1KQSK

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1kqsK02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1kqsK01
1KC8P 2QEXO 1YJ9L 1KD1P 3G4SL 1VQPO 1S72L 3CCLL 1VQ7O 1YJWO 1K9MP 1VQ4L 1Q86P 3CCVO 3CCRL 1M1KP 3CMEO 2OTLL 1M90M 3CMAO 1VQKO 3CC7O 3CCSO 1QVFN 1QVFK 1YI2L 3CPWN 3CPWK 3CC4O 1KC8M 1NJIP 3CC2L 3CD6O 1K73M 1YITO 3CCJO 3I55L 1YIJO 1VQ6L 1Q86M 1VQNO 3CCQL 3I56L 1Q7YM 1W2BN 1VQLO 1W2BK 1VQOL 3CCML 1Q82P 3G71O 2OTJO 3CCEO 1VQ8O 3G6EO 1K8AM 1YJNO 3CC4L 1YHQO 3CCUO 1VQ5O 3CD6L 1Q81P 1JJ2N 2QEXL 1JJ2K 1VQ9O 3CCJL 2QA4O 1KD1M 3CXCN 1VQMO 1QVGN 3CXCK 1QVGK 1VQPL 1VQLL 1VQ7L 1K9MM 1YJWL 1YJ9O 3G4SO 1S72O 3CCEL 1M1KM 3CCLO 3CCVL 1N8RP 3CMEL 1YJNL 1VQ4O 3CMAL 1KQSN 1KQSK 1VQKL 3CC7L 3CCSL 3OW2N 3OW2K 1Q81M 1NJIM 1M90P 1YI2O 1YITL 3CC2O 1YIJL 1VQNL 1N8RM 1K73P 1Q82M 3I55O 1VQ6O 3G71L 2OTJL 3CCQO 3I56O 1Q7YP 1VQOO 3CCMO 1VQ8L 3G6EL 3CCRO 1YHQL 2OTLO 3CCUL 1K8AP 1VQ5L 1VQ9L 2QA4L 1VQML
chains in the Genus database with same CATH superfamily
1KC8P 2QEXO 5DLJA 1YJ9L 1KD1P 3G4SL 1VQPO 1S72L 4N06A 3CCLL 1VQ7O 5DS5A 2YZSA 1YJWO 1K9MP 1VQ4L 1Q86P 3CCVO 3CCRL 1M1KP 3CMEO 2OTLL 1M90M 3CMAO 1VQKO 3CC7O 3CCSO 1QVFN 1QVFK 1YI2L 3CPWN 3CPWK 3CC4O 1KC8M 1NJIP 3CC2L 3CD6O 1K73M 1YITO 3CCJO 3I55L 1YIJO 1VQ6L 1Q86M 1VQNO 3CCQL 3I56L 1W2BN 1Q7YM 1VQLO 1W2BK 1VQOL 3CCML 1Q82P 3G71O 2OTJO 3CCEO 5DQTA 3NKDA 3G6EO 1VQ8O 1K8AM 1YJNO 3CC4L 1YHQO 4WJ0A 3CCUO 1VQ5O 3CD6L 1Q81P 1JJ2N 2QEXL 1JJ2K 1VQ9O 3GODA 3CCJL 2QA4O 1KD1M 3CXCN 1VQMO 1QVGN 3CXCK 5DS4A 4W8KA 1QVGK 1VQPL 1VQLL 1VQ7L 1K9MM 4XTKA 1YJWL 1YJ9O 3G4SO 1S72O 3CCEL 1M1KM 3CCLO 3CCVL 1N8RP 3CMEL 1YJNL 1VQ4O 3CMAL 1KQSN 1KQSK 4QDLA 3CC7L 3CCSL 1VQKL 3OW2N 3OW2K 1Q81M 1NJIM 1M90P 1YI2O 1YITL 3CC2O 1YIJL 1VQNL 5DS6A 1N8RM 1K73P 1Q82M 3I55O 1VQ6O 3G71L 2OTJL 3CCQO 3I56O 1Q7YP 1VQOO 3CCMO 4P6IC 3G6EL 1VQ8L 3CCRO 1YHQL 5DQZA 2OTLO 3CCUL 1K8AP 1VQ5L 1VQ9L 5FCLA 2QA4L 1VQML
chains in the Genus database with same CATH topology
1KC8P 2QEXO 5DLJA 1YJ9L 1KD1P 3G4SL 1VQPO 1S72L 4N06A 3CCLL 1VQ7O 5DS5A 2YZSA 1YJWO 1K9MP 1VQ4L 1Q86P 3CCVO 3CCRL 1M1KP 3CMEO 2OTLL 1M90M 3CMAO 1VQKO 3CC7O 3CCSO 1QVFN 1QVFK 1YI2L 3CPWN 3CPWK 3CC4O 1KC8M 1NJIP 3CC2L 3CD6O 1K73M 1YITO 3CCJO 3I55L 1YIJO 1VQ6L 1Q86M 1VQNO 3CCQL 3I56L 1W2BN 1Q7YM 1VQLO 1W2BK 1VQOL 3CCML 1Q82P 3G71O 2OTJO 3CCEO 5DQTA 3NKDA 3G6EO 1VQ8O 1K8AM 1YJNO 3CC4L 1YHQO 4WJ0A 3CCUO 1VQ5O 3CD6L 1Q81P 1JJ2N 2QEXL 1JJ2K 1VQ9O 3GODA 3CCJL 2QA4O 1KD1M 3CXCN 1VQMO 1QVGN 3CXCK 5DS4A 4W8KA 1QVGK 1VQPL 1VQLL 1VQ7L 1K9MM 4XTKA 1YJWL 1YJ9O 3G4SO 1S72O 3CCEL 1M1KM 3CCLO 3CCVL 1N8RP 3CMEL 1YJNL 1VQ4O 3CMAL 1KQSN 1KQSK 4QDLA 3CC7L 3CCSL 1VQKL 3OW2N 3OW2K 1Q81M 1NJIM 1M90P 1YI2O 1YITL 3CC2O 1YIJL 1VQNL 5DS6A 1N8RM 1K73P 1Q82M 3I55O 1VQ6O 3G71L 2OTJL 3CCQO 3I56O 1Q7YP 1VQOO 3CCMO 4P6IC 3G6EL 1VQ8L 3CCRO 1YHQL 5DQZA 2OTLO 3CCUL 1K8AP 1VQ5L 1VQ9L 5FCLA 2QA4L 1VQML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 P;  2QEX O;  1YJ9 L;  1KD1 P;  3G4S L;  1VQP O;  1S72 L;  3CCL L;  1VQ7 O;  1YJW O;  1K9M P;  1VQ4 L;  1Q86 P;  3CCV O;  3CCR L;  1M1K P;  3CME O;  2OTL L;  1M90 M;  3CMA O;  1VQK O;  3CC7 O;  3CCS O;  1QVF N;  1QVF K;  1YI2 L;  3CPW N;  3CPW K;  3CC4 O;  1KC8 M;  1NJI P;  3CC2 L;  3CD6 O;  1K73 M;  1YIT O;  3CCJ O;  3I55 L;  1YIJ O;  1VQ6 L;  1Q86 M;  1VQN O;  3CCQ L;  3I56 L;  1Q7Y M;  1W2B N;  1VQL O;  1W2B K;  1VQO L;  3CCM L;  1Q82 P;  3G71 O;  2OTJ O;  3CCE O;  1VQ8 O;  3G6E O;  1K8A M;  1YJN O;  3CC4 L;  1YHQ O;  3CCU O;  1VQ5 O;  3CD6 L;  1Q81 P;  1JJ2 N;  2QEX L;  1JJ2 K;  1VQ9 O;  3CCJ L;  2QA4 O;  1KD1 M;  3CXC N;  1VQM O;  1QVG N;  3CXC K;  1QVG K;  1VQP L;  1VQL L;  1VQ7 L;  1K9M M;  1YJW L;  1YJ9 O;  3G4S O;  1S72 O;  3CCE L;  1M1K M;  3CCL O;  3CCV L;  1N8R P;  3CME L;  1YJN L;  1VQ4 O;  3CMA L;  1KQS N;  1KQS K;  1VQK L;  3CC7 L;  3CCS L;  3OW2 N;  3OW2 K;  1Q81 M;  1NJI M;  1M90 P;  1YI2 O;  1YIT L;  3CC2 O;  1YIJ L;  1VQN L;  1N8R M;  1K73 P;  1Q82 M;  3I55 O;  1VQ6 O;  3G71 L;  2OTJ L;  3CCQ O;  3I56 O;  1Q7Y P;  1VQO O;  3CCM O;  1VQ8 L;  3G6E L;  3CCR O;  1YHQ L;  2OTL O;  3CCU L;  1K8A P;  1VQ5 L;  1VQ9 L;  2QA4 L;  1VQM L; 
#chains in the Genus database with same CATH topology
 1KC8 P;  2QEX O;  5DLJ A;  1YJ9 L;  1KD1 P;  3G4S L;  1VQP O;  1S72 L;  4N06 A;  3CCL L;  1VQ7 O;  5DS5 A;  2YZS A;  1YJW O;  1K9M P;  1VQ4 L;  1Q86 P;  3CCV O;  3CCR L;  1M1K P;  3CME O;  2OTL L;  1M90 M;  3CMA O;  1VQK O;  3CC7 O;  3CCS O;  1QVF N;  1QVF K;  1YI2 L;  3CPW N;  3CPW K;  3CC4 O;  1KC8 M;  1NJI P;  3CC2 L;  3CD6 O;  1K73 M;  1YIT O;  3CCJ O;  3I55 L;  1YIJ O;  1VQ6 L;  1Q86 M;  1VQN O;  3CCQ L;  3I56 L;  1W2B N;  1Q7Y M;  1VQL O;  1W2B K;  1VQO L;  3CCM L;  1Q82 P;  3G71 O;  2OTJ O;  3CCE O;  5DQT A;  3NKD A;  3G6E O;  1VQ8 O;  1K8A M;  1YJN O;  3CC4 L;  1YHQ O;  4WJ0 A;  3CCU O;  1VQ5 O;  3CD6 L;  1Q81 P;  1JJ2 N;  2QEX L;  1JJ2 K;  1VQ9 O;  3GOD A;  3CCJ L;  2QA4 O;  1KD1 M;  3CXC N;  1VQM O;  1QVG N;  3CXC K;  5DS4 A;  4W8K A;  1QVG K;  1VQP L;  1VQL L;  1VQ7 L;  1K9M M;  4XTK A;  1YJW L;  1YJ9 O;  3G4S O;  1S72 O;  3CCE L;  1M1K M;  3CCL O;  3CCV L;  1N8R P;  3CME L;  1YJN L;  1VQ4 O;  3CMA L;  1KQS N;  1KQS K;  4QDL A;  3CC7 L;  3CCS L;  1VQK L;  3OW2 N;  3OW2 K;  1Q81 M;  1NJI M;  1M90 P;  1YI2 O;  1YIT L;  3CC2 O;  1YIJ L;  1VQN L;  5DS6 A;  1N8R M;  1K73 P;  1Q82 M;  3I55 O;  1VQ6 O;  3G71 L;  2OTJ L;  3CCQ O;  3I56 O;  1Q7Y P;  1VQO O;  3CCM O;  4P6I C;  3G6E L;  1VQ8 L;  3CCR O;  1YHQ L;  5DQZ A;  2OTL O;  3CCU L;  1K8A P;  1VQ5 L;  1VQ9 L;  5FCL A;  2QA4 L;  1VQM L; 
#chains in the Genus database with same CATH homology
 1KC8 P;  2QEX O;  5DLJ A;  1YJ9 L;  1KD1 P;  3G4S L;  1VQP O;  1S72 L;  4N06 A;  3CCL L;  1VQ7 O;  5DS5 A;  2YZS A;  1YJW O;  1K9M P;  1VQ4 L;  1Q86 P;  3CCV O;  3CCR L;  1M1K P;  3CME O;  2OTL L;  1M90 M;  3CMA O;  1VQK O;  3CC7 O;  3CCS O;  1QVF N;  1QVF K;  1YI2 L;  3CPW N;  3CPW K;  3CC4 O;  1KC8 M;  1NJI P;  3CC2 L;  3CD6 O;  1K73 M;  1YIT O;  3CCJ O;  3I55 L;  1YIJ O;  1VQ6 L;  1Q86 M;  1VQN O;  3CCQ L;  3I56 L;  1W2B N;  1Q7Y M;  1VQL O;  1W2B K;  1VQO L;  3CCM L;  1Q82 P;  3G71 O;  2OTJ O;  3CCE O;  5DQT A;  3NKD A;  3G6E O;  1VQ8 O;  1K8A M;  1YJN O;  3CC4 L;  1YHQ O;  4WJ0 A;  3CCU O;  1VQ5 O;  3CD6 L;  1Q81 P;  1JJ2 N;  2QEX L;  1JJ2 K;  1VQ9 O;  3GOD A;  3CCJ L;  2QA4 O;  1KD1 M;  3CXC N;  1VQM O;  1QVG N;  3CXC K;  5DS4 A;  4W8K A;  1QVG K;  1VQP L;  1VQL L;  1VQ7 L;  1K9M M;  4XTK A;  1YJW L;  1YJ9 O;  3G4S O;  1S72 O;  3CCE L;  1M1K M;  3CCL O;  3CCV L;  1N8R P;  3CME L;  1YJN L;  1VQ4 O;  3CMA L;  1KQS N;  1KQS K;  4QDL A;  3CC7 L;  3CCS L;  1VQK L;  3OW2 N;  3OW2 K;  1Q81 M;  1NJI M;  1M90 P;  1YI2 O;  1YIT L;  3CC2 O;  1YIJ L;  1VQN L;  5DS6 A;  1N8R M;  1K73 P;  1Q82 M;  3I55 O;  1VQ6 O;  3G71 L;  2OTJ L;  3CCQ O;  3I56 O;  1Q7Y P;  1VQO O;  3CCM O;  4P6I C;  3G6E L;  1VQ8 L;  3CCR O;  1YHQ L;  5DQZ A;  2OTL O;  3CCU L;  1K8A P;  1VQ5 L;  1VQ9 L;  5FCL A;  2QA4 L;  1VQM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...