1KQSF

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kqsF00
2AIFA 2LBWA 1YJWF 1ZWZA 3AGKA 5GAPK 1M1KH 2KG4A 1VQNF 1K8AH 4X3MA 3I55F 1GZ0A 1VQMF 4TZZA 2HVYD 1E7KA 1Q82H 1KD1H 1W41A 3CXCF 1PXWA 3OBYA 1JJ2F 3N4YA 2LBXA 1VQ8F 3CG6A 3V7EA 2OHWA 3E20B 5EWRA 1W42A 3N4ZA 3I56F 3PLAC 2BO1A 1YHQF 1K9MH 5GIOC 2OTJF 1KC8H 3CCUF 2QI2A 3J7AR 3CCMF 1X52A 2JNBA 3J80M 2QEXF 3CCQF 1S72F 3G4SF 5FLXM 1W2BF 2CZWA 2KTVA 3CCVF 1N8RH 1T0KB 4BY9D 5GINC 1QVGF 1YITF 3CCLF 2FC3A 1VQOF 5A2QM 1KQSF 3CCEF 3NK7A 3OBWA 4X3LA 3LWPC 3MCAB 2VGMA 1YIJF 3LWOC 3JAMM 3FFMA 1DT9A 3CCRF 3RA6A 3PAFA 1YJNF 1NMUB 3CC7F 3SIVA 5G4VC 1SDSA 3J81M 2I6DA 3CCSF 5IT9M 5GANK 1QVFF 1W3EX 1Q86H 5EO3A 3NVKE 3VMFB 1RA4A 1X7PA 1W40A 3JCMM 3CC4F 3LWVC 1VQ6F 3SIUA 3CPWF 3CD6F 5G4UC 3CC2F 4C4WC 3NK6A 1VQ4F 1Q81H 3NMUC 3E1YA 1GO1A 3ON1A 1XBIA 3G71F 3VI6A 3LFOA 1NJIH 1CN7A 3CMAF 2OZBA 2WALA 1VQ5F 3O85A 3RA5A 4LCKA 3CMEF 5FJ4C 1VQKF 1M90H 5DCVA 3CPQA 3LWRC 3LWQC 1VQ9F 3OW2F 3HAXD 1GO0A 1IPAA 1VQLF 3G6EF 3IR9A 3WXMB 1VQPF 4BW0B 2VGNA 3CCJF 2ALEA 3V7QA 5GIPC 1K73H 1YI2F 1VQ7F 1Q7YH 1CK2A 1X7OA 3HJWC 2KTUA 2QA4F 3NVIB 4NUTA 3GYQA 1YJ9F 1RLGA 1H7MA 2OTLF
chains in the Genus database with same CATH superfamily
3JAWB 3D01A 1X25A 2K1SA 3RE3A 2GLZA 3V3TA 3HTNA 1M1KH 2UYJA 4IHJB 4BT6A 4TZZA 4G88A 3CXCF 1DBFA 1JY8A 3ZO8A 3JALB 3V7EA 2AIZP 3CG6A 3VTIC 3HWUA 3VOBA 2OHWA 3E20B 4TUYA 1SA0B 3I56F 3PLAC 2BO1A 1K9MH 1Q8RA 4EI7A 3TD5A 2UYKA 4ZHQA 3J7AR 5CB4B 1S72F 3D54A 1W2BF 2Z1UA 3CB2A 2LBTA 3WGJA 2KTVA 3VYTC 4YJ2A 1H48A 2RHJA 5IJ9A 3K2XA 5LOVB 4BY9D 1QVGF 4IIJA 3HKEB 4O2BA 3I7TA 4I4TA 5HWEA 4X1IA 3NK7A 5J2TB 3RYFB 3LWPC 1W581 4C82A 2VGMA 5HY4A 3FFMA 5C8YB 1CLIA 3RA6A 5B8FA 5KMGA 3VO8A 3VIUA 4X1YA 1SDSA 3J81M 4O4JA 1T0AA 5GANK 2EWCA 2CVLA 1RA4A 1J7HA 1X7PA 3TD4A 4G4ZA 2YYEA 1VQ6F 4TUYB 3SIUA 3CPWF 4EB6A 3E1YA 4O4LA 3ON1A 4ZHQB 1W55A 2IQQA 3G71F 2R751 4G4WA 3EORA 1VQ5F 1IV3A 2P6YA 4YJ2B 4NQ3A 5IJ9B 3LWQC 4X20A 1QU9A 3F0DA 4IIJB 3P10A 1IPAA 3S03A 4LNUA 3G6EF 4O2BB 1Z5VA 4I4TB 3WXMB 3DDNA 4BT4A 4X1IB 4BW0B 3ZP4A 4ZHVA 2UZHA 2Z01A 1NQ3A 4FFBA 3N2GA 5HY1A 3GTZA 3LMEA 3WJPA 3KIZA 3RYCA 3HJWC 3NVIB 2VXYA 2HS4A 4U39A 5KMGB 4X1YB 3K0TA 2AIFA 1KNKA 5KX5A 2RHHA 4G4XA 1VQVA 3S0WA 1W5BA 3AGKA 2R6R1 1VH8A 5FNVA 5GAPK 1K8AH 3HKCA 3M1XA 3I55F 5MN6A 5HP7A 3OBYA 4EB6B 3N4YA 4R40B 1VQ8F 4O4LB 4BT2A 2Z1FA 3KJJA 5LXTA 5EWRA 1W42A 3B6NA 1RLUA 4C8EA 1U3PA 4HNAA 2GVIA 2QI2A 3C8LA 5EB0A 1X52A 3J80M 3MDOA 3U0OA 2ZVYA 4X20B 4RHAA 3QHDA 5JVDA 3CCVF 4LNUB 2B33A 5CA0A 3WGMA 3CCLF 4RQOA 4WBNA 5A2QM 5BMVA 1KQSF 1FNKA 2YXZA 3RYHA 3N2GB 2Z1TA 3JARA 3WGKA 1UI9A 5HP8A 3JAMM 1DT9A 1R1MA 5HY0A 2HX0A 3CCRF 2UYNA 3CYPB 2HP3A 5EIBC 1YJNF 1JN1A 5KX5B 3CC7F 4I55B 1PF5A 2RHOA 5FNVB 3CCSF 1IV4A 3L7QA 3HKCB 1W3EX 5EO3A 3TD3A 3NVKE 3WJRA 1KNJA 1OAPA 5HXUA 2V9YA 3WPWA 5LXTB 4BVQA 5G4UC 4C4WC 1VQ4F 1Q81H 3F0GA 1OFUA 4ZI7A 2N48A 2HQSC 4BVSA 3KJKA 5HY2A 4HNAB 2RB9A 1YQNA 2ZOVA 3LYBA 2CHTA 3VI6A 1NJIH 1CN7A 4B5CA 4ERHA 3O85A 5JVDB 2PMPA 2ZF8A 1VQKF 5CA0B 2ZAUA 4TV9A 3LWRC 2CSLA 1GO0A 1JFFA 4X1KA 4WBNB 5BMVB 3RYHB 1FFXA 3JARB 4BT7A 2W8BC 3F0FA 1U43A 5EZYA 1IV1A 4G4VA 5ITZA 4XCQA 1YI2F 1VQ7F 5LA6A 2UYNB 2KTUA 2QA4F 2Z1EA 1YJ9F 5AVMA 2DYYA 1RLGA 1H7MA 2OTLF 1VK3A 5EAZA 2ZODA 5IJ0A 4NWOB 1XHOA 4O4IA 1ZWZA 4B46A 1TVKA 4X3MA 1GZ0A 4B45A 4G4YA 1XRGA 4PWTA 4ZK7A 3OONA 1Q82H 2IAFA 1KD1H 1W41A 1JD1A 1PXWA 2IG8A 3HKBA 2BTOA 3K12A 3N2KA 1JJ2F 4ZI7B 4C8IA 1YGYA 5JQGA 3N4ZA 2CW4A 1YHQF 3R0PA 2OTJF 4ZOLA 5LYJA 2HRUA 3K14A 2JNBA 4O4JB 2QEXF 1SZQA 3P0ZA 3CCQF 4TV9B 5JCOA 1IV2A 3P4EA 5CA1A 1JFFB 3I3FA 3JASA 1N8RH 1FFXB 3S02A 1T0KB 1VQOF 2FC3A 1W59A 2RHLA 3CCEF 2KGWA 4X3LA 5ITZB 2F9ZC 1ONIA 4F6RA 5LA6B 1U3LA 3PAFA 1FNJA 4ZHWA 5IJ0B 3QUWA 3S0YA 4O4IB 3VYSC 3JAKA 3VCZA 1TVKB 5IT9M 5LP6C 3CYQA 1Q86H 4C81A 3F0EA 3VMFB 2MQEA 3S06A 3HKBB 2FGYA 3QTYA 4E6EA 3MQWA 3N2KB 1W40A 4FFBB 3RYIA 4M8IA 3CC4F 5JQGB 4BVRA 3C9UA 3RYCB 2GZLA 3FD5A 3Q8HA 4ZOLB 5LYJB 3UT5A 3JVHA 2OTMA 3LFOA 4I50A 4TV8A 5CA1B 2HS0A 3CMEF 2ZVZA 3JASB 5GONA 2Q1XA 3CPQA 3ZP7A 1QAHA 3E22A 1M90H 5DCVA 1VQ9F 3OW2F 2BTUA 2HRYA 3IMPA 1VQLF 3IR9A 5IYZA 1TUBA 1Z5WA 3CCJF 2ALEA 3WJQA 1UFYA 3ELCA 4F6RB 3V7QA 3C9TA 5GIPC 4KWEA 5EYPA 1K73H 1Q7YH 1CK2A 1U40A 2UYPA 5LP6A 4YJ3A 1W5EA 3S0HA 5J2UA 2VAPA 1ODEA 3WGNA 4EI8A 3JAKB 2HS3A 1W57A 2LBWA 3LDTA 1YJWF 3IKFA 3HKDA 2KG4A 1VQNF 3IEQA 5EB1B 1VQMF 1H47A 2HVYD 3RYIB 4DRXA 3ZOPA 1E7KA 4BT5A 2CWJA 5JCOC 3DC2A 2LBXA 1COMA 2PHNA 3D00A 4B62A 3UT5B 2DT4A 3JATA 5GIOC 2VAMA 3BYQA 4I50B 2VAWA 2QTPA 4TV8B 1KC8H 3CCUF 3FPIA 3CCMF 5JH7A 5GONB 4DXDA 3VOAA 3E22B 3G4SF 5FLXM 2NMUA 2CZWA 2HP0A 1RQ2A 4U3JA 5IYZB 1TUBB 5GINC 4O2AA 1YITF 1QD9A 3IKEA 1GX1A 3OBWA 5EYPB 2LCAA 3MCAB 4ZHYB 2H8CA 1XV2A 1YIJF 3LWOC 2I6RA 5LP6B 2H8EA 4YJ3B 2H6LA 3V4DA 4C8GA 5J2UB 3MBMA 4EI9A 3KHNA 1NMUB 3SIVA 2G9IA 3M4SA 5G4VC 2Q1YA 3FD6A 2I6DA 3HKDB 3JAWA 4O4HA 3WPXA 1QVFF 4X1KB 4DRXB 5EIBD 3MCQA 4IHJA 1VHAA 3JCMM 5EZYB 2L26A 3LWVC 5HXZA 3CD6F 3CC2F 3ESJA 3NK6A 3JALA 3C9RA 3NMUC 1GO1A 3JATB 1W5AA 4BVTA 1SA0A 1XBIA 5JH7B 1W5FA 3CMAF 2OZBA 2WALA 3RA5A 4I55A 4LCKA 2HP0B 5CB4A 5FJ4C 4U3JB 5MN4A 2BTQB 1FSZA 4O2AB 3HAXD 3ERNA 3T80A 1VQPF 5LOVA 2VGNA 3GHZA 3M84A 3HKEA 1RQ7A 3FBAA 3WGLA 5J2TA 2CHSA 3IEWA 3RYFA 4BT3A 1X7OA 3VYUC 4NUTA 3GYQA 3KE1A 2AMTA 3F6MA 3C9SA 5MN5A 5C8YA 4O4HB
chains in the Genus database with same CATH topology
2AIFA 4EI8A 2LBWA 2GLZA 1YJWF 3V3TA 1ZWZA 3AGKA 5GAPK 1M1KH 2KG4A 1VQNF 1K8AH 4X3MA 3I55F 1GZ0A 1VQMF 4TZZA 2HVYD 1E7KA 1Q82H 1KD1H 1W41A 3CXCF 1PXWA 3OBYA 1JJ2F 3N4YA 2LBXA 1VQ8F 3CG6A 3V7EA 2OHWA 3E20B 3D00A 5EWRA 1W42A 3N4ZA 3I56F 3PLAC 2BO1A 1YHQF 1K9MH 5GIOC 2OTJF 4EI7A 1KC8H 3CCUF 2QI2A 3J7AR 3CCMF 1X52A 2JNBA 3J80M 2QEXF 3CCQF 1S72F 3G4SF 5FLXM 1W2BF 2CZWA 2KTVA 3CCVF 1N8RH 1T0KB 4BY9D 5GINC 1QVGF 1YITF 3CCLF 2FC3A 1VQOF 5A2QM 1KQSF 3CCEF 5HWEA 3NK7A 3OBWA 4X3LA 3LWPC 2F9ZC 3MCAB 2VGMA 1YIJF 3LWOC 5HY4A 3JAMM 3FFMA 1DT9A 5HY0A 3CCRF 4EI9A 3RA6A 3PAFA 1YJNF 1NMUB 3CC7F 3SIVA 5G4VC 1SDSA 3J81M 2I6DA 3CCSF 5IT9M 5GANK 1QVFF 1W3EX 1Q86H 5EO3A 3NVKE 3VMFB 5HXUA 1RA4A 2FGYA 1X7PA 1W40A 3JCMM 3CC4F 3LWVC 1VQ6F 5HXZA 3SIUA 3CPWF 3CD6F 4BVQA 5G4UC 3CC2F 4C4WC 3NK6A 1VQ4F 1Q81H 3NMUC 4BVRA 3E1YA 1GO1A 3ON1A 4BVSA 5HY2A 4BVTA 1XBIA 3G71F 3VI6A 3LFOA 1NJIH 1CN7A 3CMAF 2OZBA 2WALA 1VQ5F 3O85A 3RA5A 4LCKA 3CMEF 5FJ4C 1VQKF 1M90H 4NQ3A 5DCVA 3CPQA 3LWRC 3LWQC 1VQ9F 3OW2F 3HAXD 1GO0A 1IPAA 1VQLF 3G6EF 3IR9A 3WXMB 1VQPF 4BW0B 2VGNA 3CCJF 2ALEA 3V7QA 5GIPC 5HY1A 4XCQA 1YI2F 1K73H 1VQ7F 1Q7YH 1CK2A 1X7OA 3HJWC 2KTUA 2QA4F 3NVIB 4NUTA 3GYQA 1YJ9F 1RLGA 1H7MA 2OTLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIF A;  2LBW A;  1YJW F;  1ZWZ A;  3AGK A;  5GAP K;  1M1K H;  2KG4 A;  1VQN F;  1K8A H;  4X3M A;  3I55 F;  1GZ0 A;  1VQM F;  4TZZ A;  2HVY D;  1E7K A;  1Q82 H;  1KD1 H;  1W41 A;  3CXC F;  1PXW A;  3OBY A;  1JJ2 F;  3N4Y A;  2LBX A;  1VQ8 F;  3CG6 A;  3V7E A;  2OHW A;  3E20 B;  5EWR A;  1W42 A;  3N4Z A;  3I56 F;  3PLA C;  2BO1 A;  1YHQ F;  1K9M H;  5GIO C;  2OTJ F;  1KC8 H;  3CCU F;  2QI2 A;  3J7A R;  3CCM F;  1X52 A;  2JNB A;  3J80 M;  2QEX F;  3CCQ F;  1S72 F;  3G4S F;  5FLX M;  1W2B F;  2CZW A;  2KTV A;  3CCV F;  1N8R H;  1T0K B;  4BY9 D;  5GIN C;  1QVG F;  1YIT F;  3CCL F;  2FC3 A;  1VQO F;  5A2Q M;  1KQS F;  3CCE F;  3NK7 A;  3OBW A;  4X3L A;  3LWP C;  3MCA B;  2VGM A;  1YIJ F;  3LWO C;  3JAM M;  3FFM A;  1DT9 A;  3CCR F;  3RA6 A;  3PAF A;  1YJN F;  1NMU B;  3CC7 F;  3SIV A;  5G4V C;  1SDS A;  3J81 M;  2I6D A;  3CCS F;  5IT9 M;  5GAN K;  1QVF F;  1W3E X;  1Q86 H;  5EO3 A;  3NVK E;  3VMF B;  1RA4 A;  1X7P A;  1W40 A;  3JCM M;  3CC4 F;  3LWV C;  1VQ6 F;  3SIU A;  3CPW F;  3CD6 F;  5G4U C;  3CC2 F;  4C4W C;  3NK6 A;  1VQ4 F;  1Q81 H;  3NMU C;  3E1Y A;  1GO1 A;  3ON1 A;  1XBI A;  3G71 F;  3VI6 A;  3LFO A;  1NJI H;  1CN7 A;  3CMA F;  2OZB A;  2WAL A;  1VQ5 F;  3O85 A;  3RA5 A;  4LCK A;  3CME F;  5FJ4 C;  1VQK F;  1M90 H;  5DCV A;  3CPQ A;  3LWR C;  3LWQ C;  1VQ9 F;  3OW2 F;  3HAX D;  1GO0 A;  1IPA A;  1VQL F;  3G6E F;  3IR9 A;  3WXM B;  1VQP F;  4BW0 B;  2VGN A;  3CCJ F;  2ALE A;  3V7Q A;  5GIP C;  1K73 H;  1YI2 F;  1VQ7 F;  1Q7Y H;  1CK2 A;  1X7O A;  3HJW C;  2KTU A;  2QA4 F;  3NVI B;  4NUT A;  3GYQ A;  1YJ9 F;  1RLG A;  1H7M A;  2OTL F; 
#chains in the Genus database with same CATH topology
 3JAW B;  3D01 A;  1X25 A;  2K1S A;  3RE3 A;  2GLZ A;  3V3T A;  3HTN A;  1M1K H;  2UYJ A;  4IHJ B;  4BT6 A;  4TZZ A;  4G88 A;  3CXC F;  1DBF A;  1JY8 A;  3ZO8 A;  3JAL B;  3V7E A;  2AIZ P;  3CG6 A;  3VTI C;  3HWU A;  3VOB A;  2OHW A;  3E20 B;  4TUY A;  1SA0 B;  3I56 F;  3PLA C;  2BO1 A;  1K9M H;  1Q8R A;  4EI7 A;  3TD5 A;  2UYK A;  4ZHQ A;  3J7A R;  5CB4 B;  1S72 F;  3D54 A;  1W2B F;  2Z1U A;  3CB2 A;  2LBT A;  3WGJ A;  2KTV A;  3VYT C;  4YJ2 A;  1H48 A;  2RHJ A;  5IJ9 A;  3K2X A;  5LOV B;  4BY9 D;  1QVG F;  4IIJ A;  3HKE B;  4O2B A;  3I7T A;  4I4T A;  5HWE A;  4X1I A;  3NK7 A;  5J2T B;  3RYF B;  3LWP C;  1W58 1;  4C82 A;  2VGM A;  5HY4 A;  3FFM A;  5C8Y B;  1CLI A;  3RA6 A;  5B8F A;  5KMG A;  3VO8 A;  3VIU A;  4X1Y A;  1SDS A;  3J81 M;  4O4J A;  1T0A A;  5GAN K;  2EWC A;  2CVL A;  1RA4 A;  1J7H A;  1X7P A;  3TD4 A;  4G4Z A;  2YYE A;  1VQ6 F;  4TUY B;  3SIU A;  3CPW F;  4EB6 A;  3E1Y A;  4O4L A;  3ON1 A;  4ZHQ B;  1W55 A;  2IQQ A;  3G71 F;  2R75 1;  4G4W A;  3EOR A;  1VQ5 F;  1IV3 A;  2P6Y A;  4YJ2 B;  4NQ3 A;  5IJ9 B;  3LWQ C;  4X20 A;  1QU9 A;  3F0D A;  4IIJ B;  3P10 A;  1IPA A;  3S03 A;  4LNU A;  3G6E F;  4O2B B;  1Z5V A;  4I4T B;  3WXM B;  3DDN A;  4BT4 A;  4X1I B;  4BW0 B;  3ZP4 A;  4ZHV A;  2UZH A;  2Z01 A;  1NQ3 A;  4FFB A;  3N2G A;  5HY1 A;  3GTZ A;  3LME A;  3WJP A;  3KIZ A;  3RYC A;  3HJW C;  3NVI B;  2VXY A;  2HS4 A;  4U39 A;  5KMG B;  4X1Y B;  3K0T A;  2AIF A;  1KNK A;  5KX5 A;  2RHH A;  4G4X A;  1VQV A;  3S0W A;  1W5B A;  3AGK A;  2R6R 1;  1VH8 A;  5FNV A;  5GAP K;  1K8A H;  3HKC A;  3M1X A;  3I55 F;  5MN6 A;  5HP7 A;  3OBY A;  4EB6 B;  3N4Y A;  4R40 B;  1VQ8 F;  4O4L B;  4BT2 A;  2Z1F A;  3KJJ A;  5LXT A;  5EWR A;  1W42 A;  3B6N A;  1RLU A;  4C8E A;  1U3P A;  4HNA A;  2GVI A;  2QI2 A;  3C8L A;  5EB0 A;  1X52 A;  3J80 M;  3MDO A;  3U0O A;  2ZVY A;  4X20 B;  4RHA A;  3QHD A;  5JVD A;  3CCV F;  4LNU B;  2B33 A;  5CA0 A;  3WGM A;  3CCL F;  4RQO A;  4WBN A;  5A2Q M;  5BMV A;  1KQS F;  1FNK A;  2YXZ A;  3RYH A;  3N2G B;  2Z1T A;  3JAR A;  3WGK A;  1UI9 A;  5HP8 A;  3JAM M;  1DT9 A;  1R1M A;  5HY0 A;  2HX0 A;  3CCR F;  2UYN A;  3CYP B;  2HP3 A;  5EIB C;  1YJN F;  1JN1 A;  5KX5 B;  3CC7 F;  4I55 B;  1PF5 A;  2RHO A;  5FNV B;  3CCS F;  1IV4 A;  3L7Q A;  3HKC B;  1W3E X;  5EO3 A;  3TD3 A;  3NVK E;  3WJR A;  1KNJ A;  1OAP A;  5HXU A;  2V9Y A;  3WPW A;  5LXT B;  4BVQ A;  5G4U C;  4C4W C;  1VQ4 F;  1Q81 H;  3F0G A;  1OFU A;  4ZI7 A;  2N48 A;  2HQS C;  4BVS A;  3KJK A;  5HY2 A;  4HNA B;  2RB9 A;  1YQN A;  2ZOV A;  3LYB A;  2CHT A;  3VI6 A;  1NJI H;  1CN7 A;  4B5C A;  4ERH A;  3O85 A;  5JVD B;  2PMP A;  2ZF8 A;  1VQK F;  5CA0 B;  2ZAU A;  4TV9 A;  3LWR C;  2CSL A;  1GO0 A;  1JFF A;  4X1K A;  4WBN B;  5BMV B;  3RYH B;  1FFX A;  3JAR B;  4BT7 A;  2W8B C;  3F0F A;  1U43 A;  5EZY A;  1IV1 A;  4G4V A;  5ITZ A;  4XCQ A;  1YI2 F;  1VQ7 F;  5LA6 A;  2UYN B;  2KTU A;  2QA4 F;  2Z1E A;  1YJ9 F;  5AVM A;  2DYY A;  1RLG A;  1H7M A;  2OTL F;  1VK3 A;  5EAZ A;  2ZOD A;  5IJ0 A;  4NWO B;  1XHO A;  4O4I A;  1ZWZ A;  4B46 A;  1TVK A;  4X3M A;  1GZ0 A;  4B45 A;  4G4Y A;  1XRG A;  4PWT A;  4ZK7 A;  3OON A;  1Q82 H;  2IAF A;  1KD1 H;  1W41 A;  1JD1 A;  1PXW A;  2IG8 A;  3HKB A;  2BTO A;  3K12 A;  3N2K A;  1JJ2 F;  4ZI7 B;  4C8I A;  1YGY A;  5JQG A;  3N4Z A;  2CW4 A;  1YHQ F;  3R0P A;  2OTJ F;  4ZOL A;  5LYJ A;  2HRU A;  3K14 A;  2JNB A;  4O4J B;  2QEX F;  1SZQ A;  3P0Z A;  3CCQ F;  4TV9 B;  5JCO A;  1IV2 A;  3P4E A;  5CA1 A;  1JFF B;  3I3F A;  3JAS A;  1N8R H;  1FFX B;  3S02 A;  1T0K B;  1VQO F;  2FC3 A;  1W59 A;  2RHL A;  3CCE F;  2KGW A;  4X3L A;  5ITZ B;  2F9Z C;  1ONI A;  4F6R A;  5LA6 B;  1U3L A;  3PAF A;  1FNJ A;  4ZHW A;  5IJ0 B;  3QUW A;  3S0Y A;  4O4I B;  3VYS C;  3JAK A;  3VCZ A;  1TVK B;  5IT9 M;  5LP6 C;  3CYQ A;  1Q86 H;  4C81 A;  3F0E A;  3VMF B;  2MQE A;  3S06 A;  3HKB B;  2FGY A;  3QTY A;  4E6E A;  3MQW A;  3N2K B;  1W40 A;  4FFB B;  3RYI A;  4M8I A;  3CC4 F;  5JQG B;  4BVR A;  3C9U A;  3RYC B;  2GZL A;  3FD5 A;  3Q8H A;  4ZOL B;  5LYJ B;  3UT5 A;  3JVH A;  2OTM A;  3LFO A;  4I50 A;  4TV8 A;  5CA1 B;  2HS0 A;  3CME F;  2ZVZ A;  3JAS B;  5GON A;  2Q1X A;  3CPQ A;  3ZP7 A;  1QAH A;  3E22 A;  1M90 H;  5DCV A;  1VQ9 F;  3OW2 F;  2BTU A;  2HRY A;  3IMP A;  1VQL F;  3IR9 A;  5IYZ A;  1TUB A;  1Z5W A;  3CCJ F;  2ALE A;  3WJQ A;  1UFY A;  3ELC A;  4F6R B;  3V7Q A;  3C9T A;  5GIP C;  4KWE A;  5EYP A;  1K73 H;  1Q7Y H;  1CK2 A;  1U40 A;  2UYP A;  5LP6 A;  4YJ3 A;  1W5E A;  3S0H A;  5J2U A;  2VAP A;  1ODE A;  3WGN A;  4EI8 A;  3JAK B;  2HS3 A;  1W57 A;  2LBW A;  3LDT A;  1YJW F;  3IKF A;  3HKD A;  2KG4 A;  1VQN F;  3IEQ A;  5EB1 B;  1VQM F;  1H47 A;  2HVY D;  3RYI B;  4DRX A;  3ZOP A;  1E7K A;  4BT5 A;  2CWJ A;  5JCO C;  3DC2 A;  2LBX A;  1COM A;  2PHN A;  3D00 A;  4B62 A;  3UT5 B;  2DT4 A;  3JAT A;  5GIO C;  2VAM A;  3BYQ A;  4I50 B;  2VAW A;  2QTP A;  4TV8 B;  1KC8 H;  3CCU F;  3FPI A;  3CCM F;  5JH7 A;  5GON B;  4DXD A;  3VOA A;  3E22 B;  3G4S F;  5FLX M;  2NMU A;  2CZW A;  2HP0 A;  1RQ2 A;  4U3J A;  5IYZ B;  1TUB B;  5GIN C;  4O2A A;  1YIT F;  1QD9 A;  3IKE A;  1GX1 A;  3OBW A;  5EYP B;  2LCA A;  3MCA B;  4ZHY B;  2H8C A;  1XV2 A;  1YIJ F;  3LWO C;  2I6R A;  5LP6 B;  2H8E A;  4YJ3 B;  2H6L A;  3V4D A;  4C8G A;  5J2U B;  3MBM A;  4EI9 A;  3KHN A;  1NMU B;  3SIV A;  2G9I A;  3M4S A;  5G4V C;  2Q1Y A;  3FD6 A;  2I6D A;  3HKD B;  3JAW A;  4O4H A;  3WPX A;  1QVF F;  4X1K B;  4DRX B;  5EIB D;  3MCQ A;  4IHJ A;  1VHA A;  3JCM M;  5EZY B;  2L26 A;  3LWV C;  5HXZ A;  3CD6 F;  3CC2 F;  3ESJ A;  3NK6 A;  3JAL A;  3C9R A;  3NMU C;  1GO1 A;  3JAT B;  1W5A A;  4BVT A;  1SA0 A;  1XBI A;  5JH7 B;  1W5F A;  3CMA F;  2OZB A;  2WAL A;  3RA5 A;  4I55 A;  4LCK A;  2HP0 B;  5CB4 A;  5FJ4 C;  4U3J B;  5MN4 A;  2BTQ B;  1FSZ A;  4O2A B;  3HAX D;  3ERN A;  3T80 A;  1VQP F;  5LOV A;  2VGN A;  3GHZ A;  3M84 A;  3HKE A;  1RQ7 A;  3FBA A;  3WGL A;  5J2T A;  2CHS A;  3IEW A;  3RYF A;  4BT3 A;  1X7O A;  3VYU C;  4NUT A;  3GYQ A;  3KE1 A;  2AMT A;  3F6M A;  3C9S A;  5MN5 A;  5C8Y A;  4O4H B; 
#chains in the Genus database with same CATH homology
 2AIF A;  4EI8 A;  2LBW A;  2GLZ A;  1YJW F;  3V3T A;  1ZWZ A;  3AGK A;  5GAP K;  1M1K H;  2KG4 A;  1VQN F;  1K8A H;  4X3M A;  3I55 F;  1GZ0 A;  1VQM F;  4TZZ A;  2HVY D;  1E7K A;  1Q82 H;  1KD1 H;  1W41 A;  3CXC F;  1PXW A;  3OBY A;  1JJ2 F;  3N4Y A;  2LBX A;  1VQ8 F;  3CG6 A;  3V7E A;  2OHW A;  3E20 B;  3D00 A;  5EWR A;  1W42 A;  3N4Z A;  3I56 F;  3PLA C;  2BO1 A;  1YHQ F;  1K9M H;  5GIO C;  2OTJ F;  4EI7 A;  1KC8 H;  3CCU F;  2QI2 A;  3J7A R;  3CCM F;  1X52 A;  2JNB A;  3J80 M;  2QEX F;  3CCQ F;  1S72 F;  3G4S F;  5FLX M;  1W2B F;  2CZW A;  2KTV A;  3CCV F;  1N8R H;  1T0K B;  4BY9 D;  5GIN C;  1QVG F;  1YIT F;  3CCL F;  2FC3 A;  1VQO F;  5A2Q M;  1KQS F;  3CCE F;  5HWE A;  3NK7 A;  3OBW A;  4X3L A;  3LWP C;  2F9Z C;  3MCA B;  2VGM A;  1YIJ F;  3LWO C;  5HY4 A;  3JAM M;  3FFM A;  1DT9 A;  5HY0 A;  3CCR F;  4EI9 A;  3RA6 A;  3PAF A;  1YJN F;  1NMU B;  3CC7 F;  3SIV A;  5G4V C;  1SDS A;  3J81 M;  2I6D A;  3CCS F;  5IT9 M;  5GAN K;  1QVF F;  1W3E X;  1Q86 H;  5EO3 A;  3NVK E;  3VMF B;  5HXU A;  1RA4 A;  2FGY A;  1X7P A;  1W40 A;  3JCM M;  3CC4 F;  3LWV C;  1VQ6 F;  5HXZ A;  3SIU A;  3CPW F;  3CD6 F;  4BVQ A;  5G4U C;  3CC2 F;  4C4W C;  3NK6 A;  1VQ4 F;  1Q81 H;  3NMU C;  4BVR A;  3E1Y A;  1GO1 A;  3ON1 A;  4BVS A;  5HY2 A;  4BVT A;  1XBI A;  3G71 F;  3VI6 A;  3LFO A;  1NJI H;  1CN7 A;  3CMA F;  2OZB A;  2WAL A;  1VQ5 F;  3O85 A;  3RA5 A;  4LCK A;  3CME F;  5FJ4 C;  1VQK F;  1M90 H;  4NQ3 A;  5DCV A;  3CPQ A;  3LWR C;  3LWQ C;  1VQ9 F;  3OW2 F;  3HAX D;  1GO0 A;  1IPA A;  1VQL F;  3G6E F;  3IR9 A;  3WXM B;  1VQP F;  4BW0 B;  2VGN A;  3CCJ F;  2ALE A;  3V7Q A;  5GIP C;  5HY1 A;  4XCQ A;  1YI2 F;  1K73 H;  1VQ7 F;  1Q7Y H;  1CK2 A;  1X7O A;  3HJW C;  2KTU A;  2QA4 F;  3NVI B;  4NUT A;  3GYQ A;  1YJ9 F;  1RLG A;  1H7M A;  2OTL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...