 A;  4RTU A;  2GGR A;  1WIE A;  3EG1 A;  4J9D A;  2FO0 A;  1PRM C;  2A28 A;  1YCS B;  4A63 B;  3VS1 A;  3FJ5 A;  2SRC A;  1ZUU A;  1PRL C;  5FW9 A;  2F2V A;  5GJW B;  1UDL A;  5IXF A;  2GTJ A;  3REB B;  2LMJ A;  1EFN A;  1T3L A;  4JZ3 A;  1BU1 A;  2DMO A;  2J6O A;  2XMF A;  4Z8A A;  2EVR A;  2KBT A;  1U5S A;  2X3W D;  4J9E A;  1K0S A;  4OMN A;  2KT8 A;  2FG0 A;  2FRY A;  4J9H A;  2JM9 A;  3H0I A;  2O9V A;  5L23 A;  2CH4 W;  2LNH B;  2KXD A;  2P4R A;  2PNI A;  3VS4 A;  2DRM A;  1TUC A;  2AKL A;  1FYN A;  1QLY A;  2W10 A;  1I07 A;  2YUO A;  3VRZ A;  1K0X A;  2SEM A;  1AVZ C;  2HBW A;  1JO8 A;  1VYU A;  2YSQ A;  1X27 A;  2K3B A;  3SHW A;  1U06 A;  1YWO A;  2F2X A;  1M8M A;  1UHF A;  2KRM A;  3I5R A;  3PVQ A;  2J6F A;  1X6G A;  2DL3 A;  1BBZ A;  1OEB A;  3NMZ C;  3PE0 A;  1CKB A;  2K6D A;  4EIK A;  2K79 A;  2ECZ A;  2EGA A;  1GFD A;  4JPB W;  4LUE A;  1K9A A;  2EQI A;  3VS5 A;  3UF4 A;  2A37 A;  1I0C A;  3M0Q A;  1AOJ A;  2CT4 A;  3I5S A;  1SRM A;  2NUZ A;  3REA B;  2HDA A;  2CT3 A;  4JJC A;  4AFZ C;  2KYB A;  2KRS A;  1OOT A;  2D0N A;  3GBQ A;  1NYF A;  1BB9 A;  1JXM A;  1UTI A;  2J6K A;  2W0Z A;  1X2Q A;  4F17 A;  1SHF A;  1IO6 A;  2FRW A;  2RQT A;  3TSZ A;  1UGV A;  1X2K A;  1ZX6 A;  1WXB A;  2X3X D;  1PNJ A;  2YUQ A;  3M0S A;  4LN2 A;  5HCK A;  2GNC A;  2F2W A;  4RTV A;  1NEG A;  1WA7 A;  1KJW A;  2E5K A;  2G6F X;  5IHI A;  1JEG A;  2O2O A;  1QWE A;  2H8H A;  2C0I A;  2RN8 A;  1KSW A;  2EGC A;  1K4U S;  2DNU A;  3UA7 A;  3UA6 A;  2DA9 A;  2KEA A;  4QT7 A;  2CH4 A;  1M30 A;  4Y92 A;  1GCP A;  4HXJ A;  3EGU A;  1J3T A;  1G83 A;  1UFF A;  4RTZ A;  4HVW A;  2RQU A;  4ORZ A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 1OI1 A;  4XTX A;  3J7A F;  3G4S Q;  2ZZD A;  1KG1 A;  4RTT A;  4M78 B;  5CIU A;  2DIL A;  5GAN 8;  4D8D A;  2GFA A;  4Y28 E;  3KXT A;  2AIR B;  4R0K A;  3E1S A;  3JCM Q;  2JUF A;  2AT1 B;  3MEW A;  3R6N A;  2C0T A;  4OB3 B;  1GCQ C;  1AT1 B;  4B9W A;  1D0X A;  2OTL T;  3CXC A;  1YIT A;  4HVU A;  3J81 E;  2K5L A;  3CC7 A;  4DA4 A;  2CDT A;  3CMA Q;  3CCV T;  1ZUY A;  2LCC A;  1MMD A;  3A8O B;  2JOY A;  4DOW A;  2E1H A;  2J7I A;  1K73 C;  2KE9 A;  1OU8 A;  4BY6 C;  2E70 A;  4F14 A;  1X01 A;  3N5B B;  3CCL T;  4LDU A;  2MYS A;  3OW2 A;  5GMK i;  5J26 A;  3O8V A;  1I4K 1;  4JRQ A;  1H64 1;  3UDC A;  4KGX B;  4MZM A;  2DE0 X;  2ENM A;  3HHT B;  4JJB A;  1QQJ A;  3RBB B;  1ZUK A;  1E6H A;  2YRV A;  5FRO A;  1UJY A;  5CKB A;  3BFM A;  3RKY A;  3EHR A;  2Y4Y A;  4C92 F;  5A2Q E;  5D7U A;  2LDM A;  2MMP A;  3TVT A;  2CZ6 B;  2R57 A;  2PVG B;  4NL2 A;  3CBO A;  2LT4 A;  1S72 T;  2DER A;  1YIJ T;  3PTA A;  2P0Q A;  1B3Q A;  4E2F B;  3HSB A;  5EG2 A;  2EBP A;  1KQ1 A;  3EFO B;  2ATC B;  2GFU A;  1BI0 A;  4ESR A;  2C06 A;  2LT1 A;  2JTE A;  1YWP A;  2PUO B;  3OYG A;  1OU9 A;  2FEI A;  5I11 A;  1Q82 C;  1G5V A;  5CKE A;  4HT8 A;  2X35 A;  5GMK m;  4O6J A;  3NFC A;  2L3R A;  2XI9 A;  5FU7 C;  2VB6 A;  2FHD A;  2LVM A;  2RQV A;  3JV3 A;  3A8H B;  3OYK A;  3FC3 A;  4HCB A;  3TEE A;  2CUD A;  4B9X A;  1M1K U;  2VXE A;  1LVK A;  3EG9 B;  3CC2 Q;  5IXB A;  4M4Z A;  4AT1 B;  3EFO A;  5GAN 6;  3SWN C;  2QK0 A;  3MEA A;  3MET A;  1MV0 B;  3OMG A;  5GAO n;  4F7U E;  1NLO C;  2X4J A;  3CC4 T;  3JCM P;  2GF7 A;  1GBQ A;  2CSI A;  3CCQ A;  5KYN A;  1GBR A;  2DK3 A;  4DQ2 A;  2EPD A;  1UEB A;  3QDF A;  1ZBX A;  4N4H A;  2EYZ A;  3EH1 A;  1VQM Q;  1VQ9 A;  3EHQ A;  2ZPH B;  3EGX B;  2FZK B;  4JRI A;  5A0L A;  3OYB A;  4PKC C;  1S1N A;  2KR3 A;  3E2U A;  4CRI A;  1UJ0 A;  1IRE B;  2K5I A;  4WTO B;  4E47 A;  2RF0 A;  1D09 B;  2OJ2 A;  2MOX A;  1D0Z A;  4JUV A;  3EAE A;  4IUR A;  2Y4X A;  3RMQ A;  2MI6 A;  1W4S A;  5GAM g;  3P8D A;  3EG0 A;  1WPY A;  3FIF A;  3JCM W;  1M8V A;  3QWX X;  1JQQ A;  1LPL A;  3G4S T;  2GCX A;  3VJP A;  4PJN A;  1M2O A;  1EZZ B;  2CYZ B;  2RQR A;  3CBP A;  5KE2 A;  2A08 A;  2LX9 A;  3FEO A;  3M0P A;  2EJ9 A;  1I8F A;  4FYW B;  3TQ7 P;  2KDS A;  4F04 B;  4M7D B;  3LW5 E;  2X4W A;  2X51 A;  1AEY A;  4RTW A;  1YHQ A;  4M75 C;  2R5A A;  4F16 A;  1N8R C;  4KH1 B;  1XQH A;  4J9I A;  2EQM A;  3C94 A;  2LCS A;  3A8L B;  2M0O A;  4BI8 B;  1RLQ C;  1GL5 A;  2WSC E;  5IT9 E;  3UAT A;  2QQR A;  3CMA T;  2X4Y A;  2ZPF B;  5J39 A;  3I56 A;  1PKT A;  2DF6 A;  3MP1 A;  3URG A;  2ZPI B;  2KVQ G;  5LJ5 g;  1M27 C;  3OQ5 A;  1MNE A;  4GBQ A;  1M2V B;  1KQS P;  2DM1 A;  1BCO A;  2YUP A;  1NZ9 A;  2RJF A;  3LH5 A;  3JB9 I;  4C8Q G;  1AWX A;  2EWN A;  3V8K A;  3H8Z A;  5KCH A;  4PJO E;  1Y96 A;  5CK9 A;  3CPW S;  2DPP B;  1QCF A;  4FL6 A;  4KH0 B;  3CCJ A;  1OQK A;  1SG5 A;  2DIQ A;  1VQ8 A;  3QHS A;  3TSW A;  1ZSZ B;  1VIE A;  3NTK A;  2ZAE A;  1VQP T;  1TH7 A;  3KFV A;  5AT1 B;  3H0H A;  1VQO A;  2A36 A;  2DVE A;  2I2L A;  2DTO A;  5GJV B;  1M5Q 1;  2PVD B;  4C8Q A;  4GY5 A;  4RUG A;  4QVZ A;  4HT9 A;  1M2V A;  2BE7 D;  1SEM A;  3EG2 A;  1K9M R;  5ECA A;  1I1J A;  3CCU Q;  4NS5 A;  3CCE A;  4UC4 A;  4BAC A;  2GQV A;  2RHZ A;  2JTM A;  4JRK A;  3EG1 A;  1PRM C;  2A28 A;  2CKK A;  2EYQ A;  4A63 B;  1Q86 C;  4M7A E;  3MO8 A;  4MDW A;  2K2V A;  2YRC A;  2F2V A;  5L8R E;  2QG9 B;  2LMJ A;  1T3L A;  2J6O A;  2QAZ A;  3WVE B;  1VQN T;  2BUD A;  4OMN A;  2KT8 A;  3A5Z B;  2FG0 A;  3M4G A;  5LJ5 f;  3H0I A;  1YJW Q;  2CH4 W;  2XK0 A;  3CC2 T;  1QVF P;  4FSX A;  2QI2 A;  4A4E A;  2AKL A;  1FYN A;  4FU6 A;  2SEM A;  1AVZ C;  1JO8 A;  1VYU A;  4C92 B;  3SHW A;  3GNF B;  4M78 C;  2KRM A;  4Z02 A;  4JLI A;  3NMZ C;  4YTL A;  1VQL Q;  3R6O A;  2K6D A;  4EIK A;  5GMK h;  1D0Y A;  3X24 B;  3EH2 A;  1QVG S;  4LUE A;  2CZ0 B;  4MZP A;  2E64 A;  1QW1 A;  2A37 A;  2E5Q A;  1AOJ A;  5KYW B;  2HDA A;  3FLG A;  2KYB A;  2D0N A;  4R56 A;  1LNX A;  4IKF A;  1SHF A;  3MPU B;  8AT1 B;  2X3X D;  3DB3 A;  1Q81 C;  3QXE B;  1N9S A;  1JJ2 S;  7AT1 B;  1OYX A;  4IUP A;  4LN2 A;  1JJ2 A;  5HCK A;  2GNC A;  2YWW A;  4C5H A;  3CCV A;  3INZ A;  5IHI A;  1OX9 A;  4EPC A;  2H8H A;  2QEX T;  2RN8 A;  2EGC A;  1TWB A;  3M56 A;  1KC8 C;  3EGD A;  5IAY A;  2ZPB B;  2F69 A;  3UA6 A;  1W2B S;  4BE0 A;  2KEA A;  4JS4 A;  2EJG A;  2P84 A;  1KHC A;  2LNV A;  3MCA B;  3JCM X;  1G83 A;  1YJ9 Q;  3MEU A;  3VRY A;  1W6X A;  3SFM A;  5GAO r;  3OS1 A;  2BTT A;  5KYX A;  3U23 A;  4C0D B;  4E6R A;  3OYI A;  3VS7 A;  2JS2 A;  2DL7 A;  1K1Z A;  3AHU A;  3WVD B;  2EYY A;  1WZO A;  2OTJ Q;  4OMM A;  1YIJ A;  5IHK A;  4ZN1 A;  3L2U A;  1YP5 A;  1K9M U;  3LH0 A;  1MUZ A;  3JCM b;  2CS7 A;  1Z9Z A;  3C12 A;  2E4H A;  1FX7 A;  4J9G A;  5GMK e;  2FPD A;  4LE9 A;  3RER A;  2O4X B;  3HFN A;  3M54 A;  3OSS C;  2QDY B;  4KRT A;  3I55 Q;  4N4I A;  1Y71 A;  4M77 C;  2H3J A;  4LXC A;  3CD6 A;  3G1J A;  2RH2 A;  1QP3 A;  3M4Y A;  1KIK A;  1VQ6 A;  1R8O B;  1G3T A;  3CCU T;  3M0R A;  4IUV A;  5GAN g;  1PSF A;  2P4T A;  2JTF A;  1R0C B;  3CCM A;  5GMK j;  3HP9 A;  1OX8 A;  4X34 A;  2COY A;  2P0P A;  2LX7 A;  4HKE A;  3CC4 A;  1TU0 B;  3IQL A;  4J9F A;  1WI7 A;  3JB9 G;  1OV3 A;  2I0N A;  1ZLM A;  1OPL A;  1RLP C;  1M3A A;  1IGQ A;  4J6W A;  5CQX A;  1RAD B;  4FT4 A;  4AFU C;  2NYS A;  3O5Z A;  2XG8 D;  2PUK B;  2CZ7 B;  4CI0 C;  1YJW T;  4KGZ B;  3SEM A;  1H92 A;  2DJQ A;  4M7A F;  2RJC A;  2JMC A;  1Y07 A;  1VYT A;  4C8Q D;  1VQ7 Q;  4E7L A;  1RAG B;  2V1Q A;  5FWB A;  3M59 A;  2D1X A;  4JS5 A;  4M75 E;  3RDV A;  3VYH B;  1YI2 Q;  2HMA A;  4RCB A;  4C8Q F;  4Z88 A;  1E6G A;  1NPR A;  1E7O A;  1PWT A;  1WHG A;  1WNL A;  1VQL T;  2DYB A;  2DFU A;  3F70 A;  2K3X A;  1TTH B;  4XU1 A;  3OBW A;  1K73 U;  3G4S A;  3GOX A;  2RI3 A;  4XK8 E;  4M7D C;  1BI1 A;  4IUU A;  2RNA A;  1UB4 A;  3JCM J;  2EYX A;  2HZY A;  4BD3 A;  1N8R R;  3VU3 C;  1C6V X;  2ZPG B;  3JCM g;  2IG0 A;  4L59 A;  2KI7 A;  4BE2 A;  4E7Z A;  1FMK A;  2J06 A;  5GAN f;  2BKD N;  4QW2 A;  2HNI A;  1WQW A;  3MJX A;  1SSF A;  3MP8 A;  1UGP B;  2QDL A;  4DBQ A;  2QTX A;  5GAO p;  4Z89 A;  2M9U A;  4J9B A;  4IIM A;  2FZC B;  2OI3 A;  1I81 A;  5FRM A;  2LP5 A;  5GAN 5;  1OPK A;  1ABQ A;  1YN8 A;  2YRD A;  2E3H A;  2KT1 A;  2V1R A;  4X9D A;  2DXC A;  4FYY B;  2K4Y A;  3BE3 A;  2K9G A;  1GXI E;  1ABO A;  4QVD A;  3KUF A;  3G6E A;  1ZSZ C;  2FPF A;  1UGQ B;  2V8I A;  1GFC A;  1YIT Q;  2JXB A;  1TUD A;  1YJ9 T;  4PFZ A;  5HY6 A;  3LYI A;  5D6X A;  1WFW A;  2KNB B;  3CC7 Q;  4FSS A;  1VQP A;  4C92 D;  2DJZ A;  3FJP A;  2HKN A;  2BE9 B;  2HSP A;  5DLO A;  1HYO A;  2LQW A;  4ME7 A;  2HEQ A;  2D8J A;  4J6Y A;  2OTJ T;  4OML A;  4RG8 A;  2OAU A;  6AT1 B;  3JCM f;  2M02 A;  4F7U G;  4GLK A;  3G71 Q;  4LNP A;  2HQH A;  2E41 A;  1M90 R;  1VQ5 Q;  1RAI B;  1PD1 A;  3ZBD A;  4AG2 C;  1V1C A;  5KE3 A;  3RR6 A;  3QYG B;  1KD1 R;  4ZN3 A;  1VQK Q;  4M78 E;  3CME Q;  3HKS A;  1Q7Y C;  4F7U A;  1OZ3 A;  3I55 T;  1WDX A;  4OF1 A;  1VYV A;  2GQI A;  1KQS S;  1UHC A;  3CCR A;  1VQN A;  3PVL A;  1NJI C;  5A0D A;  1CSK A;  3L1A A;  3E19 A;  1Y57 A;  4C92 C;  3CC2 A;  4XTY A;  2K5F A;  5D6Y A;  3THK A;  4J83 A;  4JZ4 A;  2O01 E;  1RAH B;  2KK4 A;  3CPF A;  1D1A A;  3A98 A;  4QQD A;  5LJ3 g;  4E7S A;  4ELZ C;  3VKI A;  4EMK B;  4RTX A;  3V8L A;  1HJD A;  1X6O A;  2RJD A;  1YJN A;  3OMC A;  3Q1J A;  1K8A R;  4TVR A;  2Y90 A;  2HSE B;  2HCK A;  2KXC A;  5KYY A;  2CP5 A;  5I22 A;  2ED1 A;  3PT9 A;  4RTU A;  1BKB A;  1XJW B;  2Z0W A;  4J9D A;  2FO0 A;  1Q81 R;  4XTW A;  1VQ7 T;  3VS1 A;  2SRC A;  1N8R U;  1G3Y A;  1MHN A;  2JN0 A;  1ZUU A;  1YI2 T;  4XU0 A;  5GJW B;  3REB B;  4EMK A;  3OYN A;  1EFN A;  4C0F A;  4L6V 5;  2XMF A;  2EVR A;  2KBT A;  1U5S A;  1BIA A;  5D6W A;  3M55 A;  3CXC P;  1PM3 A;  2ZCF B;  1QVF S;  1KHI A;  2EJF A;  1VQ9 Q;  2P4R A;  2L5Q A;  2DRM A;  2QEX A;  1TUC A;  5I21 A;  4KUI A;  4PJO G;  1M1K C;  1K0X A;  1Q95 G;  2HBW A;  3X28 B;  2PQW A;  3X25 B;  4N0A C;  2K3B A;  3D7S B;  4C0D C;  4C0G A;  1PSE A;  3I5R A;  3PVQ A;  3OW2 P;  1X6G A;  1OEB A;  1CKB A;  5A0G A;  3JB9 D;  2K79 A;  5LJ3 f;  4JLG A;  1GFD A;  4PJO A;  4FT2 A;  2KAF A;  1N27 A;  2EQI A;  4OP0 A;  3OA6 A;  4M7A B;  1Y96 B;  1PCX A;  3UF4 A;  4M77 E;  3JB9 F;  3M0Q A;  3I5S A;  3CBM A;  1SRM A;  2NUZ A;  3REA B;  3GPL A;  4RCC A;  3QII A;  1VQ4 Q;  1LOJ A;  2KRS A;  4XQ3 A;  2QA4 Q;  1NYF A;  1BB9 A;  2W0Z A;  4ZGD B;  4A4F A;  4M7A G;  4C8Q B;  1G3S A;  5FLX E;  1ZX6 A;  1YHQ Q;  1PNJ A;  1YIT T;  1I5L A;  2QXF A;  3OYF A;  1HK9 A;  1NE8 A;  3GLX A;  4KUD K;  1NEG A;  3X20 B;  3ME9 A;  2MF2 A;  3L42 A;  1M90 U;  3CC7 T;  2E5K A;  4M7A A;  1B34 B;  1Y7X A;  4IUT A;  1QWE A;  2XDD A;  3I56 Q;  3CPW A;  2D0Q B;  1KSW A;  1KD1 U;  5GAM f;  1ZHI A;  5DM7 R;  2DNU A;  3ZFJ A;  4OVA A;  4XTZ A;  2DA9 A;  4E7J A;  2FYK A;  3HRT A;  4EDU A;  1M30 A;  4Y92 A;  2RHX A;  2V8J A;  3PGG A;  3M53 A;  1YFN A;  1GCP A;  2DIG A;  3G71 T;  4OMF B;  4HVW A;  4A4H A;  1VQ5 T;  1OZ2 A;  4X1V A;  5KYU B;  3OSV A;  1QWF A;  3CCJ Q;  1T0H A;  1VQK T;  1B34 A;  3L2V A;  1VQ8 Q;  4HCK A;  1GCQ A;  3CME T;  1FMW A;  2JZ2 A;  1M3B A;  4ZNX A;  3OYJ A;  3ULR B;  1PC0 A;  1SF9 A;  2QQA A;  2YUN A;  4M7D E;  2VAS A;  1D1C A;  3DLM A;  3S3O A;  2KYM A;  3LX7 A;  3QJ6 A;  3L2R A;  1K8A U;  3CCE Q;  1MMN A;  2K3Y A;  1VIF A;  3DB4 A;  3VS2 A;  2DVJ A;  2E6N A;  5CVI A;  1DJ7 B;  5KYU A;  1AZE A;  4C5E A;  2JNG A;  4AFQ C;  1Q81 U;  3QO3 A;  4BUG A;  5GAM d;  1ZQ1 A;  1NBE B;  4OMP A;  1JXO A;  3AT1 B;  3QJY A;  2AK5 A;  4LDX A;  2CP3 A;  1I5O B;  2DD4 A;  2V26 A;  4EMH A;  1U1S A;  1K76 A;  4LDW A;  5C0M A;  3H9N A;  1VQM T;  1GRI A;  1QVG A;  3HTR A;  5FU7 B;  3FDR A;  3JB9 H;  1SRL A;  1M9S A;  1MV3 A;  4DEX A;  1T0J A;  4FIB A;  2YT6 A;  1LCK A;  4F7U F;  3EGD B;  2RQW A;  3OYD A;  5M9O A;  1M1F A;  1IHV A;  3CQT A;  3ZEH A;  1PG5 B;  2IPO B;  2OTL A;  2HQX A;  1X43 A;  3QPH A;  3HRU A;  3HPW A;  4BI3 A;  1K73 R;  3HL8 A;  3JSC A;  2RK1 A;  1EIF A;  3T9N A;  2ED0 A;  5LJ5 d;  4Q5W A;  3A8G B;  3PNW C;  5KYX B;  4XAX B;  2RI2 A;  2EYW A;  1Y0M A;  2PZ1 A;  1YCY A;  3CCL A;  3A8M B;  2CRE A;  1W2B A;  3SWN A;  2RB6 A;  4ANJ A;  4DBF A;  3H41 A;  1OUL A;  2RI5 A;  1B7T A;  3OYE A;  1X69 A;  2CGH A;  3CCV Q;  1QKX A;  2YDL A;  1PHT A;  5KCO A;  1VQ4 T;  3DLL A;  5LJ5 h;  2QA4 T;  2VYT A;  4J7F A;  3PIO A;  2RPN A;  1W1F A;  1NYG A;  1YHQ T;  1S72 A;  1MGQ A;  1WX6 A;  2ZPE B;  1UG1 A;  4M77 F;  4PLI A;  1Q82 R;  4OB1 B;  1KFZ A;  2NLU A;  1WGS A;  4ZGE B;  3J80 E;  1B07 A;  3I56 T;  3ER0 A;  2DL4 A;  4K11 A;  2JMA A;  4PL6 A;  4FM4 B;  1ZSG A;  1AWW A;  2VWF A;  2IVW A;  2DTI A;  4FYV B;  1UUE A;  4PJO D;  2LJ0 A;  3RNJ A;  3H0F A;  1D3B B;  3M5A A;  4NL3 A;  4M75 G;  3CCS Q;  4XU2 A;  1AWO A;  4HCC A;  4XTU A;  4HVV A;  5CCA A;  1IGU A;  4PJO F;  2KRO A;  2COZ A;  3L2W A;  1H3Z A;  2MIO A;  1ZA2 B;  2EQK A;  1VQ8 T;  2DL8 A;  4M75 A;  5CR2 A;  1U3O A;  2ROT A;  4PFO A;  4V2S A;  2D9T A;  2BZ8 A;  3CD6 Q;  1A0N B;  1PKS A;  2EW3 A;  4DBH A;  1VQ6 Q;  1D3B A;  3VV0 A;  4M7A D;  4KT0 E;  2L3Q A;  4Y91 A;  3NHN A;  1RL2 A;  2C0O A;  3V8J A;  5IH2 A;  3CCM Q;  3L2Q A;  1K9M C;  3MHX A;  4DEY A;  2DLP A;  2AZS A;  2CP7 A;  3RIR A;  3CC4 Q;  4J5Y A;  1TSF A;  1NM7 A;  2KY9 A;  4IIO A;  4II1 A;  3OS2 A;  1G2B A;  1VA7 A;  1IB8 A;  2CP6 A;  1XNI A;  1RI0 A;  4PJL A;  1HD3 A;  1UE9 A;  5LJ5 e;  4JRP A;  4BDZ A;  2RHI A;  2L2P A;  3GF5 A;  2OAW A;  2LZ6 B;  4CC4 B;  1WHL A;  2FL7 A;  2DBK A;  4MML A;  4JJD A;  5GAN 7;  2DX1 A;  4ZTJ A;  2RHU A;  5HK0 A;  2EKH A;  3X26 B;  1VOM A;  3OY9 A;  2XDB A;  2VUB A;  2X9H A;  2JT4 A;  3OS5 A;  2VGN A;  3I9Q A;  5LJ5 j;  2LQN A;  2VVK A;  4FCY A;  1BYM A;  2PVO B;  4OMO A;  5KH6 A;  2DKG A;  2LRQ A;  2JJ9 A;  3QWY A;  1YNZ A;  4PJM A;  4C8Q C;  4JDS A;  3M9Q A;  2O88 A;  1RI9 A;  5CQY A;  2GGR A;  2HL3 A;  3CMA A;  2XD0 A;  1WIE A;  3QBY A;  5FU6 B;  2DEU A;  1O9S A;  4JJN K;  3RUX A;  5CAI A;  3L2Z A;  5FW9 A;  1C1A A;  1UDL A;  5IXF A;  3JCM c;  4M78 G;  4JZ3 A;  1BU1 A;  3DKM A;  4Z8A A;  3CXC S;  3OYM A;  5CO7 A;  1K0S A;  2RD1 A;  1Q7Y U;  3UT1 A;  2FRY A;  4J9H A;  2JM9 A;  2O9V A;  2NUP A;  4A54 A;  5L23 A;  4B6M A;  2DXU A;  1Q82 U;  4NOY A;  3LGF A;  1XTD A;  3VS4 A;  1NJI U;  1G3W A;  4M78 A;  1QLY A;  2WSE E;  4QQ6 A;  1I07 A;  2YUO A;  3VRZ A;  1D1B A;  4F7U B;  1RAE B;  4KUL A;  2QQS A;  1X27 A;  4HCZ A;  1BI3 A;  3OW2 S;  1YWO A;  2F2X A;  3QDR B;  1UHF A;  5GAN d;  4FW1 A;  2DL3 A;  3G6E Q;  1BBZ A;  3G71 A;  1Q86 R;  1TUG B;  3JRZ A;  2EFI A;  2QYZ A;  2ECZ A;  3HFO A;  1VQ5 A;  1QVP A;  2EGA A;  2B8A A;  4A53 A;  4L5G A;  4JPB W;  1K9A A;  4PLL A;  3VUB A;  3VS5 A;  3PMI A;  2DZ9 A;  1VQK A;  4J7I A;  2K57 A;  3CME A;  1VQP Q;  4OGC A;  4JJC A;  4AFZ C;  1JXM A;  1LJO A;  1UTI A;  2J6K A;  4BDY A;  2MK5 A;  3GIB A;  2LCL A;  1KQS A;  5GAN 2;  1WXB A;  3BDL A;  3CCS T;  5GAO l;  1VUB A;  2RM4 A;  5GAN h;  1WQ7 A;  4ELY C;  5KYY B;  5CKD A;  1FWZ A;  2G6F X;  1JEG A;  2DO3 A;  3BY7 A;  2X4X A;  2HQE A;  3CD6 T;  1R77 A;  2MWP A;  3CCR Q;  4BE1 A;  5GAN 4;  3SDZ A;  1VQN Q;  4OGE A;  4E7I A;  2CH4 A;  1VQ6 T;  2QGF B;  2A0F B;  2V8K A;  1J3T A;  4PFP A;  3JCM d;  2RQU A;  4M77 B;  1AWJ A;  1VQM A;  3LLR A;  2AZV A;  1ZBJ A;  3NPF A;  3P8H A;  1JRI A;  1SPK A;  2RK2 A;  3CCM T;  2KGT A;  5CKF A;  1T3S A;  3LGL A;  4M77 G;  4AMC A;  1SKU B;  1M3C A;  2DAQ A;  3C4S A;  2MCN A;  2L3P A;  3SD4 A;  4A4G A;  1AD5 A;  3CCQ Q;  1YJN Q;  4R55 A;  4AG1 C;  2WAC A;  1KC8 R;  2OX7 A;  2LC4 A;  4PJO B;  1WHM A;  3RMS A;  2KRN A;  4M75 D;  4M77 A;  3EG9 A;  1QVF A;  5IHN A;  2HAX A;  2DTH A;  1MMG A;  2VXF A;  2KSS A;  5AYF A;  3JCM h;  2XHC A;  4E7H A;  4M75 F;  4P5N A;  2D6F A;  5HKC A;  5DLQ E;  1QP2 A;  3TCJ A;  1NG2 A;  4GLM A;  2DZC A;  1WYX A;  4WCI A;  1F1B B;  4BB7 A;  2RO0 A;  2E3I A;  1UGR B;  2LJ1 A;  2WSF E;  4CC2 A;  2GTO A;  3M58 A;  2D8H A;  3C0C A;  8ATC B;  3HRS A;  1BK2 A;  2R5M A;  1RUW A;  2COW A;  1U8R A;  1RAF B;  1UEC A;  2BZX A;  2VV5 A;  2L0A A;  3EGX A;  2QEX Q;  1H3H A;  2LQK A;  2ZGW A;  1WHH A;  1VQ4 A;  4EMG A;  2QA4 A;  1RAC B;  1BIB A;  2DL5 A;  3S3N A;  3ZL7 C;  5GAN e;  4CC7 A;  3LWI A;  4WF2 A;  2LJ3 A;  1WXT A;  4IUQ A;  4ATO A;  2LTO A;  2RJE A;  1WLP B;  1Q86 U;  2YXY A;  4FYX B;  5EC7 A;  1ZA1 B;  1P92 A;  2YLB A;  5I2S A;  4M7D G;  2O31 A;  1RAB B;  2YLC A;  4RKU E;  1IZ6 A;  2E12 A;  2MPX C;  3BDU A;  4OMQ A;  3PMT A;  2J05 A;  3UPU A;  5GAN j;  1WXU A;  3EFS A;  4AFS C;  2MWO A;  4CC3 A;  1NLP C;  2CSQ A;  3TU4 K;  4M7D A;  1HXD A;  1CKA A;  5GAO q;  1M1G A;  3CEY A;  3G6E T;  2EAY A;  2JW4 A;  2PU9 B;  2L89 A;  3CCU A;  2VC8 A;  1R0B G;  5LJ3 d;  4J9C A;  3OYL A;  4LD9 K;  4BY6 B;  2H3E B;  2L3S A;  4LUD A;  1KQ2 A;  1IRX A;  1EX4 A;  3NTI A;  4PK4 A;  1W70 A;  4QVC A;  1V29 B;  3QG1 A;  1WJS A;  1HSQ A;  4A4K A;  2ESW A;  1VQO Q;  4PJJ A;  5GAN 3;  1TG0 A;  3TRE A;  3JCM e;  2KMT A;  2DBM A;  2PTK A;  3VYG A;  2M16 A;  4M78 D;  5FWC A;  1YJW A;  1NEB A;  4MMK A;  2AKK A;  1QCO A;  1M4Z A;  2G3R A;  3NGP A;  3OB9 A;  4M78 F;  1ZSZ A;  3M0T A;  4RMO A;  1IHW A;  2M51 A;  5LJ3 h;  3VS3 A;  1ARK A;  2FVU A;  2ROL A;  2VGM A;  3V7S A;  2JS0 A;  3OS0 A;  1X6B A;  1M90 C;  1N6A A;  3CCR T;  1JU5 C;  1SHG A;  3EG3 A;  4C8Q E;  1JB0 E;  2P0K A;  3OYA A;  1VQL A;  2QQB A;  3G7Z A;  5C6S A;  1KD1 C;  3P8B B;  3GP8 A;  2HBP A;  4RG2 A;  1KC8 U;  2IIM A;  5GAO m;  4LD6 A;  3KBG A;  4VUB A;  3JAM E;  4KGV B;  3I35 A;  3V7R A;  4XTV A;  5FRN A;  4D6W A;  1C0M A;  2DET A;  2ABL A;  2JVV A;  2E6Z A;  2NWM A;  1BI2 A;  1NPP A;  2R58 A;  1AHJ B;  1TOV A;  5FU6 C;  1Z9Q A;  1BCM A;  3CCQ T;  1YJN T;  4C0Z A;  3SWN B;  4XU3 A;  2EQU A;  1PD0 A;  2DEQ A;  4D8K A;  2A7Y A;  4C92 G;  5CKH A;  5GAM h;  1O75 A;  1SSH A;  3H6Z A;  1MMA A;  3A1P A;  3UWN A;  1VQ9 T;  2CP2 A;  2EQJ A;  2NUT B;  2K2M A;  3VS0 A;  2K7A A;  2XIC A;  2FPE A;  1K8A C;  5LL6 S;  2O9S A;  4X9C A;  1RAA B;  3QYH B;  4C92 A;  2DYI A;  2CUB A;  1N5Z A;  2LQ8 A;  3V7C A;  2JM8 A;  1JBM A;  5DY9 A;  2M0Y A;  4PNO A;  2EGE A;  3LWH A;  1XOV A;  2QTV A;  1QKW A;  2OTL Q;  4MZT A;  2BZY A;  1YJ9 A;  3SB2 A;  1KK7 A;  1H8K A;  2E65 A;  2HD0 A;  2VKN A;  2RHY A;  1ACM B;  5KYW A;  2NUT A;  4ZTF A;  2DXB A;  4KBM B;  3CPW P;  2GBQ A;  2B86 A;  2DRK A;  4OB2 B;  1U1T A;  3QSU A;  2F5T X;  2CZ1 B;  2QGG A;  3CCL Q;  1QMC A;  2FZG B;  4C92 E;  2OTJ A;  3M0U A;  3S6W A;  4M77 D;  2RMO A;  3C95 A;  9ATC B;  1AZG B;  4DBR A;  3M57 A;  3VS6 A;  5LJ3 e;  1Q7Y R;  3NTH A;  3OYY A;  5I2M A;  5IN1 A;  4RTY A;  1NJI R;  1WHJ A;  1YCS B;  3QZ5 B;  3FJ5 A;  3OBY A;  3QZ9 B;  1YBY A;  2E10 A;  4FW2 A;  4M75 B;  5GMK l;  2QQ9 A;  2XKO C;  3I55 A;  1PRL C;  1FXX A;  5HK3 A;  2GTJ A;  3GNG A;  3RKW A;  1N9R A;  1IXD A;  2DMO A;  3CCS A;  5LJ3 j;  2X3W D;  4J9E A;  1S72 Q;  2MAM A;  2EKO A;  1YIJ Q;  3BW1 A;  4EMK C;  1TS9 A;  3MP6 A;  4N0A A;  2LNH B;  2KXD A;  2PNI A;  4LDY A;  1MND A;  2M1H A;  3CCJ T;  3PFS A;  2L8D A;  2W10 A;  2EIF A;  5GAM e;  1V76 A;  4E7K A;  2YSQ A;  1U06 A;  3OYC A;  1M8M A;  1VQO T;  1UGS B;  2J6F A;  3PE0 A;  3VUZ A;  2XID A;  2F5K A;  1QCN A;  4LDV A;  2HKQ B;  3QKJ A;  3CCE T;  4C5G A;  1QVG P;  4QKU A;  1I0C A;  2A3L A;  2BIV A;  1X75 C;  2CT4 A;  2RA2 A;  2FB7 A;  2XU8 A;  1VQ7 A;  4M7D D;  2QAS A;  2CT3 A;  5GAM j;  2KQW A;  3QUI A;  4J8O A;  2O4X A;  4PJO C;  1OOT A;  3MEV A;  3GBQ A;  1YI2 A;  2HL5 C;  4DOV A;  1G8X A;  1X2Q A;  4M7D F;  4F17 A;  1IO6 A;  3ASK A;  1TXQ A;  2FRW A;  3JB9 J;  2DD5 A;  2RQT A;  4ZGJ B;  3PIP A;  3TSZ A;  5J3B A;  1UGV A;  1X2K A;  4O5V A;  1M1K R;  3OYH A;  2YUQ A;  3M0S A;  4HA8 A;  3E9G A;  4J6X A;  4RTV A;  2F2W A;  3RKX A;  4OB0 B;  4C5I A;  1JJ2 P;  3RES A;  3EFR A;  1WA7 A;  1KJW A;  2O2O A;  2CP0 A;  2C0I A;  2F1L A;  1WJQ A;  2YHT A;  1FMV A;  1WJR A;  2XDP A;  3FB9 A;  1K4U S;  3E9F A;  3UA7 A;  4MDX A;  4M7A C;  2DXT A;  4QT7 A;  4BI4 A;  1WHK A;  3JCM V;  4N4G A;  3WXM B;  1W2B P;  4HXJ A;  3EGU A;  3S3M A;  3FRN A;  1UFF A;  4RTZ A;  2AHJ B;  3MKD A;  4ORZ A;  4QQG A;  2NUP B; 
#chains in the Genus database with same CATH homology
 3VRY A;  1W6X A;  2AZV A;  1ZBJ A;  4X1V A;  3NPF A;  2BTT A;  1SPK A;  3U23 A;  1QWF A;  4RTT A;  4E6R A;  1T0H A;  2DIL A;  3VS7 A;  4HCK A;  2JS2 A;  2DL7 A;  1K1Z A;  1GCQ A;  2KGT A;  4D8D A;  1T3S A;  2EYY A;  1M3B A;  4ZNX A;  3ULR B;  4R0K A;  1M3C A;  2YUN A;  3R6N A;  2MCN A;  2KYM A;  2L3P A;  1AD5 A;  4OMM A;  2C0T A;  1GCQ C;  4AG1 C;  5IHK A;  1YP5 A;  2KRN A;  4HVU A;  1MUZ A;  5IHN A;  3VS2 A;  2CDT A;  2DVJ A;  1Z9Z A;  1ZUY A;  1AZE A;  4AFQ C;  4J9G A;  2FPD A;  4LE9 A;  2J7I A;  2KE9 A;  4KRT A;  4F14 A;  4OMP A;  1JXO A;  1NG2 A;  4GLM A;  1WYX A;  2AK5 A;  4WCI A;  2LJ1 A;  4CC2 A;  1KIK A;  2GTO A;  1K76 A;  2D8H A;  3C0C A;  1BK2 A;  3M0R A;  1RUW A;  2DE0 X;  1UEC A;  2ENM A;  4JJB A;  2BZX A;  2L0A A;  1GRI A;  3RBB B;  1H3H A;  1SRL A;  1ZUK A;  1MV3 A;  4DEX A;  1E6H A;  1UJY A;  1T0J A;  2DL5 A;  2LX7 A;  3ZL7 C;  2YT6 A;  1LCK A;  3IQL A;  3EHR A;  4CC7 A;  4J9F A;  1WI7 A;  2LJ3 A;  1OV3 A;  2I0N A;  2RQW A;  1WXT A;  1ZLM A;  3TVT A;  1OPL A;  1RLP C;  1M3A A;  4AFU C;  3CQT A;  1WLP B;  3O5Z A;  1X43 A;  5EC7 A;  3SEM A;  1H92 A;  2O31 A;  1B3Q A;  2DJQ A;  2ED0 A;  2EBP A;  4ESR A;  2JMC A;  2JTE A;  1YWP A;  1VYT A;  4OMQ A;  2FEI A;  2V1Q A;  2J05 A;  5FWB A;  1WXU A;  2D1X A;  2EYW A;  4AFS C;  5I11 A;  4CC3 A;  1NLP C;  2CSQ A;  1Y0M A;  2PZ1 A;  1CKA A;  4Z88 A;  1E6G A;  1E7O A;  1PWT A;  2CRE A;  2RQV A;  3JV3 A;  2DYB A;  2CUD A;  2JW4 A;  3H41 A;  4J9C A;  1X69 A;  2L3S A;  5IXB A;  2RNA A;  4LUD A;  4M4Z A;  1QKX A;  2EYX A;  2YDL A;  1W70 A;  1PHT A;  1MV0 B;  1FMK A;  2J06 A;  1HSQ A;  1NLO C;  2RPN A;  2ESW A;  1GBQ A;  2CSI A;  2QDL A;  1TG0 A;  1GBR A;  1W1F A;  1NYG A;  2EPD A;  4Z89 A;  2DBM A;  2PTK A;  4J9B A;  4IIM A;  1WX6 A;  5FWC A;  1UG1 A;  2EYZ A;  2OI3 A;  1NEB A;  2LP5 A;  3EHQ A;  2AKK A;  1OPK A;  1ABQ A;  1YN8 A;  1KFZ A;  3NGP A;  1B07 A;  3M0T A;  2DL4 A;  1S1N A;  2KT1 A;  2M51 A;  2KR3 A;  2V1R A;  4K11 A;  2JMA A;  2ROL A;  3VS3 A;  1ARK A;  1ZSG A;  1UJ0 A;  2JS0 A;  1AWW A;  2VWF A;  2RF0 A;  1X6B A;  2K9G A;  1UUE A;  1JU5 C;  1SHG A;  2OJ2 A;  2MOX A;  3EG3 A;  1ABO A;  2LJ0 A;  3RNJ A;  3H0F A;  2FPF A;  1AWO A;  3EG0 A;  4HVV A;  1GFC A;  2JXB A;  2IIM A;  1TUD A;  2KRO A;  3QWX X;  1JQQ A;  1WFW A;  2KNB B;  4FSS A;  2MIO A;  3I35 A;  2RQR A;  2DL8 A;  2ABL A;  1U3O A;  2A08 A;  2HSP A;  2ROT A;  2NWM A;  3M0P A;  2BZ8 A;  1A0N B;  2LQW A;  1PKS A;  2HEQ A;  2D8J A;  1Z9Q A;  2EW3 A;  4OML A;  1AEY A;  4RTW A;  4F16 A;  4D8K A;  4LNP A;  4J9I A;  2L3Q A;  3NHN A;  1SSH A;  2LCS A;  2C0O A;  4AG2 C;  1RLQ C;  1GL5 A;  1V1C A;  5IH2 A;  3UAT A;  2K2M A;  3VS0 A;  1PKT A;  2DF6 A;  2K7A A;  2FPE A;  4DEY A;  2O9S A;  2DLP A;  2AZS A;  1WDX A;  1M27 C;  1VYV A;  2GQI A;  2CUB A;  1NM7 A;  4IIO A;  1N5Z A;  1UHC A;  4GBQ A;  2JM8 A;  1G2B A;  1VA7 A;  3PVL A;  2M0Y A;  1CSK A;  2DM1 A;  2EGE A;  1XOV A;  2YUP A;  1HD3 A;  1QKW A;  1Y57 A;  1UE9 A;  3LH5 A;  2BZY A;  1AWX A;  2L2P A;  2OAW A;  3THK A;  1H8K A;  4JZ4 A;  2VKN A;  1QCF A;  2LZ6 B;  4CC4 B;  3TSW A;  2DBK A;  2GBQ A;  4JJD A;  3A98 A;  2B86 A;  2DX1 A;  3KFV A;  2DRK A;  3H0H A;  2A36 A;  5GJV B;  2EKH A;  4RTX A;  4RUG A;  1HJD A;  3M0U A;  1SEM A;  2JT4 A;  3EG2 A;  2RMO A;  1AZG B;  3I9Q A;  2LQN A;  2VVK A;  3VS6 A;  5ECA A;  4OMO A;  1I1J A;  2HCK A;  2KXC A;  3QWY A;  1YNZ A;  2O88 A;  1RI9 A;  5I22 A;  4RTY A;  2ED1 A;  4RTU A;  2GGR A;  1WIE A;  3EG1 A;  4J9D A;  2FO0 A;  1PRM C;  2A28 A;  1YCS B;  4A63 B;  3VS1 A;  3FJ5 A;  2SRC A;  1ZUU A;  1PRL C;  5FW9 A;  2F2V A;  5GJW B;  1UDL A;  5IXF A;  2GTJ A;  3REB B;  2LMJ A;  1EFN A;  1T3L A;  4JZ3 A;  1BU1 A;  2DMO A;  2J6O A;  2XMF A;  4Z8A A;  2EVR A;  2KBT A;  1U5S A;  2X3W D;  4J9E A;  1K0S A;  4OMN A;  2KT8 A;  2FG0 A;  2FRY A;  4J9H A;  2JM9 A;  3H0I A;  2O9V A;  5L23 A;  2CH4 W;  2LNH B;  2KXD A;  2P4R A;  2PNI A;  3VS4 A;  2DRM A;  1TUC A;  2AKL A;  1FYN A;  1QLY A;  2W10 A;  1I07 A;  2YUO A;  3VRZ A;  1K0X A;  2SEM A;  1AVZ C;  2HBW A;  1JO8 A;  1VYU A;  2YSQ A;  1X27 A;  2K3B A;  3SHW A;  1U06 A;  1YWO A;  2F2X A;  1M8M A;  1UHF A;  2KRM A;  3I5R A;  3PVQ A;  2J6F A;  1X6G A;  2DL3 A;  1BBZ A;  1OEB A;  3NMZ C;  3PE0 A;  1CKB A;  2K6D A;  4EIK A;  2K79 A;  2ECZ A;  2EGA A;  1GFD A;  4JPB W;  4LUE A;  1K9A A;  2EQI A;  3VS5 A;  3UF4 A;  2A37 A;  1I0C A;  3M0Q A;  1AOJ A;  2CT4 A;  3I5S A;  1SRM A;  2NUZ A;  3REA B;  2HDA A;  2CT3 A;  4JJC A;  4AFZ C;  2KYB A;  2KRS A;  1OOT A;  2D0N A;  3GBQ A;  1NYF A;  1BB9 A;  1JXM A;  1UTI A;  2J6K A;  2W0Z A;  1X2Q A;  4F17 A;  1SHF A;  1IO6 A;  2FRW A;  2RQT A;  3TSZ A;  1UGV A;  1X2K A;  1ZX6 A;  1WXB A;  2X3X D;  1PNJ A;  2YUQ A;  3M0S A;  4LN2 A;  5HCK A;  2GNC A;  2F2W A;  4RTV A;  1NEG A;  1WA7 A;  1KJW A;  2E5K A;  2G6F X;  5IHI A;  1JEG A;  2O2O A;  1QWE A;  2H8H A;  2C0I A;  2RN8 A;  1KSW A;  2EGC A;  1K4U S;  2DNU A;  3UA7 A;  3UA6 A;  2DA9 A;  2KEA A;  4QT7 A;  2CH4 A;  1M30 A;  4Y92 A;  1GCP A;  4HXJ A;  3EGU A;  1J3T A;  1G83 A;  1UFF A;  4RTZ A;  4HVW A;  2RQU A;  4ORZ A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...