1KRWA

Solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
molecule tags Signaling protein
source organism Salmonella typhimurium
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krwA00
2FEWB 3HVRA 3OM1A 1E2BA 2ZAYA 2GI4A 2VYCA 3HS3A 4MR9A 4GPAA 3CNBA 3IP6A 1U2QA 5DLEA 3KLNA 3RVNA 1SRRA 4MQFB 2Q5CA 4UHJA 4MS1B 1SXGA 1EWVA 1B00A 1U8TA 2LIVA 4JA2A 2PL1A 1VRVA 4G97A 2MYPA 5EWJB 1ZITA 1XWWA 2FEKA 2IOYA 3DGFC 4MS4A 3G1WA 3E61A 3D8UA 1I3CA 3O21A 1BDIA 1OXKB 2A9PA 4W5OA 3HM9A 3L6UA 1MVOA 1YMVA 1GUBA 2LBPA 2H0AA 4RY0A 1W25A 4ZPJA 5TQJA 4RDCA 1W9HA 3CG0A 5TQ2B 3OMWA 4EVRA 4RK5A 4D6XA 3O75A 4KQCA 4RV5A 4MQEA 4RU1A 1GCGA 2FMKA 3LKBA 3JVIA 1YS6A 3O2JA 1GLGA 1TVMA 4EYKA 4XFKA 3H5OA 5JNUA 1XHFA 1WETA 4MGEA 4TN5A 1D5WA 4N03A 1Y1LA 5IUNC 4RWEA 5KC9A 5KQMA 3OLVA 5CNKA 2FMIA 5HQJA 1URPA 4Y9TA 4YS6A 2MYUA 3HEBA 2W42A 2QZJA 4XAQA 4EGSA 3QEMB 1NY5A 3LUCA 4KRFA 2QSJA 1U2PA 2R48A 5B3JC 1RZRD 3M9WA 4MS3A 4IRXA 2X7XA 3CHYA 2FSPA 2GWRA 4Q6BA 1YTUA 4RY8A 3I5AA 3LUAA 3QELB 3FFXA 5HSGA 2KYRA 4W5QA 5BRAA 3H5IA 3W9SA 4Q7EA 5CNIA 3EAFA 3LFTA 3GV0A 1QNLA 2L2QA 2R47A 4XARA 2FN8A 2N9UA 3HSYA 5FWYB 3TMYA 5TPZA 2MYNA 3Q9SA 4KNYA 3HO1A 3IP5A 4XASA 3H5VA 4N0QA 4Z99A 4LE2A 1ZN2A 3CFYA 4G0YA 1IIBA 5KC8A 4MLCA 3I09A 5IX8A 1C0EA 2PUDA 3F7NA 3N75A 2JRLA 4H3KB 1OXBB 4OLBA 1A0OA 3BRQA 4JP1A 3F73A 1LJUA 5JS2A 7ABPA 3MA0A 8ABPA 1JDPA 1PHRA 2JCGA 1R8JA 2E4YA 3JPYA 1D4ZA 2ID7A 3FFTA 1FQWA 5ED4A 2JK1A 3LUHA 1M5TA 5T7BA 1BDJA 4EY3A 4MLDA 3B2NA 3RQIA 4O1HA 1EFAA 2P4UA 4ML3A 2FKAA 4EVSA 1KGSA 5KQGA 4IGAA 3FDFA 3NHMA 1QO0A 4WUTA 4WWHA 3TX6A 3C3KA 4Z4EA 1K68A 3URMA 3H6HA 3RVJA 1JYFA 2LPMA 2O20A 2E4ZA 4MR9B 3MYYA 3Q7SA 3CKMA 3QLUA 1PNRA 1MIHA 3K9CA 4NQRA 2NZVG 3GT7A 4MR8A 4JOQA 3C3MA 4IILA 1JBEA 1PNTA 4DN6A 1CHNA 5KQPA 1BVHA 4GNRA 4MS4B 4Z9BA 3N6VA 1QQBA 3KG2A 4MPTA 5DTEA 1DC7A 1YMUA 4YO7A 3T6KA 3R0JA 3Q7RA 2V0NA 1DJMA 4PE5B 4TLLB 1ISSA 1EHCA 2FVYA 2YHAA 5CNJA 3RVOA 1L5ZA 3MQ4A 4W5TA 4L4UA 3HUTA 3HZHA 1DG9A 1P6QA 1JYEA 1ZDMA 3LUDA 4UHKA 1QP4A 2GX6A 4G0XA 5JNVA 1H9CA 4G0QA 4MQEB 3CZ5A 5EWLA 1DP4A 2FXIA 1D2AA 4D74A 4HNQA 4F06A 3IPCA 1JHZA 2WB4A 5KQLA 1JLKA 4KMRA 2FQYA 3SM9A 4RK7A 1Z2DA 5IEJA 2PUEA 3H1EA 1JX6A 4Z0NA 2QU7A 1SD5A 1FFSA 4ZMSA 3LMKA 2LUOA 5HKOA 1Z16A 5TQ0A 3T38A 5C5EA 2J48A 1RPJA 3GBPA 3HV2A 2A9RA 2L19A 9ABPA 2NT3A 3ROFA 4RK1A 1SXHA 2XDYA 4KZKA 3EJWA 3KHTA 4YP9A 5TPWA 4MS3B 4LRQA 5PNTA 3H75A 4F3TA 6ABPA 1YK0A 2HQRA 4Z4CA 4MR7A 4DADA 1DC8A 4Z9AA 4KV7A 4MAAA 3KKEA 3ROTA 3RVPA 3TO5A 5EWMA 5JNSA 4G0OA 4RSMA 1DBWA 4YR7A 3CLKA 4O5AA 4TMYA 4HYEA 4W5RA 1Z17A 3C6QA 5CNMA 2IYNA 4S04A 1Z12A 1BA2A 2IDMA 1QMPA 4KK3A 1TJYA 3GRCA 3SY8A 1FSPA 1NXVA 1ZHHA 3QX9A 3SAJA 3T95A 1JFSA 1M2EA 1JFTA 4Q6WA 1Z13A 1ISRA 3JPWA 4MQFA 2FLKA 2PMCA 4YRZA 4NCBA 3C3WA 3UKJA 1M2FA 4G0MA 2P9HA 4KK4A 1EAYA 2JVJA 4CBVA 5E3JA 3A10A 5FBHA 4ZYLA 4P1ZA 3HDGA 3N8IA 3MF4A 1L5YA 2OENG 3KYIB 1FFGA 3O1HB 1LJLA 3OLXA 3Q41A 2JBAA 5JNWA 2NZUG 1KRXA 2PJUA 2HJ9A 3OLWA 3H5WA 4LE1A 1LK0A 3RH0A 4W5NA 2WRZA 3MMNA 3CS3A 4G0ZA 4IMJB 1USKA 2WJWA 5IULC 1UDRA 1MB0A 2B4AA 4RS3A 3FMVA 4KQ9A 3VNBA 4D6YA 3N0RA 1YIOA 1NXXA 3DLBA 3OMXA 1T34A 1ABEA 3LTEA 1MB3A 1DRJA 3LUKA 4H3HB 2YHBA 3LUJA 4XLTA 3NHZA 4EYGA 4MR8B 5FBKA 4G0PA 3HDVA 3JTEA 5GOTA 2RJOA 5FWXA 1MAVA 3BRSA 3DBIA 1HEYA 1EWKA 1YS7A 2GKGA 3KLOA 1JF8A 1TLFA 5BRJA 2HQOA 2PUAA 3RVMA 5JNTA 3MM4A 4Z4HA 1ZVVA 2E4WA 1APBA 1ZY2A 2E4UA 5T3YA 3M6MD 5JNRA 2PUCA 4PEVA 1A2OA 3T8YA 3QEKA 3QLVA 1ZESA 4F11A 2FN9A 4LZLA 1QP0A 3EQ2A 5EWLB 2RGYA 2FMFA 4O1IA 4Z4GA 4ZMRA 1Z2EA 4ETIA 1PEAA 2FTKE 3S99A 4KPYA 1XHEA 2H3HA 2QVGA 3QLUC 3BILA 4QYWA 2E4XA 4YLEA 1VPWA 2PUGA 2OQRA 2RJNA 3LUFA 2F8TA 3HCWA 2PUBA 2FMHA 1NATA 2AYXA 4N76A 2MSLA 5TQ0B 3E3MA 1KRWA 3O1JC 3ILYA 4N0PA 3QLTA 5TPZD 1YVUA 3SG0A 2HPHA 5ABPA 3RVLA 4NCAA 2PUFA 2FEPA 4B09A 3OM0A 1QQAA 1DCFA 1NTRA 1JDNA 1F51E 1S8NA 5TPWB 3LUGA 1RXIA 1VLZA 3NBMA 5D2CA 4LX8A 4IF4A 2NUBA 1DCKA 2WY2D 3EGCA 4RY9A 4Z4IA 4MYRA 4EYOA 3GYBA 1JFVA 4MR7B 3F6PA 2IPNA 4RZSA 5EWMB 1NXSA 4N41A 3CZCA 4FE4A 4E7PA 2QR3A 3A0RB 1PUXA 1K66A 3C97A 3A3KA 4WT7A 1RZRA 3KSMA 4F12A 1USIA 4EUKA 2QXYA 1DZ3A 3EDCA 1U0SY 4EVQA 3M9XA 1PEYA 2NT4A 3TD9A 4KFCA 4L85A 2RDMA 3HJFA 3O2QB 3F6CA 1E6KA 1TM2A 4MRMA 3OLYA 1QO0D 1E6MA 2FLWA 2ID9A 3JS5A 3OO0A 5JS1A 2IPLA 3H5LA 2M1ZA 4JASB 4E7OA 4WXMA 4Z4FA 3A0UA 3KS9A 3GL9A 3NNNA 4OTZA 2JBAB 4WZZA 3NNDA 4PZ0A 3IDOA 3BBLA 3HUUA 3KCNA 1NXWA 3OLZA 1Z15A 4YGXB 1YK1A 3CG4A 3GBVA 3RVKA 1ZGZA 4PICA 1D1PA 3KTOA 4HNRA 2IPMA 4TLMB 1KMIY 1P6UA 1ZH4A 3UK0A 1GUDA 4FE7A 2L17A 3KYJB 4QICA 5IUKC 4ETNA 4LE0A 1A04A 3CRNA 3UUGA 4YWHA 2GBPA 2LP4Y 3IP7A 4MS1A 2AYZA 2CHEA 3SQNA 4P98A 3ILHA 1DBQA 3CTPA 3O2SB 4KVFA 1F4VA 1U04A 2CHFA 2PAFA 3H1GA 4OG2A 2WWVD 3RVRA 1ZAYA 3EODA 2IPAB 1Z25A 2VUHB 3I45A 4JAVC 5EWJA 3HXMA 4KREA 3OO1A 2HSGA 5FWXB 1USGA 1NXOA 2I6FA 3CU5A 3D02A 3JY6A 5B3JA 2PL9A 4WXEA 3G85A 5IEBA 1P8AA 5KI6A 4RXMA 1DBPA 4PYRA 2TMYA 3GWGA 3EULA 1BDHA 3LKVA 2FW0A 5IUJC 5TE9A 1QKKA 2JVKA 1QPZA 2QVCA 2MSWA 3MIZA 1D1QA 1FFWA 3H6GA 5DCLA 3DZDA 5C5CA 2VUIB 2A9OA 6CHYA 5TQ2A 3QX8A 1ZH2A 3P9YA 3Q7TA 2R4QA 4H60A 4RK0A 1LBHA 1J56A 2QW1A 1ZGGA 3LOPA 3N53A 3EQZA 4FB4A 3RVSA 3RVQA 4RXUA 1RXEA 3QK7A 1ABFA 2IKSA 2MSKA 3H5TA 4QYMA 1LBIA 5KWSA 3KJXA 1JH9A 4JB0A 3HK2A 1SXIA 4RKRA 4JB2A 1DCMA 1GCAA 1Z26A 1CYEA 2PKXA 3N0XA 4S05A 1M5UA 3FFWA 5CHYA 3QEMA 4OLAA 4XXHA 4OATA 3VNAA 4N47A 3IP9A 4LDZA 3DLHA 4RK6A 5IC5A 2CWDA 4NICA 4OBBA 3QELA 3SNKA 2QV0A 3NNSA 1RNLA 5BQ3A 1EWTA 2L18A 5IBQA 2CD7A 2E4VA 3H1FA 5HM6A 4YV7A 4DQDA 1C4WA 3IPAA 3QLVC 4RK4A 3FGZA 1JL3A 5FWYA 2PLNA 1BAPA 3JVDA 2A9QA 4G86A 1TMYA 1Z18A 2JB9A 2R25B 2VK2A 1E6LA 5DKFA 2B1JA 3O1IC 4ZJPA 1QP7A 4NV3A 4HNSA 3OQMA 2PE5A 2WMYA 5I4CA 4ETMA 2DRIA 4MRMB 5DGCA 4EYQA 3DGEC 2FQXA 5F64A 1VKRA 2ZWMA 3L49A 3O74A 2JVIA 2M98A 2MYTA 2WJAA 4YCSA 4M88A 1DRKA 4QPJC 5BR1A 2FQWA 1AB5A 1NXTA 4IMIB 3K4HA 5GQSA 3BREA 3OQNA 2BGGA 2HQBA 3GA5A 4RXTA 3Q15C 4LDAA 1JWLA 1AB6A 2F8SA 4F8JA 3TB6A 4RKQA 1NXPA 3I42A 3OQOA 3N0WA 1P2FA 1CEYA
chains in the Genus database with same CATH superfamily
1VLHA 1GU7A 1KO8A 1N8TA 3JZFA 4F84A 2Q4EA 3CNBA 4IJKA 3OE4A 4H4EA 3DDHA 2XZOA 2ZEJA 5AVYA 3FDIA 1C1XA 1N1MA 2XYRA 2XODA 1JHPA 3VI4B 2OV2A 4WK4B 3PD0A 3NP9A 4MQ5A 3TW4A 4F91B 5AH0A 3DXZA 4FXPA 3H4MA 3NI2A 3OIFA 4JA2A 2MIIA 3ITDA 3JQBA 4J0JA 3GJXC 2QUHA 2G0TA 4MS4A 3VR3A 1B93A 2X8WA 3EQ6A 3TQCA 2XD9A 1Z8HA 4P84A 1I3CA 4R2XA 4ERXA 5A7FA 2CNWA 4HMPA 1U1GA 2A9PA 5JMPA 4HV4A 3NASA 4L78A 1G0OA 2CHVA 3GJ5A 4P58A 4UTVA 5L7WA 4KOAA 1W25A 5LQRA 1YA6A 1H6DA 3PE6A 4MINA 2GT1A 2JFGA 4A8HA 1XDSA 4B80A 1K6IA 3V7NA 3C7CB 2O2ZA 3NOQA 4PRLA 5DM2A 2WT4A 2JLUA 5KREA 3EY9A 1LGYA 4XM1A 3KEMA 1SUBA 2W71A 2WC1A 4OH1A 4OXYA 1RBMA 5CG1A 5ITSA 2H08A 1FRQA 3C70A 4C6TB 3DUWA 2VJBA 3JXEA 3KYCB 1D2HA 4WFJA 1D5WA 1K1EA 3F4BA 3GEBA 3H8SA 3DB1A 3I76A 5FTKA 1E2LA 2AG5A 4QE3A 4EARA 3I23A 3WLSA 4YQZA 1TLTA 2WNHA 2YYZA 3CH6A 3GAZA 2X0JA 5HQJA 2RAPA 4JVSB 4QJ3A 4R41A 4O4HF 1KYVA 4XUCA 2AQHA 1DO2A 3WTBA 1QO9A 1UC5B 3R3XA 1UXGA 4DXHA 3TFOA 3LHDA 2QRJA 4CKEB 5AHOA 4KRFA 1B3BA 4XIFA 5DEOA 4C5BA 1MORA 4FOOA 8AT1A 3TTVA 3P8ZA 1HWYA 1Y4AE 3BGIA 2WFLA 3GJ0A 2Q3EA 2ZIFA 3OAAD 4J3FA 1LDNA 3IIKA 3V4VB 2BONA 4A92A 1UBRS 1PNOA 3BK2A 4YRIA 3IVGA 1A5BB 1JVNA 1JJ7A 1XJ0A 2FWNA 3IT0A 4KLNA 3ZJUA 3RYIB 3FFAA 1O0SA 4L7VA 2OLJA 1IK4A 4GPTA 4QPZA 4CJXA 3HO1A 4JXJA 3R7FA 4PXYA 4POAA 2PZ8A 1S7GA 1GQRA 2C2HA 1ZN7A 2BZSA 2QE7A 2QPAA 2VIIA 3WB2A 5IXJA 5AW5A 3CFYA 3I6BA 4YCNA 4MJLA 3K0BA 2ESRA 3LYUA 3NVAA 3TSAA 3ZUGA 4CR7A 1C4OA 5B6JA 1D7OA 2BMDA 3UA4A 1KQGA 4PPGA 2RGRA 2IEYA 4TGLA 2JL1A 3UVEA 1QG2A 4B7ZA 1R0CA 1JGTA 1CQIB 3BRQA 4MB2A 4LZWA 2QGNA 4RH1A 3PXGA 3C1OA 4BVBA 3W8FA 2AMLA 1RYMA 2Q5FA 3FB4A 1EVYA 1MDBA 3P9QA 3VR2A 1CLEA 4AP6A 4YCDA 4FI3C 3HWSA 3CPSA 1B73A 1SVMA 2XAAA 4ZQHA 1MJHA 2DKFA 2GF9A 3CY6A 4CEHB 3LKDA 3PT5A 1VIDA 5DX8A 4H3VA 5H70A 3THXA 1DWQA 1XV5A 2P4UA 2FKAA 3LFUA 3DLCA 2QOEA 5DHSA 2C3YA 2HM7A 4E46A 2BRUC 3UYKA 3DTYA 4D9FA 3NIWA 4Z86A 5F73A 3NHMA 5INTA 2VS1A 4A0FA 1X19A 4FC6A 1VHJA 4TZTA 3ITEA 1W8DA 2PK3A 2BHNA 3AI7A 2YH2A 1NMYA 4MR9B 1D0VA 3ZNQA 1E66A 1I7PA 1UQUA 2OVBA 2VNIA 5KDOA 5CBPB 3T1NA 4X1KA 4UARA 3DLAA 4QFDA 4NS1A 2H5EA 2GFIA 4J2HA 5B58T 3WWYA 8ATCA 1XSEA 3IV9A 3SEAA 3W6UA 3F71A 4IILA 2Z5GA 3CN9A 2WJGA 3KKQA 2OD9A 3EF0A 2I29A 1A5AB 3F6BX 2RD2A 3LPCA 4MW9A 4GYJA 3NHLA 1JEQB 1WW2A 3NBQA 4V1CI 3ICOA 3EXG2 5LOVB 2AUTA 1WF6A 5BN5A 4O4LB 5CEEA 5CVJA 1E2DA 2XXAB 4NP6A 2X19A 4INPA 3T12A 3V8MA 4A8TA 4DC9A 1NP6A 4JROA 4FIZA 1N6PA 4MULA 1QH1B 1R66A 3PXDA 2FRDA 2O2SA 2G1KA 3CLTD 2GYWA 3HUTA 2PFGA 2QJOA 3LUDA 2ONYA 4NJMA 5IFLA 1RRGA 2AN9A 3NWJA 4UFOA 2C5HA 1TM1E 3RAGA 1JXAA 2D2XA 1U0GA 4EO4A 1ZIPA 5EWLA 4DMHA 1K5HA 4JVLA 2DVMA 1NNUA 4HNQA 4KNVA 3UN1A 5YASA 2UZ0A 2GTHA 1QAMA 1U99A 3DC2A 5BN3B 1R6TA 2W6IA 3SF8B 2JH8A 1II8B 2GBFA 2Q45A 1J22A 4TOIA 4RYDA 3CVVA 3GLSA 2Q5EA 1XEXA 5EJAA 5AWFC 5J1TB 3SFVA 4AG5A 3BGVA 2G76A 3K5WA 1PJ8A 3AHHA 4NJEB 3SX2A 3W1VA 3SVTA 3TLYA 2AJTA 1W93A 1YR1A 2L19A 3SS9X 1HFJA 3DPUA 1CG6A 1N8SA 2RSLA 3G0IA 4PNPA 5DCUA 5EJGA 3UUWA 3BJMA 3U3XA 3KZKA 5JXHA 3H75A 1VE5A 5EP2A 2I9KA 2ONCA 2VQDA 1PQYA 2HQRA 4J91A 2QMUA 3NW9A 2DYKA 2GBCA 2DFKB 3DCYA 3JAWB 2PBFA 4DADA 1PJTA 3VNUA 1FP4B 2Y1OA 2IXDA 5EWMA 2OKCA 3ENWA 1XAIA 3PA6A 3UHJA 4JLPA 2J45A 1YS1X 1ZRSA 2DWUA 4HFMA 4YDQA 6NULA 4WFIA 3HB4X 2R6R1 3HRKA 1QRSA 3KTAA 5JMWA 5L3QB 4QEDA 5JRZA 4C7XA 2ZRQA 1TJYA 3WBKA 2C7GA 3GRCA 3DEZA 3RNLA 1CB7A 2BYTA 3T1TA 5EP4A 1YXMA 5AK0A 5CB6A 2CSXA 1JHMA 2IEDA 2BHLA 1QU2A 2BGLA 2NX2A 2VHQA 2YTZA 2LW7A 3IE2A 4FD2A 3AZQA 3Q88A 1Z4IA 3VKGA 2VDMB 4NZPA 3QIVA 4AURA 1KHHA 4XQGA 1AU9A 1Z5VA 3A10A 3D7SA 3QUCA 2OCPA 3NAZA 3PEUA 3ETHA 3C7AA 2XRZA 2J31A 1YULA 1T4BA 3OD1A 1I4LD 1KAOA 3IJ5A 3RC8A 2J3DA 2V58A 3B38A 3MG9A 1FYVA 2ZXEA 3KOZA 2BGJA 2WUFA 4M7PA 3TIGA 3C4VA 7ADHA 3MMNA 5CCDA 1D09A 2EBHX 4Q18A 1DKUA 2BVNA 4TV8A 1XJCA 1MB0A 2X9VA 1PV4A 1H0RA 3IUNA 3PS9A 4MEBA 3SZGA 1KMMA 2LDXA 3RR2A 3A1FA 4D6YA 4HS4A 4EI9A 5CCEA 1S2NA 3IXQA 4DZTA 4YV2A 5H9WA 3PF9A 1M0SA 1PEDA 4RLSA 2CDBA 5EIEA 3BAFA 2IYYA 2XEDA 3MIIA 1KPGA 4R0VA 1B6RA 2YASA 1XZIA 4H6PA 1Y6RA 3ZWXA 1KO4A 2XIJA 1XF1A 1KO5A 3DC7A 1TMGE 3UAYA 2NPFA 1K27A 3G5TA 1AUQA 4OXQA 3BJZA 1A88A 4DUPA 3CZMA 1RHMA 3H2GA 4PQYA 3GLHB 5BYBA 5JDCA 4H17A 2YQZA 2E4WA 1K92A 2PRYA 3RIEA 4DLYA 4QULA 1IQRA 3GZ4A 1C2TA 5J23A 4DR3B 2WU0A 3Q8XB 2I2BA 2AMJA 5AM5A 4GYKA 2RB5A 2OVFA 3KZMA 2ZYHA 4C21A 1XDZA 1V9SA 4Z8XA 2HSEA 2OO7A 2DR3A 5HEKA 3VGPA 4G9EA 4ZQBA 3IMEA 1W2WB 1MOPA 1EB8A 1WXQA 3RIHA 3HJHA 3SHOA 5ES4B 1VPWA 1C3EA 1QHXA 3G1UA 4JGBA 4RD1A 3E82A 2D7JA 1L8LA 1NDQA 3AR2A 1AXRA 3VNSA 3JQ8A 3AC0A 4P7JA 4KP7A 5JXJA 3PGKA 3PDCA 3N05A 3WGIA 4B09A 1CW2B 2BGKA 2IW1A 4JBIA 3TSOA 4OAPA 3ZUPA 4C1NA 3HZRA 5IAEA 4DGQA 3SEFA 4LX8A 2P75A 2NUBA 4GG1A 4IF4A 4ZAXA 2WHQA 3SC4A 3Q8LA 1EJ6A 1JEEA 2BEUB 4B3XA 3WLAA 5DTIA 2N1MA 4HGQA 3WQSB 1VL6A 3GP3A 1Q5PA 5KVSA 4E6PA 4G1EB 1OH8A 2WUGA 1KZ7B 2QR3A 3H04A 4US0R 2POCA 1IULA 5EIHA 1Z35A 4JDUA 4DIKA 4RTKA 4FWTA 3L9WA 4YYEA 4ARIA 1USIA 2YVQA 5C7LO 2AI1A 1YB5A 4F8YA 1OH5A 1EQUA 2FX5A 3OFND 2B61A 4LSMA 1L1EA 3FMFA 5CVUA 3TD9A 3OAAA 2BFMA 2HYIC 5B1DA 4OGLA 2FG7C 2Y0EA 1CPYA 3VO9A 3ZBPA 1LPPA 3IULA 1KJZA 3S2GA 2N3ZA 1UDXA 3O90A 4MRMA 4DJEC 5B7QA 1TNDA 4MHOA 5AVOA 4ZVKA 4ZAZA 1WUYA 3UJCA 5K4GA 1MB4A 2O54A 4N40A 4ZKEA 1X87A 2PGXA 1P5JA 1Z0AA 2JH3A 4JLWA 4LNHA 1N9KA 4RZIA 2FEXA 3GNSA 1EXMA 3K1AB 3TLJA 4EO9A 4OUDB 2XZTA 3USES 4CFSA 3JQAD 4B3GA 2GYYA 2IXBA 4Z4FA 3PE3A 2VK8A 4RIGA 3WL3A 5A6SA 1DUVG 3Q9NA 3WBBA 1E77A 1V37A 2A35A 4E2YA 4FR5A 2HA6A 2GCOA 2Y1XA 1T36B 3K0CA 5KOJB 3N0VA 4MVJF 1N4DA 3PFFA 1I1OA 1OYYA 3GBVA 4L07A 2OMEA 3CB2A 5IYZB 1N1DA 1N2SA 1YZQA 2VF4X 4LZPA 5DYIA 5KAPA 2J6IA 3SIWA 4CT5A 2O59A 1YH3A 3T5MA 3UUGA 4DCNA 1E1LA 1XZCA 3OCUA 1JMKC 3P97A 4O59O 1J07A 2JHAA 2Z1NA 3WLJA 3MFQA 4F2DA 3NP7A 4KPEC 3RM3A 1N2GA 3OQJA 2QG4A 2Q7OE 3ZJ5A 4Q15A 4NECA 1Z5GA 3RDPA 2ERXA 2X1MA 1Y3DE 3JYHA 4BZQA 4OHKA 4DAEA 3UHPA 1USGA 3ZV5A 2I6FA 3RSLA 4YQYA 4KFSA 3ZE2B 4QU0A 1GVHA 1P8AA 3U81A 4Y7DA 4EI2A 3KR1A 1B8NA 5FTNA 1W48A 2X0KA 3QF7A 5E9JA 3LLVA 4ZOCA 4EG7A 1ITZA 3KWJA 3TBFA 2ZIAA 3DSRA 4ZEMA 3ZE7A 1SU8A 2A1TS 3BSWA 4Y67A 1PYOA 4PY2A 3T61A 3QE9Y 2NNLD 1VG1A 3QLEA 3KEOA 4J76A 3DB2A 2B8JA 2YV1A 3O9VA 4LNUA 4LOKA 5HQ3B 1MG5A 3HWRA 2HBYA 1IZ8A 2Y1LA 2D3TA 2OUIA 3NJ4A 1ZZGA 1C0IA 2FQQA 2FSFA 3QK7A 4ND4A 1VMIA 2C5FA 1SGWA 3INGA 3PC4A 1UAYA 1U8EA 5AIAA 4I6GA 3TQIA 3UJ8A 4AS1A 4IAOA 4XJVA 4KYUA 5DHUA 3ZX5A 4DQVA 5EJ8A 5I9MA 4IV5A 2HO5A 1RWOA 2ETVA 4P3XA 1YZGA 3A25A 1DT3A 2XMQA 3HDJA 1L5FA 4XXHA 4BJHB 4DCUA 2FWPA 3K9QO 3DUFA 1U0LA 4LDZA 3FCOA 3KE9A 4Y6RA 4LY3A 3DZCA 4CLHA 1JMVA 2CNNA 2CWDA 2UZAA 1C8BA 4KKXB 2NUPB 4ZDWA 1X2BA 1B16A 3ZGXA 4HI0E 3NO4A 1FNSA 4OHFA 1ZSYA 2CD7A 1QH0A 1NJ5A 1I1QB 3OC0A 3NC1C 5FWYA 2P30A 5DLQC 5T8KA 1LB1B 4B32A 3OT1A 4G85A 1Y81A 1UJBA 3KT8A 1V8PA 2C9YA 1KAHA 3QYPA 4UXIA 1YBHA 4CGYA 2VDOB 3BL8A 4H6XA 3T9BA 1IAVA 2D0PB 4MWCA 2PSDA 3FMGA 2B1JA 3WXBA 5I7WA 1TCUA 3DOFA 1HETA 4O2AF 3QKUA 5GIOE 2IH2A 2BJVA 3OY7A 1GYRA 3LCJA 4NV3A 1ZYUA 2AVNA 4BJ5A 1MPXA 2PE5A 1I01A 1RPNA 4G1BA 3X2EA 3QVKA 4NFYA 4P92A 2WHYA 3OQVA 1E9FA 3QITA 4PSAA 5JFGA 3L4JA 3K70C 1GZ5A 1QTNA 2WTXA 3C3XA 1W88B 3DE0X 4YCCA 3SSOA 5EOVA 3SJAA 5ITVA 2C59A 4REOA 3T5GA 3V4OA 3K4HA 5A4AA 3BREA 3RTAA 5FV4A 1MZVA 1PDWA 3E81A 1AC5A 1J2TA 3GA5A 4LC9A 2QLFA 1ISJA 1VMEA 4MUEA 2Z0MA 1DEXA 1MABA 4R16A 1A96A 2WF7A 3WRWA 4D26A 3G49A 1O3YA 1KIAA 2BMJA 4AICA 4MYHA 1WG8A 5KTNA 2W58A 3NUQA 2IEBA 3L0ZA 4MRNA 3BKXA 1FNDA 1YNOA 2P2SA 4GPAA 3FMOB 1ZCBA 2V6BA 2FPPA 4UREA 4UTXA 1WCV1 2YUTA 1YQ9A 1ZQ9A 3HJUA 4DG8A 4ZK6A 3N7UA 5KHLB 1B8VA 1H9BA 3EXFB 4R2WA 4H4CA 4CM8B 3RFCA 4MV8A 4ZCRA 2IYWA 1RLMA 4ISBA 4K8RB 4E13A 4F4UA 2R8OA 4IIJB 4RPLA 4NX2A 1Z8NA 3BKWA 1PS8A 1F6DA 3FUUA 4XGNA 2FPIA 1ECBA 2QMYA 4QXPA 3WSTA 2GJ8A 3F6SA 3EX7C 3QM1A 2GAFA 4RZUA 3UMVA 2PGDA 1FRZA 1DVRA 1L8AA 2H1VA 1XA4A 3QY0A 4QPCA 4F5WA 2OGUA 4B8YA 2WV7A 1OROA 4LY9A 3U60B 3ED1A 2H29A 1YBFA 3CG0A 3ZDFA 4BO0A 3KOMA 5IKXA 3I61A 2BFDB 5ALFA 4KXXA 3UJ9A 2WIKA 1L7AA 1UDWA 1EX6A 2OO5A 3V4SA 3WWDA 4HWSA 1GCGA 5LYJF 4DDTA 4MUXA 3BX1A 2XUJA 1TVMA 4JNKA 1G7RA 3FNQA 3RIXA 1RADA 3H5OA 2I3AA 4MUIA 2OBFA 3P0RA 3IAEA 4F8EA 4LC1A 4ZOEA 1KO7A 4EFDA 1YR6A 5CNKA 1WV0A 1ZCJA 2X5JO 4LRUA 5NULA 1URPA 3OF3A 4DAOA 1U5BB 2B2CA 2DWCA 3R6WA 5ALZA 2AUNA 2A1UA 3VSAA 1B4DA 3T9DA 1OH6A 3AUJB 4ND5A 2VDLB 2DLCX 3FTCA 1NY5A 1QOZA 2UYQA 2C3PA 1E2EA 4ZT5A 1LLCA 4WASA 3ZIDA 3GLHE 3LO8A 4BO2A 1U3DA 1XKXA 4G2TA 3UMFA 4AQDA 2VI5A 3TL3A 3CM0A 1MIOA 1H69A 1OI3A 2PEYA 3BPSA 1JU4A 1FSSA 3MB5A 4RY8A 3QELB 4ZZ3A 4F9FA 4EKYA 5IAGA 5BNZA 4MW2A 5AK6A 3CNHA 5HSGA 1VBKA 3OLQA 4XKJA 1EUCB 1F0PA 3GV0A 3WV5A 3R5FA 1Q84A 5U4XA 1Q7BA 1CY8A 4XARA 4YP0A 2N9UA 2UDPA 5H81A 5KZMB 1VIMA 3OE5A 4PLWA 4FOPA 1IEWA 4JBXA 1VJCA 3I1FA 4FOSA 2JKZA 3I32A 1SVUA 2ZSKA 3NEJA 4TKVB 1AM4D 4ZARA 4B3HA 1VG0B 3QHAA 1VKNA 4ZRDA 3B3AA 2BDEA 4AD8A 3EUAA 5IX8A 2PU5A 3R7AA 4TTVA 4CF5A 1TPZA 2ZT8A 1ODSA 2DH5A 1PGJA 3LCUA 1G3MA 5K3FB 3WGZA 2XMSA 4ZTBA 1M2WA 3E9YA 5JS2A 4AZSA 3HXQA 2NMVA 1ZFNA 7ABPA 3NKVA 1EDEA 1EE1A 1X7ZA 2PZBA 3AOGA 1JDVA 1RMQA 2ZWPA 3OKFA 5K1ZA 3WGKA 1SKUA 1SQ5A 2D59A 3EZ9A 2ZXFA 2QI9C 1M5TA 2Y68A 4H59A 1FX0B 2OBBA 2YIJA 1DCTA 3RQIA 4CQJA 3TLXA 3KTDA 4BGUA 4QUJA 5JWOA 1QM5A 1VB5A 2PT5A 2RH8A 2V7TA 1E32A 1M73E 1BSVA 1JJFA 2ACEA 3RHSA 1WMBA 3SR0A 3VR5H 2IP1A 4C7MA 3WLMA 5K0BA 5D86A 1UBHS 1NQVA 4CHGA 4MCHA 1HGXA 1E3WA 1FJ2A 3Q7IA 4YGYA 3WK9A 4LCEA 1JYFA 1Z34A 1XNQB 4MKRA 3ECAA 3JQAA 1P0IA 1T8PA 3PC3A 4K05A 3IUBA 4OQXA 5CW1A 3M34A 4YRQA 5DGHA 1F6WA 4G9GA 3VZSA 2RCNA 3ZJVA 3CLSC 5ENVA 1UZAA 2CHQA 3K1ZA 4HVTA 1A72A 1C3LA 2YZNA 3AI1A 1UXIA 3PLNA 5B4UA 2CMGA 2ECQA 3L8CA 1JBEA 1FSGA 4JZYA 2HY7A 3WNQA 4JVOA 1A7UA 3R3JA 3CNLA 4MPRA 3W05A 1Q0SA 4B4KA 4MS4B 2E48A 2WAAA 4HNAA 2JFQA 4M0KA 4V2UA 2X5NA 1YFJA 1UJ5A 5GP1A 3CVOA 3CXUA 3LC1O 3R0JA 3JQFC 2I4LA 2Z2ZA 1YJCA 5AJTA 3N2EA 4C4OA 3O92A 4LF4B 4J03A 1Z08A 2QQEA 3MQ4A 4ZVOA 1R0SA 1Z28A 1ZW1A 2FZVA 3EYAA 1ZDMA 4UHKA 2R7NA 3EA0A 1H9CA 1JFFA 5JD6A 3E53A 4FWIB 1JJVA 3D2LA 4NIMA 3IEIA 4Y0NA 3O6VA 4HEHA 1ZL2A 1S4QA 4MI1A 1QSGA 4INAA 5JPIA 4BWVA 5KQLA 3WQHA 3EUFA 4Q93A 3RLFA 3E5NA 3A6LA 2DSNA 3TTXA 4DMMA 5JRDS 3H19A 4W8OA 3TR5A 2IEGA 3K2EA 4AFNA 2YZGA 3SVZA 1WLSA 4J8PA 2O52A 2HXYA 4WLNA 4HQOA 3RSQA 3T38A 3WZMA 1NZDA 1JPUA 1OZGA 3KDSE 4P08A 2Z6VA 2ECOA 4P7KA 2WHRA 3CNEA 5DE3A 3B70A 5GAJA 4Q1VA 1BROA 2WJIA 2P1RA 3S7ZA 1OIVA 2WFLB 3KB6A 2ZM5A 4E51A 3PFNA 4NBLA 1DC8A 3SS8A 1SBNE 2F59A 5L6LB 3L7MA 4BX9A 4JU9A 3TEJA 1XE3A 4KIGA 3JZMA 2CJXA 3R41A 4YR7A 1OXTA 1YZVA 2FWAA 4OB7A 5E8RA 4AIIA 4W5RA 4CKBA 4IJVA 3DTTA 4GL4A 1UPFA 3E9MA 1QMPA 3ANYB 2YXBA 2FGKA 3VO8A 3PQCA 3QXGA 1IN1A 1KETA 4NHEA 1T5TA 1XZBA 4GX5A 2FU5C 4C20A 2QSZA 4V03A 3HBAA 1G4HA 1J9EA 3D4PA 1Z13A 3GJTA 2NAPA 2V6GA 2Q5HA 4H1VA 1AQUA 4NBNA 3ZYZA 3L7CA 5EZYA 1CR6A 1FMLA 2QNBA 3ZN2A 3C3WA 1XVIA 1R2QA 1UMBA 5GZ6A 1G9SA 1ULHA 2VJLA 3MNFA 6REQB 2AFRA 3MJRA 4ZJZA 1L8QA 1R00A 4CNQA 5M04A 3M5PA 4HYYA 1SCAA 4N39A 2BCGY 4ZO4A 4HMOA 1QWOA 1X1QA 5K3EA 3MS4A 3DMRA 4EHKA 2H4FA 2CEAA 2YMLA 2PJUA 3VR4H 4BLTA 3THXB 2YFHA 1YR3A 5FBRB 3V80A 3OLWA 1VMAA 3D2BA 1XPOA 2C82A 1H2XA 4JLKA 4TL9A 1TJ5A 1S9HA 3N8KA 4JJKA 4QDJA 4AWAA 1RABA 2VQEB 5IULC 2WJWA 3EZLA 1P61B 4ZVLA 1N5MA 2PYZA 4P38A 4BFVA 2AN1A 4DSNA 2VLBA 1PD1A 4N12A 1CFZA 2X1VA 5C8DA 2VCYA 4RJIA 5GPBA 1YQEA 2YXEA 1SIWA 3G79A 4FD3A 2BOVA 4MQ6A 3M33A 1MB3A 4X1KB 5D5HA 1EFTA 1EJ2A 2YHBA 2CVQA 3AZPA 1IWBB 3ZGYA 3ZNPA 2BISA 2IYXA 4DLRA 4B33A 4CXMA 4GWKA 4X9XA 4AUNA 3HNOA 3JTEA 2P90A 2Y71A 3SIRA 3AXTA 3V8BA 3NWBA 1B3RA 2MR6A 2XA9A 3ANNA 1C7FA 4JI6B 4EQ6B 1Y98A 4WKOA 3QKSB 3CW2A 3MRTA 4JI5B 5AXBA 4UUNA 1RRVA 1KR5A 3P7MA 2E2WA 1G5FA 5CT4A 2C5GA 4WZAA 3D0OA 5BN5B 5LP6C 3T0FA 1W36D 3FKSD 3ULKA 1OW3B 1QLJA 2RE8A 5BSGA 4MZDA 2WP0A 4YCAA 1T1EA 3G7SA 2B20A 5CA1A 2BGWA 2OORA 3CRVA 3TLZA 4NJMB 4N3NA 3IBTA 4PWZA 4J3JA 1GPWB 3S2YA 3FIJA 3TQQA 1CQPA 5GV8A 4QQRA 4LHYA 4H1HA 4KIUA 5EWLB 1M74A 2WU1A 1EWYA 1M2KA 3MCTA 5DYNA 2NUTA 4BXOA 1D2CA 3OA0A 4QYWA 4F4DA 4ID3A 2JIDA 1F20A 3WDKA 1QGED 3AUAA 4S12A 2C7VA 4BB5A 4FYXA 4RQAA 3WLLA 3OC6A 1PQ4A 1G60A 2PXXA 5DTRA 5C1BA 2R6DA 1U9ZA 1XEXB 4B3JA 2B30A 2YOFA 3A37A 4EAQA 1KI7A 3ROXA 4IIJF 3KB1A 1V7QA 4CIDA 2WJZB 3WGHA 1YVUA 1OWMA 4K8OA 1Q3HA 1Z0IA 2H54A 1FRNA 5IBCA 2PUFA 2XYQA 2O14A 3BWBA 1EBFA 5CD1A 5IRCD 3P52A 4X90A 2GB4A 1AD2A 4XVQA 2YZKA 1JQJC 2DHCA 1DEKA 1X0XA 4EAAA 4B3MB 1KK2A 3FPKA 2IUYA 1A9YA 2DUUA 4TTQA 5CFRA 4NH0A 5JZBA 1XDBA 5HS4A 1Y3HA 1E1QD 3K8ZA 5EWMB 4B3IA 3RKUA 5DX1A 2HTFA 3U56A 1O95C 2QHXA 5F23A 5LNK1 2QM7A 4J0KA 5E7QA 1CJSA 2FFRA 3W78A 3NJRA 1AGYA 4NMMA 2VYVA 5CXUA 3VKVA 4ARUA 2C98A 3KTAB 1AH2A 4ER3A 3CIOA 5BNTA 2HLDA 3SCZA 4L4RA 1P45A 5FOTA 1BEZA 1JVSA 2VRNA 2XMCA 3GRFA 3KXPA 4N7BA 4PM4A 5AVQA 1Q1ZA 2P67A 2QD1A 3M9XA 4BFCA 1YRQA 3P9RA 4CF7A 3FG9A 5HJ5A 4FCCA 1Y8CA 2G63A 1O97D 2VRBA 1QIJA 1T4DA 2E0IA 4OY3A 4PLHA 4W9NA 3RS2A 3W6NA 4B79A 4WERA 4F2HA 2J87A 4E4TA 2CY0A 5CG2A 2IHNA 3ZK7A 1FDIA 1SVWA 2B5VA 1R0RE 2GK6A 5DHAA 1MX9A 3I37X 5I9LA 2OAP1 4B81A 2CLLB 5JVDF 4W9MC 4GRDA 1LV7A 2M1ZA 2Z5LA 1XOIA 4RD3A 4CFZA 1Z2AA 3PGMA 2O50A 1IHUA 2QX9A 2RKOA 3FAKA 3KSZO 2RBKA 3GL9A 1ODFA 5FBQB 4LV8B 1I14A 1T5OA 1RHRA 1XTBA 2ZJZA 3TWOA 5DX0A 5FAKA 2IDKA 2H4ZA 1J0AA 3E70C 2V74B 5AM4A 3EFHA 4PAOA 2QT0A 4M22A 3TE6A 1RWQA 1G55A 2I5PO 1NMQA 1O6CA 4AJEA 4CDNA 1T35A 4TV8B 1M7GA 4YRLA 1O4VA 4QUGA 3TOVA 2J0QA 3IAXA 2FPUA 1MNQA 1YKGA 1ZH4A 4RZHA 1DKQA 3UK0A 4ZZ0A 1E9BA 1VZ2A 1Y1QA 3QOXA 1KEKA 1YRWA 4R8MA 1KEPA 3CRNA 4HQRA 4Y1EA 2EBWA 2AXEA 5F7OA 2BTOA 4QDTA 3QX3A 2CYBA 3QU4A 3FNIA 5JSZB 4OQDA 3D6VA 1BDMA 2BJWA 1SBYA 2I33A 3LCMA 4Q4DA 4U2DA 4D4HA 1M0EA 2DUNA 1TF7A 3KQTA 2AEMA 3O8LA 4P3OA 4F5EA 4B76A 2WIDA 3EWIA 3ELWA 3SBEA 2C5LA 3AV0B 2YNMC 3RSCA 1PJLA 5DGTA 2PL9A 5B3JA 1SK9A 5KYWA 3SHVA 3MWDA 4PLPA 4EP1A 5A5EA 3EGVA 5KI6A 4Z4GA 1AKRA 1UWCA 5DN9A 3MYRA 1PLLA 3IA2A 3MIZA 3TD6A 5EY5B 3F47A 2QM8A 3NGLA 4RFSB 4WGFA 2VUIB 4AN0A 3QX8A 4MEAA 4QM6A 4CCWA 4NFHA 2A84A 2VOEA 2X8JA 4ZYUA 1J99A 3MJTA 4A0RA 4CMHA 4Z9YA 4YWJA 4QEZA 3A1CA 5BSEA 1G2QA 5JJLA 1NE2A 4HP8A 3DULA 4ODIA 2X15A 2R96A 3GG2A 3K5HA 4FDTA 2IYVA 4G5SA 4QYMA 1XTRA 1U1DA 1QVZA 4AJJA 1SVLA 2PT7A 4MQUA 1LI5A 1ODKA 5JD3A 3GRYA 5LU8A 1BH2A 1JLSA 1TZ2A 1U1FA 4CMEC 1P2DA 3W5UA 2P6RA 3B1YA 1GSIA 2JLQA 4PYOA 2F7SA 4GGMX 5F1OA 1K3FA 3GFFA 5I4BA 1DDIA 3ZVMA 5IS2A 4OATA 3JQ8B 5IVKA 1WCYA 5ERGB 4N47A 4PTZA 3LVQE 5HJ7A 3BE6A 4Z1MA 2ZRLA 2UU9B 1K6XA 5TV2A 2J5XA 1E58A 1XTVA 5E3IA 3L82B 3GROA 3TRFA 1JJAA 2ATVA 5IT5A 5ALEA 3SNKA 5CCBA 3NNSA 1CYEA 4P2BA 5FWAA 1Q0TA 1SKYE 2HHLA 3L05A 1OC4A 1SXJD 5D3QA 1VL2A 4PX2A 4L95C 3AI2A 1B15A 2EJWA 1PZFA 5FPHA 3FGZA 2W83A 2DSTA 5LZ7A 1XELA 4KG7A 1WDWB 3I6ZA 2P5SA 4DGSA 2XQFA 3VYUB 1EP9A 2GAOA 4LC0A 1QQTA 4HAOA 4C7OA 2JB9A 3C5HA 3OFVA 5C4IA 4WY2A 2Q3JA 2YMPA 3CZPA 5EHGA 5TJHA 3RREA 3RVDA 3VO1A 4E2WA 3AM1A 4PRZA 1AKUA 5MN6A 2MHCA 2WF5A 4PIPA 4DE5A 1D7AA 3AO0B 3LT0A 1HE5A 2GEUA 1YJXA 3REOA 1Y4ZA 3ZWPA 4D9IA 2YHSA 4MCIA 3HA5A 4MRMB 2VXBA 4RL4A 4YASA 3E0QA 1C7ZA 1CDOA 3ABOB 3ZJYA 3ZNOA 5G3ZA 1F8YA 1Y1RA 1E7QA 4E0BA 4YCSA 1LRJA 1AIPA 1CIVA 2PRKA 4RF4A 3AVTA 4IMIB 1CZLA 3BULA 1QE3A 3CMMA 3KX2A 4P83A 2G9VA 3E3LA 3GEHA 4QPPA 5A6SB 2BM1A 2CUNA 1DUSA 3E23A 2VH5R 3QJ5A 1CY0A 2GCOB 3DQPA 4LI0A 4ZQIA 4BFYA 5CXQA 1XZNA 3DDZX 4N7RA 1W75A 2CLSA 1PYGA 2EFJA 3B7PA 4P5EA 5I4KA 5FFMA 2QRUA 2XITA 2PZGA 1VRWA 1AKMA 3UUFA 2DHQA 3SC6A 2HWXA 1TYEB 1MAAA 3AJEA 3CF4A 3QU9A 2C4TA 7MDHA 4MIYA 2Z9BA 1TZJA 3IAM1 3RASA 5IT4A 4KR3A 1D1SA 5IYZF 2Z6AA 1O94D 5LB4A 3LOUA 3U9LA 2WWXA 2GZ2A 1JQEA 4I5IA 4CETA 4JLBA 5C32A 1Z68A 1KDYA 3G1WA 4HSEA 4FINA 3WNZA 2DPYA 3CF0A 1LZKA 2AJ8A 4UHCA 4NVRA 5HBGA 3I04A 1MJFA 2ZUTA 3HM9A 2JLYA 2R9VA 2JD1A 4FDAA 4Q9AA 3WLHA 4YVFA 2DFPA 4V0MA 3P19A 4BNGA 1PFQA 1WABA 2P2CA 2OHFA 4BMVA 5GJBA 1G18A 3KQVA 2RHWA 1XALA 2A5YB 3DR3A 3CLSD 1XXLA 3FPJA 3NTXA 3Q2IA 1AHNA 4TT8A 3S2IA 4A91A 1K2WA 1N33B 1TIBA 4QDOA 1NVGA 1ENPA 1ZK3A 4DV4B 1E4EB 4J0HA 3QPAA 3OBIA 4K1LA 5TXGA 1WSDA 3UK1A 3ZDDA 3B1XA 2WJVA 2OYSA 1RXCA 1NLUA 3T15A 3MOIA 1TTPB 4X7MA 4XSGA 1NI4A 3ZTTA 1H8HD 1NXQA 3FKSA 4D4KA 5CFZA 2XCTB 2XRFA 1LF0A 2HMYB 1K8RA 2ZT6A 4HB3A 3HZZA 5C8YF 4YS6A 2MSDB 2ZI6A 1THMA 3FPLA 2XBMA 1GG8A 2G7ZA 2EHJA 5F78A 4PRYA 2J07A 4XPIA 2FMTA 3DUFB 3KUDA 1E4OA 1SY7A 2C04A 1L1QA 2C2BA 3DEIA 1RZRD 1XU7A 2WJJA 1EJ0A 2IKQA 5B5SA 5DM60 1K7SN 1O6FA 5DZSA 3FBGA 1YAHA 2BFCA 3W9YA 2HRBA 5CAEB 3KQOA 3LXUX 4DY4A 3TG2A 4B3BA 1T9GR 4R9RA 4CMAA 3F7MA 5FWYB 3OE7D 4PZUA 2OHJA 4MYCA 3WYBA 1YONA 3M70A 3OT1B 5EHXA 4QXRA 1ZRNA 4LS3A 3GGSA 1D6MA 4FYKA 4Y2JA 4WCFC 1JSXA 4B82A 1V0JA 5CB8A 1N25A 1UIRA 3AVYA 1KNXA 2XKJE 3DVAA 4ZRMA 2VWHA 3BRWA 1I13A 1BE8A 1P75A 4JYBA 4RD2A 3SR3A 4DXDA 4KHZA 3BXZA 3PUKA 5BUCA 2ZWIA 1T2DA 1IHDA 1SBZA 3IBGA 3PDUA 1OLUA 4HLUA 1TAHA 2IQ5A 1CRZA 1YASA 3FR8A 4GQBA 4CLRA 2PHZA 2JKYA 1PHRA 1BXRA 5A6VA 1R8JA 4EG0A 2NU9A 2E4YA 5G4KB 1KC1A 2COEA 2VCEA 4EMSA 3PFGA 1FQWA 1L8XA 1CJKC 2HK7A 1YI8A 1LA2A 4KFRA 3LHKA 3PHBE 1UEXC 2C2XA 2SBTA 3OX3A 4MLDA 3WDLA 3HCOA 3UWKA 4DYDA 1XO1A 3Q98A 1MABB 2H0RA 2XUGA 3EIXA 3L7KA 2RGNC 5TDHA 3K2BA 4ITRC 1HUQA 1A2BA 3ZWVA 4AKSA 4I50A 1G5TA 1T8RA 2HCFA 3KD2A 2O20A 1EYZA 5AM0A 3U09A 1R4MA 2RHGB 5IZCA 1TCCA 2FPPB 4BQEA 4HDKB 4LXQA 2XYVA 3TIXB 3DCNA 4U9IS 5DBFA 3K6KA 2R8YA 5AM2A 2QTRA 1FLAA 3NYIA 3QJGA 4UTZA 4D3YA 1AS2A 1A50B 4C29A 1TM7E 2RB4A 5FTJA 4B31A 4ZN6A 2CN1A 4R2JA 1KAMA 3UV6A 4EF5A 1ILEA 2NO4A 3MWGA 2YC4C 1ZRMA 3NFRA 2W9XA 4H0CA 2FPIB 1C8LA 3O7WA 4G5FA 4IDDA 5EMNA 1EX1A 4B6SA 2OM2A 1Q7TA 3BGWA 3PUZA 4TLLB 4EH1A 4ZDJA 1GITA 3TNDA 4HWGA 3EDMA 1YT5A 2D5LA 1EINA 2FUNB 2YHAA 2X9GA 4B3RB 3T4XA 4L4UA 2F3PA 1CF4A 1G64A 4JOSA 4ZYTA 4DLWA 1Y89A 1BQ4A 3RAJA 1H05A 1LK5A 3NDJA 4V0OA 5FPPA 4D45A 1S2LA 3GEGA 1E5QA 2NO5A 4YRGA 2ZJBA 2FFJA 4NNJA 3FSGD 2QENA 1YBMA 3FJOA 1XCGB 1TM5E 4JOBA 1JX6A 1H3NA 4Z0NA 4HK4A 4WLEA 3HJGA 3PPWA 3RWBA 4CT4B 3L4BA 4D0RA 4XW2A 4F21A 3R8CA 1ZJJA 2C7BA 5BSVA 3A7DA 4JCCA 2A94A 2A1UB 3EEIA 3VH2A 1KU0A 1UXOA 3P71T 4UEQA 4OYHA 3RGGA 3I6IA 4IWXA 3R3HA 4PHGA 1UCFA 4H0FA 1J5PA 4EL0A 1RMTA 3OZEA 2O2CA 2C2ZA 3VDNB 4BP9A 5AKHA 1J21A 1KSJA 1L7DA 1WTCA 1PR1A 2GPAA 2PANA 2VAMA 1WZEA 1VE9A 5KWIA 3THYA 4W7IA 5FBLB 3VZPA 3BH6A 4J29A 3Q5GA 1Y3CE 2Q4RA 3IALA 4EFKA 4OA5A 1NW3A 2V8BA 2QLBA 2EW8A 4HWOA 1MB2A 5TLSA 2QTLA 4Y18A 2PNJA 2ZJFA 3C6QA 1RKBA 4KO8A 3TLAA 1FTYA 1QQ5A 5L3RA 1MFPA 3BERA 1ZMOA 1VDMA 2D1TA 2PX0A 4LFBB 1XQ9A 1FJHA 1CY7A 4J2TA 4OYYA 2BGTA 1EDDA 2G4CA 4FGSA 1LCIA 1E5XA 2JIQA 4B4DA 4URVR 3HHPA 1OX6A 4GT1A 1KS9A 4IVNA 4L22A 1E61A 3DWEX 3HCRA 1SXJA 2V7XA 5DXFA 4JB3A 3VPDA 5JZOA 5H80A 1LU9A 2C42A 5CR9A 2JLAA 3FNBA 2GPTA 4Q34A 1M2FA 2G40A 3S5JA 2B8EA 3VU8A 4I81A 2C9CA 2WVAA 2YUIA 3DE1X 4QJ5A 5B3AA 4FCTA 1X7ZB 4P1ZA 1ZCFA 2QM3A 3CT6A 3PRKE 2ODTX 2FW8A 3CLVA 1O95D 1Y7PA 1VE3A 1KK0A 3IVRA 4MV3A 1Y3FE 3TIFA 4IGKA 1B0UA 1E2KA 3HKEA 4FT2A 2ZJ1A 3GT4A 3F8TA 3AVOA 3QE2A 2XB6A 4HGYA 1S8OA 4KSCA 5EMKA 1DX4A 4M1ZA 3GLKA 4R54A 3KD3A 4ADSG 3QOWA 3L6RA 4LY0A 4CKZA 2BJHA 4WOPA 3R6DA 1NVAA 1V6SA 2BY4A 5C1DA 5I9IA 4YBZA 3UEOA 3U4QA 2XQJA 1FEZA 5ENDA 4E88A 1E9DA 1E3WB 2FDRA 1QH9A 2YXNA 3B12A 4J2OA 2XNSA 3N0RA 1W0KA 3R3ZA 2YFKA 3N5KA 1COWD 4LJKA 3VI3B 3U61B 3JQAB 2QYTA 4TX1A 1XCPA 1T34A 4I1SA 3FDZA 3LTEA 1F9EA 3EXHA 3L4SO 2PUTA 3LUJA 4BB0A 4YRCA 4NDNE 1OBHA 4OQYA 3COWA 2HK9A 4F56A 2YV5A 5GOTA 1QG0A 3VPAA 1J2YA 2JAUA 2IE0A 2WWTA 1VG8A 4G4SO 1SQFA 2FPMA 2JG3A 1JKMA 2CLMB 2SICE 4HNAB 4RACA 5IAOA 2QMQA 4A6PA 4F04A 4LNAA 3H5RA 2FZ4A 1O96A 5JROA 4LKRA 4AY4A 1D1TA 4GR5A 3MM4A 1Z36A 2CKDA 4LGYA 3QBJA 3HP7A 5GONF 3U7QA 3C87A 1O94A 1Z5UA 2XXJA 2BSAA 3DTNA 1M9NA 3QLVA 5LU9A 4F11A 1JFFB 3AESA 2FW9A 4DCMA 3MZ0A 5JC1A 1A2KC 1F2TA 4R0MA 1AKYA 4IP0A 1WE2A 1PEAA 2D5IA 1GPAA 2V9ZA 2XUAA 4WFKA 1SG6A 3S99A 4IDNA 1IUKA 1Z73A 2CNOA 3OJOA 1N5KA 2E4XA 2YNMD 4XCXA 3TLCA 2A5LA 3FYHA 2ZJ3A 3SSMA 2PKCA 4W1QA 3DEKA 4BHTA 1ZM4A 1HFEL 1ZGBA 2Q27A 4E32A 3PXCX 1S6YA 4AB1A 4I4NA 5K6AA 4DV5B 4IIDA 1DB3A 1K0UA 2FJPA 4BUZA 3O94A 2H11A 5KDLA 2XYGA 1VCOA 1CY2A 1S3GA 1GZ6A 4H35A 4R31A 4YAJA 5C8VA 5LZ4A 1DCFA 1KQFA 1E1YA 3M3HA 1CF9A 5JSQA 4Q16A 1GTRA 1HE2A 2PO7A 2B78A 1H8HA 4Z49A 5ICGA 4YT5A 3PC8C 2V45A 4WLOA 4OL9A 5DHFA 4FU0A 4LF6B 3T0GA 1MAUA 5TGDA 3MJ4A 3ZY5A 4IMRA 3ICWA 4JR0A 1S4MA 4XZ3A 5L9AA 4J4HA 1DHTA 1Q7CA 1XK6A 4D8VA 1UP4A 1YHZA 3ORQA 4D25A 3C3BA 3F4KA 2W6MA 4B1FA 1Q11A 2EFCB 4CKBB 1RZRA 4EUKA 4ALIA 3UTCA 3BD8A 1T9HA 2BAGA 3D6HA 4K7JA 3AG6A 3ZZ0A 2OESA 3KL2A 3GFTA 3GPBA 1C0KA 3C43A 2H59A 1A8HA 3I62A 5K8UA 5EZYB 1M2GA 1XZPA 1MFZA 2GO1A 2ZPAA 1UMBB 5EKDA 3IVAA 1E62A 1F5SA 3W1WA 3RODA 4FNAA 3BHMA 5CM9C 1DIHA 1NVXQ 3L8YA 5E8JA 4HVCA 1Y8ZA 3A0UA 3G17A 2FH5B 3PUVA 2Y9MB 4LX0A 4ZOBA 1HZZC 3H4TA 2AWNA 1NI5A 2QJWA 4I3HA 4AO7A 5GZ1A 1E3IA 2CBXA 3DXYA 4ZEVA 2WU8A 3L6OO 1A8QA 1WCIA 3DHYA 4XFJA 2Y8EA 1QFSA 1ZSVA 1CKEA 1ZK0A 2PFKA 1YCGA 3LQ2A 3IR7A 3QBVA 1KMIY 5TT0A 2XAUA 4DA9A 5L53A 1RMYA 1KXJA 2D1RA 4FE7A 4BLQA 1L5QA 3OCWA 4PQRA 1I3MA 5BSWA 3IPRA 1H6BA 2XBLA 4M49A 4DJDC 2F1KA 1H2FA 3RUPA 2E5WA 2OECA 3B6ZA 3IO3A 1YDEA 5L45A 1BGWA 4OG2A 3RVRA 2WWVD 2EWVA 1EDZA 1PFWA 3OZCA 4IFEA 1NRJB 2Q6TA 2VUHB 3L5OA 4HN2A 4HXEB 4X85A 5IT9A 4ZIRA 1RBQA 3OP4A 3C3AA 1GR0A 3FPAA 1CY6A 4PNHA 1VYHA 4GYWA 3K9GA 1ADJA 1TXGA 5IEBA 3WWZA 1PF7E 2G9QA 2AZDA 4RV9A 4ZHQA 2VNAA 3CKLA 1BXKA 2R7KA 1ECPA 3BXPA 3OIVA 1XCBA 4CKCB 3LKVA 4WZAB 4HAXA 4FOLA 2QAGC 5I9SA 2EGGA 3R7SA 3WYAA 3H6GA 3I2KA 4QHSA 4KLCA 3VHRA 4X3OA 2HFKA 2V5UA 1H4SA 4L7QA 1RYZA 1YMQA 2BGNA 5CA1B 2XUDA 3WZLA 2J08A 2X8BA 3KVVA 5KIAA 5LDDC 2W2TA 3EQZA 4EW1A 3AK4A 3WLNA 1LDMA 3T5TA 3KK0A 4HKTA 4CLOA 5ALVA 3OU7A 2NUTB 3DBLB 3H5TA 4UPDA 5K0TA 4BXOB 4FGZA 1PWZA 2YJZA 4G56A 4RKRA 1GCAA 1VJTA 4EA7A 4KO1S 4JJAA 4Q4CA 1Y9AA 2JS7A 2PLRA 1XTIA 2ZWOA 5AW4A 5F9HA 3NMUF 2ORWA 3ANLA 4I66A 4KO3S 4M1EA 1N5DA 2BKEA 3FF1A 2Q3DA 5T6MA 4DMUB 4LPKA 1LTHR 4CKXA 5ULLA 4Q9JA 1CEQA 1YU9A 5LMZA 2BUBA 3CSSA 1VGQA 3FSGA 5AJYA 1W2GA 2OD2A 2TMGA 3V42A 1E9SA 3T1VA 3WL7A 4BO7A 4WHMA 3VMMA 4GECA 1Q91A 4FJ0A 4RMGA 4COOA 2RFLA 3I0ZA 5JCZA 1EWTA 1NRIA 3PU6A 3CR7A 1S89A 3H6KA 4O3FA 4MUKA 1Z0UA 4W6QA 1BVYF 2GJSA 1NQ5A 5FX2A 4C4XA 2J5KA 3DZJA 3ANSA 5CYOA 4DJFC 1GEGA 2VHVA 3JATA 4EX7A 3G02A 3IB6A 4YJ2A 1NUTA 1I32A 4TWAA 1XNHA 2B3DA 1Z18A 1PRYA 3VTAA 1NU8A 1SD2A 1ZVJA 1N6RA 1XRMA 4JWKA 1E2HA 4H7KA 5H82A 1L7RA 1Q21A 3PIIA 2PZJA 4MWZA 1N6NA 3UICA 1AVTA 1I6LA 1V41E 3C41J 2P40A 1B6SA 3O1IC 5JCJA 3O4IA 3EZYA 3RS8A 3TDNA 3PI6A 2BE7A 4Y2XA 3ES9A 4BFUA 4KQXA 1NDHA 3HCFA 2GN6A 1VJDA 2JHFA 1P3JA 3FVVA 4PAWA 4ME6A 1QAQA 4DEXA 1M2OA 4BNTA 1AV7A 4D92A 2FQXA 4HXYA 3COYA 2BC9A 5HRUA 3U3DA 5E1DA 1KY4A 2ZS9A 4KVGA 2F9MA 4J9UE 2UYCA 2GQ0A 2IF2A 2D5AA 3TVDA 4D8YA 3L43A 2IBTA 4L8WB 1K4MA 1GSOA 2R11A 1W94A 5JQGA 4BMOB 3OKCA 3E1SA 2R6GA 1LSJA 3JQ9A 2JFWA 1N78A 3OZTA 5BV8A 1WZNA 3QW4B 4EW2A 3JYOA 2XQIA 2PSJA 2D5BA 4ER7A 3AY0A 1EGVB 1HC7A 2XSZD 1E2BA 3MJCA 2B2XA 2QJRA 3F5FA 4FZ5A 2V3WA 3KLNA 3QI7A 4K9LA 2ADOA 3PKJA 5JCOC 5J2TF 3PDJA 3A2KA 2VUUA 4GMGA 2ENUA 4WOJA 2PS9A 4RTLA 3C6KA 4ZWNA 3GIDA 3EK2A 3BGOS 3U17A 4IIGA 3SGLA 1V9LA 2FEKA 5F3DA 4BTEA 1BFKA 1OTXA 5C1PA 2W2NA 1U0BB 4M46A 3KV3O 1TD9A 1LLUA 4TUYB 5KYWB 4JP8A 1MW8X 3MWDB 3C16C 2XZLA 3NJ8A 1I3LA 3PQFA 5JFTA 4GE0A 3P1JA 4B44A 2Q8QA 2H0AA 3HU5A 1NPTO 5DBHX 1UBLS 4PANA 1W9HA 2XMBA 4GQAA 3QI2A 3VNVA 2OHHA 3RSGA 2VTDA 1V4BA 3IEXA 4H2DA 1YQTA 1WP9A 2H1IA 2X8JB 3WGVA 5BV0A 4RO0A 4U8HA 3LGAA 3WAGA 3N28A 4B34A 4BL5A 3JVIA 1YS6A 4DCGA 2C4UA 1JSRA 4LIPD 3QQPA 2CLEB 4JT8A 2WTUA 2QTZA 4B7XA 2ZUSA 5T4EA 4MTCA 1XCOA 4N03A 1KFBB 1JHUA 4MJXA 5ALKA 1E7SA 3T3OA 3E8SA 2MYUA 3FPGA 4D2IA 1ZW6A 3DO6A 5ADHA 4AMVA 3PR3A 3HMKA 3JQ7A 1ZLYA 2G9RA 1WCXA 3MWKA 3AF0A 4QDZA 4IQFA 4R7ZA 5E0KB 5EKTA 3HYTA 2D54A 1LZLA 3M9WA 4HCJA 4MS3A 2WZDA 1G7TA 4Q6BA 1Z83A 1R3UA 3VDQA 1NW5A 3F9CA 3LUAA 2I4MA 1QIFA 3AI3A 3ZVLA 4BO9A 2BL4A 3CVYA 5IXYA 3NOXA 1KVSA 2H31A 4A10A 2F48A 2C9BA 5IWCA 1UH5A 2Q6KA 1RXVA 3DMPA 1CR1A 2H4WA 2HJRA 4GM4A 2DBVO 3MERA 5C34B 3R8XA 3TLMA 5CFNA 5E1MA 2PH3A 3TMYA 2MYNA 1GAXA 1HLGA 1JR3D 1TF2A 2AG0A 2QRKA 2W90A 3NONA 3TGWA 3PXAA 4XDHA 1SCBA 2O5VA 2VXOA 2VTEA 4UDYX 3V00A 4B84A 5J43A 4C7OB 2QNRA 5BSRA 2ZBEA 5FR2A 2WSYB 3NPMA 1T3TA 5EFZA 3I09A 5ER6A 1C0EA 5FPYA 3WLFA 1PDOA 4ARZA 2D7DA 3TSZA 2AVDA 4M0PA 2I0FA 3FTPA 3ADPA 5CJPA 4BMCA 1V71A 4R2IA 3CEHA 1BQ3A 3TOCA 1RXUA 1HT3A 4GKVA 2JAWA 4LCBA 4DOMA 1SU7A 3RJTA 1YDGA 3L0YA 2PVSA 3R0ZA 4QGHA 2GZ1A 4E6EA 5I9NA 5JZMA 1JR6A 4UNNA 3VZRA 2IEAA 4BKRA 3SD7A 4GVPA 3TCXB 5F35A 1KGSA 1F3OA 4HNHA 1ZGCA 2CXPA 2XT9A 1NNEA 1XN1A 5BUSA 2V54A 5KNLA 1XAJA 3FPSA 5LJIA 4GLBA 4RSRA 4Y1GA 2C94A 4EG6A 3V7WA 5MF6A 4NXNB 1K68A 3QKWA 4OP3A 1DXYA 1U3GA 1GA6A 4I55F 2AOVA 4J94A 1K4YA 2K6GA 2E4ZA 4C4ZA 3MYYA 4EJSA 1LPOA 3VAAA 4GI5A 1E18A 4OU5A 3MQ2A 5HE9A 3RV3A 2ZRCA 3H97A 1KH2A 4WNCA 4OREX 4RENA 3ZBUA 4CLDA 4DEVA 3HYLA 4MUYA 3ECSA 2HV8A 4K88A 2FDXA 1TT7A 1Y3BE 4FYMA 2XJ9A 4DQKA 5KQPA 4HNVA 2CVOA 1ZINA 3CBGA 2ACWA 3N6VA 3PNBA 4QD3A 4OLHA 5DTEA 1YMUA 4Y1FA 2J0UA 4DPMA 1KI4A 1PU2A 4B2LA 3JTMA 4ZYVA 3O3OB 1XRSB 4NCIA 1XX6A 2QY6A 2ZS8A 1T5SA 4YUVA 3AL0C 1ZZEA 2ZYTX 3RWOA 1AXEA 3VYVA 1JAHA 1VA5A 2HEIA 3TSCA 4F6CA 4OFXA 5B64A 2XHEA 4DC0A 3WO0A 1HQYE 1PAUA 4FMPA 4UEJA 1KI9A 4IDEA 4KGDA 2YJ6A 3BOSA 3Q9UA 2BHTA 3RT1A 4D74A 5GZ3A 1KVRA 3IPCA 1HNZB 2UVPA 4MUMA 5FRDA 5AI4A 2HHHB 1CDEA 1K5GA 1NJFA 1WMDA 4JODA 4C30A 1NI4B 1W36B 1J8VA 1OILA 3P2EA 3M5CA 4LWPA 1TTQB 2OCXA 3D6FA 4EWLA 1FK8A 1RI4A 1X7GA 3LRXA 4Y98A 3QU5A 5EPUA 3ZK8A 1GCIA 2VZLA 4XPIB 1WL8A 5LD2C 1Z8FA 2ODAA 1K8ZB 1STOA 4WZAE 2WM3A 3WG9A 3BCSA 1KTVA 1SC1A 1X8KA 1YQUA 3SDSA 4CMCA 4JI8B 4PW0A 3MRSA 2BFCB 5CIQA 2ST1A 5EIBD 1VCIA 2VDUE 2RARA 2VP3A 4MWGA 3JQDA 3RVPA 5IWAB 4KDCA 4AF7A 3DKPA 4CM6A 1E6UA 1Q1BA 1PCXA 2HH9A 3KEGA 4TMYA 4YRBA 2RGBA 3AJDA 3DL7A 3HYSA 4R51A 4UUAA 2RHBA 5AD1A 1ZHOA 4KK3A 1RDFA 5JADA 4HFRA 1SCDA 3AHJA 3COJA 3BJRA 3DVAB 2FSIA 3ENKA 3LOQA 4IDHA 3T95A 2DFVA 1U4OA 2IP2A 1DIOB 3H2YA 2W6JD 3LLMA 4LXTA 3T06B 4F93B 7MHTA 1NVDA 1UJ4A 2F8MA 2DCUA 2PMCA 1FVHA 2GM5A 2XTMA 4FZ3A 1OLUB 4UMEA 1SUFA 3I6MA 4KK4A 4U5XA 2E18A 2UYGA 5FBHA 4CLRB 3ZU5A 2J0VA 1BXRB 3DG9A 4RQUA 2W2OA 2NU9B 2D5CA 2Q5LA 1KO1A 4EHAA 1K89A 2Z5VA 3QX7A 3R3SA 5BVGB 5DBIA 3PCXA 2M32A 3USZA 2B98A 1KJYA 4JS0A 4HLDA 5I7RA 4D98A 1UWLA 3OJEA 3JR7A 1YSCA 1OFUA 3TGLA 3II6X 3FMPB 4LHSA 4YLGA 2X23A 2EYUA 4TKZA 5AJZA 1L4FA 3C45A 3IELA 4BNZA 1M1XB 2FOIA 1JG6A 3LQFA 5EAIA 2VDKB 3OX1A 4JUAA 3U7EB 3GNQA 2VT7A 4I50B 5EE0A 2ZP1A 3NIFB 4GR9A 1W44A 1R4MB 4PG6A 4YHHB 2QTAA 1B0AA 4DM4A 5ADUS 4ND1A 2VATA 1NSFA 3LC7O 1TUEA 5K0JA 1PTKA 1P9OA 1ZM3A 3C0KA 4NV0A 3TNJA 4K9OA 5HM8A 1MCZA 5HIMA 3HDVA 4KSBA 2JCYA 1NVUQ 2ZOSA 3QPDA 2B6HA 3NHFA 3C3DA 4PIVA 1NV9A 3E9QA 2X86A 3EEFA 4AECA 5B1IA 2RBGA 3AUKA 3D2CA 2OFPA 3QFRA 1K6MA 2P9BA 1DWUA 3EMBA 4OYLA 2UVQA 2VP6A 1X8JA 4MRRA 4R1NA 3AHEA 3CO0S 3DDSA 2YHIA 1QZTA 2ASEA 5DMXA 3SJCA 1I51A 1R4AA 3BCRA 4PEVA 2PKRA 4WZBE 3UAVA 4B3FX 1F8UA 1XEFA 4V0SA 1O8CA 2EKZA 3SBDA 2FUG6 1J70A 1I8TA 4HAZA 2AKYA 3GOHA 1P0PA 2QR5A 3HXPA 1BMQA 1Z2OX 4EBBA 4F9EA 3PQ8A 4AQYB 1ISIA 2OCKA 2HXSA 2LE0A 2BUAA 3VPBA 5DYYA 3I5YA 3P27A 4FZJA 4I1OA 3O3CA 1U8CB 1HLPA 5HZMA 4H7PA 1EFCA 5KJFA 4KXWA 1KPHA 1RWPA 1V7PC 2P9JA 3CE9A 4NRDA 5SY6A 3DL0A 4CQMD 4ZKDA 2ASVA 2Q2VA 3QLTA 4UVDA 3FZNA 3LS2A 3PSAA 4TLBA 4UMFA 3G8YA 4TUYF 3RVLA 3WLPA 4KAFA 3TJRA 2WF6A 3ONNA 3QOFA 1U98A 1NTRA 3KR9A 4DANA 2EKPA 1H0HA 4ILEA 4D6PA 5K7SA 1WW3A 1DIRA 3EGCA 4DLBA 4FM9A 3L07A 2H06A 4PAQA 3THYB 1ODIA 2X13A 3M1AA 3F6PA 2Y0CA 3HKDA 4DS3A 4YLYA 4CCYA 2HBRA 4BB9A 3PNOA 1QONA 1SFRA 3HYNA 4MO2A 4BE7B 3CA8A 2O4CA 5LWHA 5A05A 5DWDA 2OV8A 4ZK2A 4LJ5A 2ODPA 5KYVA 4G8CA 3X0DA 4PO1A 4XM2A 2DULA 4O02B 3I58A 3H9UA 4BAUA 4Z1OA 3A4LA 1EB9A 1GLNA 4G0NA 1WY5A 3E9ZA 1JA9A 3EDCA 3HKBA 5E9AA 5IKMA 3DXXA 1OV4A 3O2NA 1WW8A 1G5HA 2ZK7A 1NR5A 3HJFA 1U4NA 1VLJA 1SXJB 5EZSA 2WYHA 3T1QA 1E6KA 1QK3A 2C2YA 3WICA 3AH8A 1F7UA 1E6MA 3G2KA 1TQ8A 1QYXA 4OP1A 1JR3A 1XROA 4XQEA 4BO6A 1UM9A 4P4TA 2R8PA 4IIHA 4XQ0A 1T6YA 3I8XA 1V7ZA 5C51B 2DMRA 2XW6A 4FBMA 3HKEB 4KGXA 2W8ZA 3GUVA 2VHTA 1Z2CA 2ODBA 2PXAA 4O8ZA 4GIBA 1DAEA 2CUTA 4K6GA 3KIPA 3DV2A 4HEA6 4ETWA 4UVEA 1JQKA 5BQPA 4U0KA 3FGOA 4IKEA 3U4MA 2LR0A 1Z74A 4MWTA 3U4QB 3QYFA 2HRQA 5DHQA 1S7CA 3UBMA 1XMQB 2E37A 5ALXA 3PT9A 5EXSA 2I9PA 4FYWA 4M0EA 3TIVA 3Q3GE 1Q16A 4AROA 5HGXA 2WP8J 3B7GA 3AEKA 1XPRA 1ZVQA 3WL8A 1TQ2A 2CHFA 2NXEA 3FDZB 3EXHB 4P93A 5K0LA 3TYXA 1HYHA 1BA3A 4ENQA 4IHAA 1EVQA 1MG0A 2GEDA 2YWRA 1U5CA 2P5TB 4COKA 2Q2QA 2WQ6A 3V4RA 2QTWB 2PV0A 1Y1SA 1DUIA 3IHLA 1ZK2A 3O84A 4D97A 1UFRA 1ZOPA 2G5TA 1MOQA 1FZQA 4U4AA 5J3JA 4PYRA 4YJ3F 3NHAA 1R50A 3KSUA 4P6VF 1WMSA 5LQDA 1QPZA 2NQ8A 3MTGA 3URKA 4N0DA 4E2ZA 3D0RA 5KVQA 1KKLA 1ZH2A 3U7QB 1FYWA 4ZAYA 4ZCSA 4MKHA 2QYOA 4M76B 4QIHA 4LJ7A 2OOSA 1ANKA 3AESB 1VYVA 1ZGGA 5JS7A 2X2FA 3D3WA 4OKSA 2C7OA 1QGZA 4FVTA 3DMDA 1II9A 4OGGA 5DNDA 1F2TB 2ZSJA 2NZXA 3ZHSA 1HOXA 1QNFA 1W1IA 1VL8A 3ETEA 3OZIA 4PPNA 2ZDQA 2QW8A 1TUIA 4PC3A 4Y6GB 3HK2A 3G5LA 4QOGA 5EE5B 1SC9A 3B52X 1RYHA 4H77A 4C6RA 2ODNA 4S05A 2RK3A 2SNIE 3S3TA 1HDYA 1R16A 4CM1A 4DNXA 3HCCA 1AX9A 3TJZA 3SZ3A 3ZZTA 2AQIA 4IJQA 3VYRB 2FLVA 4FQ7A 2BBWA 2E6KA 3O3MB 3OICA 5IAJA 3EIWA 4V0ME 4AJ9A 3KQHA 1ZJWA 5B6PA 1BIFA 2AFVA 2G17A 4BU0A 5ER9A 3QTTA 2WEKA 2Q4BA 2C78A 1I5EA 1ZH8A 3SZRA 1VHWA 3MLAA 4WKCA 3H1FA 2CMHA 2BD0A 1BD3A 2XE6A 5F21A 1PFKA 3EXEA 3KEFA 1PVOA 1U7TA 4DA6A 3ESYA 2AQKA 3A11A 3RV4A 1OZFA 5U1PA 3ROKA 2PLWA 4FC7A 1PUIA 5DPMA 4MDFA 3JAKA 3D8HA 3KPVA 2R62A 2PX6A 1HO3A 4QU9A 5M34A 2FPRA 4ZI5A 4EFMA 4P35A 2CFOA 5TSDA 4UUMA 2JGMA 4NV1A 2PPVA 4Y2VA 5K2OA 5IN4A 3RTDA 2RJ3A 4OHBA 4ENRA 1N6LA 1SCNE 5IXSA 1KE2A 1ZK1A 3ZG6A 2ATEA 1YRYE 4GOLD 2FYTA 1EVZA 1OXSC 3DW1X 2YKGA 1EGAA 1SZPA 3ZWMA 2ZRBA 4BN0A 2X4DA 1DRKA 1A7AA 2ZJ5A 4WDQA 1QB7A 5DTQA 4CTMA 3FI0A 3OQNA 3VTFA 5I5EA 2FZEA 3H8JA 4GLJA 3W6OA 1XTZA 1DADA 1AUVA 4TL8A 2PV7A 3SMQA 4JDPA 3OETA 4OU4A 3E3OA 1P1RA 1L5NA 1WCIB 1KA9H 2VYQA 1HY3A 4P54A 2WE7A 1T9GS 1XXHA 3HVRA 2QX8A 1HM5A 3DBHA 2FR8A 4RPKA 3P20A 3BQMB 3IBSA 5LPNA 5LA6F 1RWXA 1HDCA 2FE4A 5FEMA 3CV3A 1SRRA 1RLIA 3F74A 1EP3B 3ZWQA 3KFLA 1JHYA 1VL0A 2A9JA 2BCJQ 2AR0A 2ONKA 3QWHA 4Q3CA 3BEDA 1MTOA 2DKOA 3ADKA 3WDMA 1B00A 3ENQA 3GT0A 1HDGO 4Q9KA 2QBYA 2PL1A 2PA0A 1TVCA 1W30A 2FSHA 3NHYA 5BWNA 3E7DA 4ZIRB 5FDFA 1QZXA 1G3RA 4Q7JB 1HZJA 1Y9JA 1FYFA 3K0FA 3W2EA 5KNDH 5ILOA 2GXQA 4XD7D 1VI5A 2V5VA 1PV2A 1RAGA 2GJAA 1JPJA 1L5LA 4ZYYA 4LRSB 2E55A 3ONEA 3PCRB 5AW8A 4M55A 4ZHQB 1BE6A 1DKMA 1LPAB 2Q3MA 3L6UA 4FFRA 4N6NA 5KYXA 1GQFA 1EUDA 1M8FA 4TSKA 4XTRA 4DJTA 5LVAA 3HV0A 4X66B 3ORHA 3QP9A 1K8YB 4WNAA 2GN0A 3KKKA 1PR4A 3MN1A 13PKA 4XJXA 4KQCA 3WIUA 1IWPB 2VHUA 2J7KA 1ZL0A 3BE5A 1A4IA 1NJGA 1FJGB 2YV3A 3MT8A 1EVIA 2PT9A 3VU1A 4QOFA 5KPDA 3WRYA 4B6QA 5ESXA 1U2TA 2OY0A 3ER6A 5SYNA 1HE8B 2EVWX 2NSDA 2Y66A 1G66A 2ORYA 4J49A 4RJJA 3VTZA 1US8A 3HLKA 4CLOB 1WETA 2PL3A 1A9OA 1H0KA 1VKZA 3IDSA 3ILVA 4TV9A 5IUNC 5EQFA 2WVGA 4XVCA 2JLVA 3QKIA 1OFGA 2ABWA 4K0RA 1NDUA 3A7EA 1TF5A 5KPJA 2XTAA 1ACMA 3GLTA 5C35A 1E2GA 1N2JA 1ORDA 4UZFA 3TRIA 4BNKA 2OL4A 3FUXA 1NNSA 4HWPA 1IATA 1R5NA 2RH4A 4CLXA 2KJQA 3R7WA 5MN5A 1ETUA 4IRXA 3WWEA 1GU1A 3W4KA 2JFZA 3NHRA 3UCFA 1MX3A 3FOWA 1NE7A 3SQMA 2H1OA 1XIVA 3ELUA 2HPAA 1ZI8A 2QM0A 2W2KA 3D6UA 3ZDQA 3VFDA 4IOLA 1Y5NA 4K2AA 3C1TA 3EAFA 4Q21A 1PP4A 1OAOA 2Z1DA 2D4HA 4JKOA 1T1SA 4C0BA 4CVNA 3JATB 4YJ2B 4OKIA 1BVRA 3ZGNA 4DV0B 4XASA 5KJ6A 1YZHA 2UUCB 4HGOA 4HLNA 1V8OA 1RWMA 1IPHA 4BGVA 1GGMA 4QNRA 2I03A 5JECA 2IXTA 4AS3A 2LCQA 2O7VA 4BWYA 4O2RA 5JWRA 1Z82A 1Z62A 3NIDB 3TPFA 3S6JA 3X3HA 1ZOOA 1FXUA 5CX1A 2WW8A 4XR4A 4BKOA 2UZ1A 2PUDA 2EJCA 2OGWA 3ZE0B 3AB8A 2I1WA 3VVBA 4CIXA 2IYSA 1LJUA 1XJQA 2GA8A 3OMLA 1CZRA 1YUNA 5CHEA 4ESVA 1WR8A 1QHGA 3OOEA 2O07A 1ZX1A 2IY7A 4MQMA 4U3JA 3UHAA 3WJ2A 3F96A 5ED4A 4QELA 2JK1A 1NP3A 1ID1A 3VMFA 1BGXT 1HBJA 1HOTA 1X80A 4GZMA 4TS9A 4OJKA 3OM8A 3W34A 3ZS9A 1UT8A 1V4NA 4JZKA 4PSDA 4CI9A 4B3SB 1IZZA 1M54A 1TOAA 2HHCA 2JEOA 3CYFA 4H1TA 4IHQA 4L1KA 3TI7A 3VU3A 5JQGB 4UC0A 5IH3A 3FN4A 4IGAA 5KOHA 4WV3A 5JU6A 3L1VA 4X7BA 2IV3A 3FBTA 3S40A 2CHGA 3JZDA 1QE0A 1JIVA 4FSDA 3PG5A 2QP3A 4I1IA 2R2AA 1GRVA 1H5NA 1XDDA 3B13B 4P3PA 2IE8A 4Q9IA 2PQ0A 1KNQA 1AS3A 4OK6A 5LZ5A 4UE6A 3GPCA 3UPUA 3I4CA 1SXJE 2HBZA 1ZD1A 3QV1A 1FTWA 5C2JB 2VDNB 1NX6A 3C3MA 4UXHA 1SC4A 3OZDA 3R76A 4PZLA 2Z2XA 1JXOA 4MUFA 1KEEA 3P2KA 1E2IA 2E6UX 4P7GA 4QUIA 3LDHA 3QWAA 3BA1A 5CJJA 3NOVA 3E2MA 4GW3A 4NTZA 1DC7A 2OG2A 3K0AA 3A4VA 2B36A 4I3FA 3FIUA 4X20A 5K6TA 1DQZA 5AVVA 3G3EA 1Z6XA 1IJEA 3CH4B 3GQBA 4ZI2A 1QIMA 2GM4A 2WYIA 3FNFA 3HZHA 3W8NA 1F14A 2G3YA 3D0KA 2B4RO 3KXLA 4EGQA 5JNVA 3RUEA 1CNMA 1LSUA 4KV9A 1DV1A 1DU4A 2GETA 2I4NA 4OCZA 5J4HA 4F06A 3ESQA 5A5GA 5J4KA 1ONSA 4Q4AA 1T2FA 1N2EA 2X6TA 3AJRA 4FYHA 3HG7A 5HW0A 3L0PA 3SU8A 3TW8B 2VTVA 3QBEA 3H1EA 1J90A 2FY8A 2IU4A 4FNOA 4IOMA 1SD5A 1T0BA 2V7EA 4B3CA 1A69A 1HF3A 4BX0A 1JIJA 1YD7A 3M0EA 2YY6A 5FA6A 2AMYA 4P2GA 1AO0A 3HTXA 1Z56C 2A5FA 2B9VA 3G9UA 3JQ7B 3K9LA 4L8YA 1NSTA 5JANA 1PR3A 3OEYA 4DWVA 3ZWDA 6Q21A 1N3YA 2O2YA 4QTTB 4MS3B 1JIUA 3CUKA 9GPBA 2GJKA 1TU4A 1ID8A 3BYZA 4MEJA 2FP4A 2WYVA 4R5HA 4ZALA 4NHOA 1OVGA 1ONNA 1RACA 1T2UA 4JR2A 3A4NA 3W8EA 4NU8X 1OFHA 4W9RA 2NSJA 3LZ6A 1QYCA 3FYSA 4CV3A 5BVGA 4PZAA 4MWDA 3UKDA 1BNCA 1G0NA 2NO6A 2QIPA 1N0HA 5HNKA 3PZRA 3W0LB 1XNGA 3WA7A 1NVFA 1XL1A 2O5CA 3HACA 4XI9A 4MVWA 3T0IA 1GFSA 2AD5A 5G0VA 1FSPA 3O3NB 3SAJA 4QGGA 3AOEC 3OPVA 1YI1A 1H23A 4HX9A 1ULAA 4X7PA 3V9PA 4DLZA 3QENA 1F7VA 4BPRA 2ZR7A 1E63A 3EQ9A 3I4LA 1OT3A 4JC5A 2Q0XA 4RKFA 2I87A 3VH3A 3CX8A 4ARZB 4XX1A 5F9MA 4EI8A 1GA4A 5ICMA 2Q2NA 1V3UA 4G01B 1PKEA 5KTKA 2JVJA 4CBVA 4F7WA 2YL2A 3WADA 2C8JA 5FTLA 3ZGVA 1EFRD 4MYDA 3FBWA 3WKAA 2Q1UA 5EP1A 5CJ2A 5G0SA 3OLXA 4W1SA 1OWOA 5DI3A 1FB5A 2DQSA 4TYYA 2C3OA 2Z2JA 1UT5A 1IONA 1PJ2A 1FU4A 3QVTA 3UMYA 4LE1A 4BGIA 3LP6A 3OJLA 5J59A 4BQRA 4LJ6A 3VR6D 4G1FA 1TK9A 3OPNA 4NXMB 3HJCA 4TS3A 3WWPA 3O4FA 2AOTA 1OAKA 2VNSA 3O38A 3GVXA 4FEYA 3O8NA 1LBQA 3GLFA 4MYUA 1PR2A 2HMWA 4NCJA 5KNBD 4EJSB 1SOVA 2PU7A 3NGXA 2H65A 3IAS6 4MGHA 4DCOA 3D6JA 4XQCA 5FOWA 2RGAA 3MILA 3KLMX 4Q37A 2QN6A 3LW7A 3ZU6A 1WZCA 2X6QA 3AHDA 4XLTA 3ORSA 4HFJA 5EEGA 2SKEA 3ESAA 4INOA 4DCCA 1P2GA 1YL5A 1VMDA 2PR7A 3RF6A 3SFZA 5GJVC