1KSRA

The repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
100
structure length
100
Chain Sequence
b'ADPEKSYAEGPGLDGGECFQPSKFKIHAVDPDGVHRTDGGDGFVVTIEGPAPVDPVMVDNGDGTYDVEFEPKEAGDYVINLTLDGDNVNGFPKTVTVKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GELATION FACTOR
publication title The repeating segments of the F-actin cross-linking gelation factor (ABP-120) have an immunoglobulin-like fold.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin binding protein
total genus 9
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1997-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ksrA00
4J12A 2NY5H 1N3NB 1XCQA 3B2VL 2CUHA 3DPBA 3SKMB 1UVQA 3T0BA 3F6LA 5SWQA 3BKCH 2ZUSA 3AAZA 2NYYD 2X4QB 4I3GA 4RFNB 5FOJA 3GMNA 4QNPF 2IPTH 2BVYA 4XPAH 2RIKA 4YXKL 3RTQC 4R3SA 1IAKA 2A0LC 3H3BC 3STLB 1TQCB 1WBZB 2DQJL 3ILQD 1S9YB 4P2QB 4X5WB 2ZG3A 1N8ZA 4KK9D 5GRZA 2DF3A 4L4VA 5DR5L 3W39A 4EN3A 1I1AA 2AQ1A 4X6CF 1RZKL 1LVEA 2VXUH 4OZFG 1XGRB 2WUCH 1J8HD 3PDOA 4N0FB 1BZQK 2P24B 3LCYA 4CDGC 1JPSH 3FT3B 3OQ3B 4TQEH 5LQBH 3REWA 3V4VL 3RWFB 3WIIH 1NANI 2VZTA 3DUUA 3VA6A 4PRNA 4L5FH 3CPLA 4XT1C 5FYKE 1P7KB 3QIUB 4CN6A 1EXUA 2MWCA 3C9NB 4OZHA 5EZIH 3BDYL 4JKWA 1DVFB 4KGLA 5L6YL 2PXYA 4YBQC 1NGWA 4NKOA 5IV2A 5E6IC 3AREA 5EU6A 3EHBD 5CEZE 4K3DL 3VGHA 2DQHH 4J2XA 1T1WA 3BPCB 3MRBA 2FJHB 3VGDA 3CX5K 4LCUB 4UMGA 3DVGB 5CCKH 3O8XD 3RUGA 3T3PF 2N1KA 5D2LE 5E00A 4OZGA 3O3UN 3C2AL 4H5SB 3SY0B 4CVZA 5C0GB 3PQYE 3LSOA 3RY6A 4MNQA 1T3FB 1T0NB 4ZPVB 4M5YL 1P5VA 3RVVC 4RBPH 2P5EE 3MJ8A 4QRPB 1PZ5A 2C1OB 2EDXA 1QLEH 1L6XA 3SCMA 3SPVA 2HMIC 4FP8L 2D7TL 1I9RL 4HPYH 3TIEA 1OP5H 1MCPL 5IB5A 5F70A 4K8RH 3MOAH 2Q3AA 4NO2A 1OQOA 4M61A 3UPRB 1KT2B 5DSCB 4P46C 1RQ5A 5IB2B 1Q9LA 4O2FB 1U36A 2EDEA 4HF5H 2PTTB 2EKJA 4JB9H 3WNOA 1JGUH 1DQLL 3TBSB 5ID1B 5HPMB 3KS0H 1BBJA 3ET9F 1R0AH 4XPHL 2AJSH 2LABA 5JORB 5DT1H 5IIEB 4OQTL 1ZT7A 3I9GL 3PV6B 5HBBA 1EAPB 3F62A 3TYGL 5E94B 3EYQC 1I8LA 1FV1A 2BXZA 3OAYH 4LKXB 1FZJA 1LK2A 4M48L 1DUYA 4ETQA 3CGTA 4KPHH 5FA3A 3GB7A 4JGJA 3EOTL 3HNSL 5KSUB 5E24E 3H9SA 4AJ0A 1UJ3B 5C8JA 1JYWA 1ZEAH 3PGDA 4AENB 2XWTA 1E4XH 4YHOL 3DX8B 3T3ME 1T2JA 2GJZA 3PWNB 1OAKH 4NQEA 3I6GB 2IPKA 2J8UB 4L4VE 1HKLL 1FJ1A 2QHRH 3BJLA 3K2UH 4JFEB 3L5WA 1NKOA 4LRNH 4XPTH 4WY7L 2FO4B 1BJ1J 1FBIH 1B90A 3WHE0 5LGKA 2EO9A 3T1FA 4LPXA 3ZDXF 3U4BL 4OSUH 4ODXA 2GCYA 3VXPB 3QQ4B 2EDWA 4L3AA 5T3ZE 3JZ7A 4P57B 4L9LA 4TPRH 3F65A 4PJEF 2A6JB 2BC4B 3VI3E 5C70A 2HJFB 4HWBA 1E27B 2YKLH 2D03H 3IJHB 3NPZB 4BQ8A 4MNGB 4OZHE 5FCSH 5J12B 1KIUA 1SVCP 4I18B 3O9WB 4Q74A 4UNVA 4M8QA 4MGXA 1K2DA 4ZUVA 2L4OA 1E4WH 3QAZC 5I15L 4R90L 4YDJA 2JIXA 4RSVA 1JMZA 2BHYA 3LB6D 1A4JB 1BZ9A 1RULH 5DK3A 4D9LL 3JVGC 4L8DA 1SEBA 2B7DT 4LSDA 1N3NA 4Z7NF 1Z0NA 1KCLA 4OZGE 1NDMB 5EZOH 1YEJH 1TQBC 3J7HA 1G0YR 3N0PB 2X4QA 4KVNH 4MNQE 2NXYD 4NZTH 2EIBA 1MCKA 4TSBH 5A2KH 2E5EA 4LL9A 4CRPA 5D8JL 3STLA 1WBZA 2XTJE 4HBCH 1MQKL 1S9YA 4TULH 4X5WA 5D2NC 3SOBH 1P4BH 2JJTC 3QP3A 3RGHA 4MA8L 1CLYL 1XGRA 3UTTD 4JFZL 4N0FA 4XHJD 5CP7B 1TTGA 1DLFH 2P24A 1F8TH 1C7TA 3L3KB 4EOWL 5IFHL 3VMPA 3FT3A 1S7RA 2R4SH 3DRQB 5ECJE 4CJ1A 4DWHA 1HNGA 5JQHC 5C0JA 1X5AA 3FOLB 3RWFA 1EGJH 3ARVA 3TO4C 1D5BB 2HKHH 2UUDH 1P7KA 2B5IC 3QIUA 2AEWA 2P42B 3DX7B 3C9NA 3PGFH 3SDAD 4EZMA 5JMRA 2JB5L 1DVFA 1LO0H 3ARFC 5F1NB 3ULVF 4NFBA 3TYFB 4KC3B 1DBMH 1CGXA 2F8OA 1HHGB 2DIAA 3BPCA 3H9SE 3RBGA 4I0PD 4PS4L 4KUZL 2CKBA 2GY5A 2VL5B 3MRQB 4LCUA 2C3XA 2YMXH 1IM3B 3DVGA 1L7TL 2DLHA 4JO1L 5GHWL 3QIBB 4D2NA 1NAMB 3QCVH 1BJ1H 3ZKQD 2H26B 4H5SA 3EO9L 4JE4B 3SY0A 1A1MB 5C0GA 4C83B 5C0NC 5INDB 3CDYA 4XZUB 1M4KA 1T3FA 1T0NA 4ZPVA 1I9IH 4C57C 4L4TA 4QRPA 3TJHD 1OVZA 2DQTL 2C1OA 2XZQH 5EORH 1HYRC 4IS6B 2FYYB 5F6IC 4MQXC 2OTPA 1NKRA 1FSKC 1SHMA 2NY1B 5KS9F 3UPRA 4WTZA 1KT2A 5DSCA 1TZHB 4F57L 5IB2A 4O2FA 1JYVA 3ZE1E 1X6NA 3KPRA 3E6FB 2PTTA 3U82B 1XR8B 4ZAKD 3TBSA 3AS1A 3WMSA 2I27N 3O0RL 3ULVC 3NCJL 5ID1A 3MYZA 5IESL 1NDGB 3TVMD 4EIGB 5JORA 5KVDL 3R1GL 1RVFL 5IIEA 2Z31D 3PV6A 4K55A 1EAPA 1KACB 3HS0B 5E94A 4U6VH 1CIDA 4WI9A 4LKXA 5K33A 1JVKA 1CZ8L 2J4WL 4S1QH 3QWQB 4QWWD 4BSJA 5I16B 4N5EC 1RU9L 1E6JH 3VFRB 1Q0YH 4KMLB 4LPYA 3U83A 3KPNB 5KSUA 1CXFA 1U8MB 1CLCA 3LKPB 5EFIB 5IVNA 1IGMH 2IJ0C 3IFNH 1NCAL 2ZOKB 4AENA 5LCVH 1X5LA 5A3ID 4Z7OF 1CD0A 3DX8A 4OUOA 4PJ5E 4I4WB 2YWZA 3WCYA 3PWNA 2OXHA 3I6GA 3GSNH 4ZXBD 1NC4B 3T2OA 2J8UA 1IEHA 1MFAL 5F7EL 1S7TA 1EH9A 4JFEA 4FABH 5D72H 4NZRL 4QOKE 3BH9B 5T1DH 3H42L 1HZHH 3X17A 3WFCL 3PE9A 3WFDH 2WQ8A 1UA6H 1ZANL 2VLLB 3I75B 4P3CL 1UM4L 3S37X 1L0YA 1IC5L 4JGMA 1A7OL 4KKAC 1X5JA 2AW2A 3QQ4A 2Q8AH 3VXPA 3CC5B 4LARH 4P57A 2NY3C 4PRBB 1F6FB 2A6JA 2BC4A 2CO7B 5HHMD 1KCRH 2HJFA 3SGDH 3RKDD 1E27A 4B41A 3CAFA 3IJHA 4MNGA 1BIHA 4I18A 3UPCA 3O9WA 3DBXB 3HAEH 5CJOH 1QNZL 2D0GA 5ITBH 5DMGD 1EUTA 1JHTB 1YQVH 4XXCC 2CLRB 1INDL 4PGZA 1RZIB 4XI5C 2GYSA 2DIJA 5ELIA 1VFBB 3LRHA 2D9QB 1A4JA 4OI8A 5CP3A 4XBPB 3OKNB 4Y16D 1ZMYA 3MBXH 4P4KC 3LQAC 4C56B 3MPCA 1NDMA 5IBUB 5DGRA 1BZ7B 4NCC2 4J3SA 3UCRA 3R8QA 4P23B 4GMTH 2FGWH 2VXTL 2ID5A 1TJIH 4K7PH 3S98A 5JIIA 4JN2B 4L4TE 4QRPE 1WAAA 3N85H 4WCYH 2OJEB 1U3HD 3TBYB 4NJ9L 2C5DC 2CGRL 1V7ML 4XWOC 2XZAL 1PLGH 4LASL 4P4RB 5CP7A 3BAEL 3KPRE 4JG0L 2VKXA 5D5MF 3L3KA 1Q94B 3LZFL 5I73C 3VFOB 3DRQA 3BP6B 5DD5L 3FOLA 4JRXB 1CGYA 1D5BA 1KGCD 4PLNC 4QCIB 1OWWA 2BNRD 2Z93B 2MKLC 3QEUB 4HH9B 2EIEA 4WUKH 3DX7A 1K3ZA 3O4LD 3EOBB 4QXUH 1FO0H 1CE1H 5ERWA 4PD4J 4WI3A 4I3RL 4U1KB 4MA1C 1V05A 2EKSB 2YOCA 5F1NA 4QTIH 4D94A 4UOJA 4Z6AT 3TYFA 3DVNB 4ENEC 3HC4L 1HHGA 2G9HB 4TUJA 4JO3L 4JDTH 3CSBA 4PJDE 2VL5A 4KKCD 3W5MA 3MRQA 3JWOC 4CBPA 3BKJH 2E6QA 1IM3A 5L88H 4J3VA 4HLJA 4V2BA 2X42A 3P11H 1NAMA 4KK8D 5DJDB 5DUML 1FNAA 5DHVH 1YEEH 4F8QA 1A1MA 3T0EA 4IEFB 1EEZB 5INDA 4JFEE 4JJHA 5ESVB 4R9HA 4Z7WB 2XZCH 4XZUA 3ARRA 4E5XB 2Q87A 2Q76B 1S7WB 1DCLA 1NMAL 2CXKA 4TYUA 4AQ1B 5CJQH 3RWHB 1G84A 3HI6L 4IS6A 1EHLH 2FYYA 4WO4D 1XGQB 1UYWL 3HAEG 4WFGD 5D1ZB 2FATH 3F6IA 3IT8D 4HUVB 1TZHA 4LGSB 4I13B 5E08L 4FQJH 2DYPB 2V7NB 4MNGE 3E6FA 3QPXL 1XR8A 1UT9A 4HJJH 2G60L 2YUZA 4LCWE 1F6AB 2J6EL 3SO3C 2YUWA 3OAZH 1OSZB 1Y18B 3ARGD 2F58H 1E28B 2IANE 4I9WD 3HS0A 1R3LB 4LSQL 5HHOD 2GJ6B 4W6XB 1RZ8B 3ARYA 1P7QA 3MLXL 3VFRA 1S7QB 4U3CA 3CU7A 4F7TB 3KPNA 1U8MA 3LKPA 4ODVH 5EFIA 1NAKH 4DQOL 2VZ1A 4X6DB 3WLWD 3PHQB 2BVEA 1FAKT 4I4WA 2VDRH 4N0YL 4Y89A 1AXSB 3GK8L 4OM1H 5C7XL 1Q8MA 5H8DA 5HGDB 3NZHL 3BH9A 4J6RH 5LVEA 4LBEB 3OXSB 4GKNB 2AEQH 2VLLA 3I75A 1EJ6A 3VI4E 1SYSB 5FA4A 4P5TA 4QHMA 1G9MC 1WSST 2R0WH 4PTUB 1WT5A 1U91B 1ZK9A 2VTFA 1BVKB 4PRBA 1B4RA 2UWEE 2FH8A 2YK1L 5CD5C 1XT5A 4NHCH 4HIIB 3DBXA 5JZ7D 5JR1H 3W82A 1WK0A 3HI5L 1JHTA 3U4AA 1OAUH 3MLPA 2CLRA 4JY5H 3JBG7 1NC2D 4BELD 1RZIA 5CLWA 3X3FL 1A7NH 4O58H 2LTQC 3K8KA 1VFBA 3BGMB 4JY6B 3KDMB 5J1AA 1EFXB 5ALBL 1R5VB 4Y8DC 4HPOL 2GK0B 4XBPA 3OKNA 1S9KC 5E2WH 5IHZB 2FEEI 4C56A 4WRLA 3AY4C 3A6CL 4RRPG 3T0EE 1BZ7A 1MHCA 3BISA 4P23A 1SBSH 4JO4L 3DWTA 4XMKL 3RVXD 4LMQI 4PLOB 4DVRL 2DTSA 2UY7A 4JN2A 1OAZH 1CL7H 1IEBB 3QQ9C 2IG2L 4YXLH 3K4ZA 2OJEA 4XBEH 4BK4A 1KBGH 3TBYA 1FGNL 5TDPB 3X14B 4ZOEA 3NFNB 1P4IH 3RWCB 4UILL 3FAXA 3B2UC 2BXYA 4P4RA 1MHPL 2ZUQB 4JHWL 1GIGH 3KG5A 5T5NF 3D39B 3ZYZA 4HIXL 1Q94A 5A43C 3VFOA 1B0RB 1PKQB 5GIRB 2YXMA 4ETYA 3S8WA 3L5XL 2MJWA 1V3MA 2AV1B 3GMLB 4S1DD 3ALWA 3QUMB 1KENH 4QCIA 5H37H 5L9DL 2Z93A 3QEUA 3WD5H 3G9AB 4QKXB 5EIIB 1WBXA 1T7YA 4H26A 4HH9A 5EIQA 3EOBA 4GMSH 3QXUA 4U6HB 1HINH 4U1KA 4UDTB 2EKSA 2E8ZA 5KSAC 4OLYH 1GHFH 1AR1D 3DVNA 3ZLQC 3ZMRA 1FYTB 3DJ9A 4KK6D 5E5RB 2G9HA 3QISA 5DJYA 3HC3H 4EVNB 5JA9A 1BECA 5EU5B 3KLHD 4LQ1A 4KVCL 4FQCL 5BV7H 5FV1L 4ORGB 1CI5A 5J1TC 3OXRB 5DJDA 3TZVC 4OCWL 4P59H 2ATKB 1EEZA 5ESVA 4Z7WA 3NFPA 5C0BD 4YFLI 4E5XA 1NGPL 1S7WA 3BPOC 4N8VA 3ULUD 4G6FB 1ZLSH 2E27L 2NY0B 3RWHA 4R2GD 4R7DB 3GMRB 4WI4A 2VDNL 4HKBB 2VZ3A 2XRAL 3CVHL 5E1AB 5D1ZA 4L8CB 1NMBH 1SY6A 5DDHA 4OT1L 3JWDL 2G75B 3BGAA 4U0RB 2QADC 4HEPG 4HUVA 5EA0H 1S5IH 1YEKH 2DYPA 2V7NA 3B9EA 3KJ6H 2BVUA 2E9IA 1ONQB 2JTDA 4POUB 5CEZL 3RNKB 4DFHA 1AY1H 1SBBA 1F6AA 2PYEE 4A6YB 5GZOD 5HY9B 1A6AB 5GRUL 1IILE 1PY9A 3JWNC 4BSWB 1OSZA 1Y18A 1KJ3H 1E28A 3SDCD 3L7EB 4HUUB 1R3LA 2XXCB 3TN0C 5I1GH 1MWAH 4KJQC 2GJ6A 4YWGL 1C5BL 1XGUB 1RZ8A 3TNMB 4C56E 3H3PL 1SJHB 3FO0H 1S7QA 3L5IA 1FVCB 1MCLA 4F7TA 3MYJB 5T3XL 4QO1A 3GSOB 4YDKH 5M7QA 2CH8A 3G08B 4RNRB 3GRWL 3H6JA 1IC7H 4X6DA 4XVUC 5F7MC 1IQWL 3PHQA 3RI5K 3V2AR 4TUKL 3NIFE 5F89B 4PRAB 1AXSA 2FJFB 3B9AA 2VQ1B 4JHZA 5HGDA 2X44D 4Z95L 2HT2C 3QZWB 4PJIB 4L8SC 3EYOB 4R26L 4LBEA 5H37G 3OXSA 4IOSD 4GKNA 4HUMB 3G6JF 1CFTB 5DQ9B 4DN3H 5CZXD 5C6TH 1SYSA 3RL1B 3EJZD 4ZTPL 4WENB 3ZO0A 3QEQB 3EIFA 1QSZA 3GDBA 4PTUA 3VDBA 3T0DA 1UB5B 1U91A 4KMTH 2HKFH 4XXDB 1BVKA 4ODTL 4GXVH 4LSUL 5E6IB 3DV6B 2O61B 4NN5B 2W59A 2W9EL 3KXFD 5GGTL 4KKBC 4HIIA 2NPLX 3WYRA 4P9HH 3IXAB 4LF3B 2EXYD 4K9EC 3BT2H 1HH9B 3UBXG 3T4YB 2JJWA 4LMQE 5I71C 5JXEA 2DN7A 3BGMA 5INCA 3RWJB 3KDMA 3QUZC 1EFXA 1R5VA 3KPQB 3H7LA 2GK0A 4X6CB 1MLCA 3B2VH 2DI9A 2HN7B 3QT2A 2Y7QB 5IHZA 2J2ZA 5MI0C 3KHQA 3QJFB 2C4FU 1E4JA 2R1YB 3UPAA 3HE7B 2A9ML 4GRLD 1Y6NR 4YXKH 5SWSD 2C3VB 2R29H 3WFBL 1IEBA 1YY8B 2ERJC 4YEEA 1KIPB 3ETBF 2DQJH 4RFOL 1T7ZA 5TDPA 3NFNA 4KTEL 5DR5H 3RWCA 1YMMD 3NCYS 1EEUA 1P1ZB 1RZKH 4HXBL 4WI5A 1A21A 2V9QA 1QSFD 5DS8B 1ZLVH 4MDJB 4M9PA 2L7JA 4LSRL 1FRGL 1UCTA 3D39A 4Q2ZB 3D0VB 3V4VH 1B0RA 1PKQA 5GIRA 2AV1A 3GMLA 1A9EB 3N9GL 4CU7A 1CICD 3QUMA 3MV9B 1X5HA 4PLJD 3CDCA 5EIIA 3WS3B 3TP4A 4J3UA 3BDYH 3ILPA 5DJ6B 1H3XA 2X6MA 1ZLUH 2GJ6E 4U6HA 5L6YH 2ZZUT 4Y4FC 4UDTA 5JXAL 3MXWL 3PG2A 4GXUN 4MHHG 5GJTL 4Y5XB 2X4PA 4DOHB 2J8OA 1HSAB 4K3DH 5HYSB 1FYTA 2YPLD 3FO9B 4EVNA 2PW2B 3CH8A 1N4XL 3S3SA 5EU5A 3HNTL 1FG2B 4X6DE 2E7BA 4ORGA 3VRLF 3TT1L 4ZAKB 3ES6B 3OXRA 3C2AH 3H3KA 1UJTA 3PP3K 2EYRB 2ATKA 1U8PB 5JMOC 1OT2A 3TVMB 4M5YH 4RGND 5K93A 3GJEA 4IDLA 5MEPA 1IRAY 4R4BB 4R7DA 4HH8A 4H1LH 4FP8H 4WFHD 2ESVD 2D7TH 1I9RH 4OLZL 4Q58C 4HKBA 4ONOA 1MCPH 5E1AA 4ZSOB 4L8CA 3B8YA 1X6LA 1WIPA 2G75A 2OZ4A 3MLZL 2XA8L 2X09A 2P43B 1WQVT 3MV8D 1GGUA 3QAZB 3SO5A 1AP2B 3TH4T 1PW3A 4PP2B 1F4WL 1ONQA 3VG9C 1DQLH 2R9HC 1VSCA 3RNKA 4LSVL 3SGEI 3TIDB 5IB4B 5L8JB 5ICZB 5HDBE 4XPHH 4ZXBB 5F7LB 4A6YA 4OFVA 4OF6A 5HY9A 5EC1B 4BSWA 4OQTH 3I9GH 5A1AA 3TYGH 4OCSL 2KZWA 4NWTL 1TQBB 1WJ3A 3A6OA 4HUUA 4YC2B 4YDLB 1VEOA 5ID0B 2AS5M 4BKLB 3RVTC 3FONB 2IALB 1XGUA 4M48H 3MLSL 3TNMA 3CLFH 4TSCL 1SJHA 2FBOJ 1FVCA 3EOTH 3HNSH 3MYJA 3GSOA 4PJ7B 1KEGL 1LMKA 5C0CB 5I1LB 3G08A 4RNRA 1A47A 3TA3C 4YHOH 1UZ6E 3C6LC 2B4CC 3HE6D 5F89A 1QBML 4PRAA 1U2CA 1T4KB 5TF0A 2NZ9C 2FJFA 1X5KA 1HKLH 2VQ1A 1K3IA 3BD5A 4HWBL 3B83A 4WY7H 3C87A 3PWUA 3CZFB 5I8EB 3QZWA 4PJIA 5DQJB 5F96L 3EYOA 2QV2A 3NIDF 5KOMC 3OJ2C 1KXQE 5JOFB 4DZ8B 2FX9L 4WFED 1CFTA 3V6ZB 1BF2A 1MLBB 2BSED 5DQ9A 3U4BH 3RL1A 3GNML 4UIKL 3QDAA 3I3DA 1CFNB 3QEQA 2JJVA 5TPWL 3QULB 1UB5A 5IMLB 1BAFL 3LS4L 2Y4SA 4IJ3C 4XXDA 3ARFB 3S36X 5E6IA 3DV6A 3BX7C 4JO2L 2O61A 3D1MC 3HMXA 1RHHB 4GH7B 3QXTA 1LILA 3FQXB 3IXAA 4LF3A 4Y2OA 2KL6A 3FO2B 5I15H 3RVUC 4R90H 1F4XL 1FYTE 4M6NL 2HTLD 1HH9A 1I3RB 3RGVD 3FB6B 3RWJA 2DMBA 4D9LH 1HDMB 3HZYB 3KPQA 3QHTC 3MRRB 4X6CA 1N26A 4IMKA 2HN7A 4Y5VB 5DMKB 4GS7B 5F1KC 4HK3J 3QJFA 1XF4B 1J88A 3DLQR 1ES0B 4MX7B 2R1YA 4PR5B 5I74B 1MRFL 3HE7A 2MCG1 4Q7DA 4RBPK 4CJ0A 2Y06L 1NBZB 4HC1A 2BNRB 1JPGB 5D8JH 1I7ZB 1YY8A 5KZCD 2MKWA 1KIPA 1MQKH 1F00I 1J7VR 3TCXA 4XC3L 2YXFA 4YIQB 4K8RD 4G3YL 1WITA 2Z91B 4Y4KC 2YPKB 3L3IB 1IM9B 5EU4B 3OF6D 4HDIB 2X1XR 1P1ZA 4MA8H 1CLYH 5CZVL 3EDJA 4ZG1A 4JFZH 5DS8A 4MDJA 4DKDC 1QSED 1WFUA 5EBMB 1R3HB 3BYYA 4D9RD 4EOWH 5SV4A 4ZTOL 5IFHH 1RUML 2R39A 4Q2ZA 3D0VA 4JPWL 2XQYK 1LGVA 3LS5L 1IGTB 1A9EA 2B1HL 4KI5D 2Z35B 3OAYK 5DJ6A 2JB5H 2Q6WB 4XP9L 5C0AD 5MERB 3O3AB 1MH5B 2P8LB 5J11C 1JI1A 4Y5XA 4WHTA 2R23B 1HSAA 5HYSA 1INEL 2HFTA 1DQQB 4PS4H 4KUZH 4PLKD 3FO9A 1KCKA 2PW2A 2HLAB 4HS8L 1L7TH 4JO1H 4QHUB 5H2BA 1FG2A 3CMOL 1I1RA 4ZAKA 5FCUL 1CTOA 3EO9H 3T0VA 2X9YA 5IFJB 2EYRA 4XBGB 4DVBB 4NQXA 1U8PA 3EDEA 3TVMA 4PJIE 1S7XB 2LE9A 2YRLA 4G6JL 2BJML 4PREA 2DQCL 2DQTH 3RX8A 3OV6A 2H45A 3LQMA 3ZYJA 3AVEA 2R0LL 5HHOB 3FKUS 2Q3ZA 1QO3B 1OGAD 1CN4A 5CEXB 5SWZD 3QEQE 4ZSOA 3WNPA 5GSVB 2VQTA 2IMNA 1ITCA 4F57H 2WWKO 3MLRL 3S5LA 5JPMB 1AP2A 2BERA 4PP2A 1INQB 2J3SA 4QNPE 5BS0B 1JNLL 4FTVB 3O0RH 3NCJH 5CD3B 3TIDA 43CAB 3LPGA 5IB4A 1GC1L 5ICZA 1YEGL 5IESH 4ZXBA 2NW2B 4MNHB 5KVDH 5EC1A 2AERT 3R1GH 1RVFH 4MJID 5TQ2L 3CLEL 4CU6A 4HKJA 2EDTA 1MY5A 2ED8A 2W92A 3UTTE 3VGAC 2R8SL 4A2MA 4EXKA 4X6CE 1WISA 1H8NA 1CZ8H 2J4WH 5ID0A 4BKLA 3BRFA 3FONA 2VR5A 2IALA 1RU9H 1D5MA 2M8XA 1I4FB 4EJ1C 5I76B 1CDUA 3F12B 3O3BB 4PRPB 3Q5OA 1W72A 4PJ7A 1NCAH 2VO5A 2GUOB 4CDHA 2N4IA 2WW8A 3UEZA 3GM0A 5C0CA 5I1LA 1FZMB 2YZ8A 3QI9D 5DJ8B 3U4EB 4UQ3B 4UZGA 1PG7W 4G8GD 4GT7A 4MYWB 4KGJA 3RWGA 1T4KA 1OP3H 1MFAH 4M7KL 1BFSA 5F7EH 3B6SA 5IB3B 1HYSD 1FNGB 4NZRH 1I9EA 3JXAA 5I73B 3H42H 3CZFA 3PIQA 1NC2B 5I8EA 3WFCH 1I8KB 5DQJA 3DSFL 1LEIB 5JOFA 3RVVD 1ZANH 3B5HA 3N1QC 4P3CH 1UM4H 3O6ML 3V6ZA 3GJFH 1YNLL 1JP5A 5F7KC 3UYRL 2HMID 1A7OH 5FK9A 1CFNA 2VXSL 1JV5B 3QULA 4FQ2L 2ICWI 4QY8B 5IMLA 3SE9L 5GRVL 3BPNB 3EUUA 1CWVA 4P46D 1BQSA 5ISZB 1RHHA 1N2RB 1QNZH 3T2PA 3GSWB 5JHDD 3FQXA 4DOHE 1INDH 3FO2A 3I6LD 5MEQA 3MUGA 1I3RA 5D1XC 4UT6L 1NGZB 5FM5O 3FB6A 1ZE3C 1EA9C 1FLTX 1FORL 1NH6A 1HDMA 3FFCD 3S37L 3HZYA 5E1HB 5JOPD 3MRRA 1AGCB 5E9DD 3LAFA 1J0JA 2XA3A 4FMFA 4MS8D 3GI8L 4Y5VA 3TH3T 5DMKA 5I1JL 1JF5A 1XF4A 1ES0A 3UTSD 4MX7A 4PR5A 5IHLB 5DZLA 2VXTH 2WANA 2IC2A 5DFVC 4PIRF 1CFQB 1NBZA 4N0CC 2BNRA 1VFOA 5EULV 1EV2E 3IDMB 1JPGA 4NCDA 4Y2DC 3VXSD 1I7ZA 1K4CB 2CIIA 1W8OA 4Q0XL 1TMCB 4NJ9H 4I2XB 4YIQA 3OBAA 2Z91A 2AP2A 1VFAB 2YPKA 3L3IA 1IM9A 4NOFA 4ZSOE 5JUEL 5EU4A 2CGRH 1A14L 2M2DA 4Z7VF 1H8SA 1V7MH 2EEAA 3P77A 2XZAH 4HDIA 3QBTB 3HLAA 1YN7B 1V3LA 4LASH 4POYA 2EDOA 3BAEH 4JG0H 3SO3B 5EBMA 1R3HA 1UKTA 4ZO8A 3LZFH 1MCOL 3V0WL 4JFXB 4OIIL 5DD5H 1HEZB 4EQ3A 2V5RA 4AG4L 3VH8B 3D5OF 1IGTA 1NGQL 4XP1H 4ZFZB 1QPPA 1Q72L 2Z35A 4WV1C 1T0MB 2D4DA 3MC0A 1NAML 1AQDB 4X0KB 4YBLB 3TM6A 4I3RH 2Q6WA 3VXRB 5MERA 1MH5A 2P8LA 3MX0A 1W0WB 4KH2A 4WO4A 4NO0B 4S1RL 1DE4B 2R23A 3MA9L 4Y5YC 1MRDL 1FCCA 2AJ3B 2EECA 1F3JB 3QH3B 3O2DA 5E6YA 2W0KA 1DQQA 2NXZB 3D2UB 4JO3H 1X4ZA 2NNAB 5DJZB 5HD8D 4PJ7E 2HLAA 3BQUC 3OHXB 4YGAB 5C0CE 3P2TA 2H41A 1H5BC 2X40A 3QUXC 4G6AC 4GBXD 4LSPH 4QHUA 4QXWA 4POZC 3SDDC 1H9VA 5HHQB 1II4E 5DUMH 2JK5B 5AZEL 1JNNL 5L8LB 3O11B 2VDLL 4FFWC 2LFGA 4XBGA 4DVBA 1L7IL 5AYQA 1NBVL 1TCRB 1OGTB 2AXHA 4JHAH 4EUPH 3LD8C 2O93L 1NMAH 2VC2L 1HHHB 2F53B 5F8RC 3SDCB 1N5YL 1WWWX 2DM2A 3HI6H 3NCYP 1F90L 3B43A 3QEHB 5HHOA 1NCNA 5F6HJ 4EDXB 5D93C 1UYWH 1QO3A 2OR7A 3LH2L 5EUKA 5CEXA 4QGYA 1QRNB 4WUUB 5E08H 1QSVA 1WF5A 1TZGL 5I0DA 3QPXH 4NO5B 5JPMA 2DJUA 1INQA 1X5IA 4FTVA 3H8NA 2G60H 3BGFC 12E8L 5GS3A 2J6EH 43CAA 1CVSC 1EERB 2NW2A 3RDTC 3W11D 5D2LF 4MNHA 1ZT4B 3TO4D 5DHYB 2WIIB 3MBED 3UDWA 3WUWB 4PJGE 3G5YB 4N90D 4Q6IC 1IGCL 2FO1A 4LSQH 3D87B 1B4JL 1UG9A 4H0HB 4LLYB 1P9MA 3HZVB 3U7AA 3MLXH 2FD6L 4R0LB 1I4FA 5I76A 4TNVF 5MEND 3F12A 3O3BA 4PRPA 5HHXL 1MCSA 2BNRE 2GUOA 4DQOH 1FZMA 5DJ8A 3U4EA 3QNYB 3O4LE 4FHBD 4J3WA 4UQ3A 3TF7C 3A67L 1R6VA 4HWEL 4ORZC 5DRWB 4N0YH 1MCBA 4NQVB 3GK8H 5C7XH 5MEOB 3MOQA 3NZHH 1FNGA 4UNUA 1ZHKB 5IB3A 3S97C 3HPLB 1NC2A 1I8KA 4K3JL 4U6XB 1LEIA 4LSSL 1CXHA 1EDQA 4M4RA 5CFHA 4JPKL 5E2JA 4QY8A 1BF8A 2QR0B 3MRNB 4LVHC 1D5IL 2JKXA 2OTUA 2YK1H 4W81A 5ISZA 4Z77A 4X6EB 1N2RA 4YUEL 3M8OL 2WM0A 3HI5H 3GSWA 3RA7L 1QFWM 1WUNT 1A3LL 3MRPB 1GOGA 4XNZC 3UP1A 4FQLH 4LVNB 3T3MF 4WFGE 3X3FH 1YMMB 1NGZA 2YRZA 3TZVB 2B1AL 3GBML 4EUPG 4P5MA 1AFVL 5ALBH 2XKSA 4GW4A 4HPOH 2FH6A 2WLZA 1AGCA 3TJEL 5C09D 4G8FB 4OZFB 4LPCA 3A6CH 4O51B 5IG7B 2GTWB 4N5ED 5I0ZA 2FB4L 4NZJA 4NNXB 4JO4H 3UYOD 4XWGL 1RZ7L 3ZKXC 1XMWA 1CFQA 4XMKH 4DVRH 3IDMA 5AAMA 2HFFA 4I9WE 2IG2H 3VI3F 1K4CA 2CKNA 3EOAA 4GJTB 4P2RD 5HHOE 1U8JB 5F3BA 1FGNH 4I2XA 4OZHF 3K4DA 4HUNB 1VFAA 1NFDB 4UILH 1C12B 4WWKB 1JWUB 1CLZL 1QPXA 2EZ0D 4IRSD 5T1KD 1NLBL 3L3JB 1YN7A 2FEEL 1MHPH 4WI2A 4GG8A 4JHWH 4X5XA 2X4OB 4HIXH 4IMLB 1WEJL 4FTVE 4JFXA 2QQKL 2C7UA 3OAZK 1HEZA 1G7PB 3L5XH 5C92A 3VH8A 3IFPB 4F7CB 4Z7OE 4OZGF 5L9DH 2NY3D 4M1DL 1I1AC 1FCGA 2BMKB 4WI6A 2H2PC 1AQDA 4X0KA 1D6EB 3C5ZC 2X7LB 1RZGB 1W0WA 2ESVB 4GRWH 4M02A 4NO0A 1ZVSB 1DE4A 1RZJC 3H9YA 3V7AE 2AJ3A 1F3JA 4PJXB 3D2UA 4MWFB 4PRPE 4RX4D 2NNAA 1OAQL 1BJMA 4E41B 1VEPA 3OHXA 1VGKB 4LAJH 4KVCH 4FQCH 3REVB 4DCQB 5C2UB 5HHQA 5ADOL 2JK5A 4P4KD 4OCWH 1EHNA 2FX7L 3BEWB 3O11A 2CK0L 4NO3A 1MCWM 2PXYC 4OIBA 4PRIB 1TCRA 1OGTA 3WLBB 1NGPH 2HT3D 3ZSSA 4F7EB 1HHHA 2F53A 2E27H 4PTTB 4BYHA 3MODL 3SDCA 2BSSB 3QEHA 4EDXA 2VDNH 1KXVC 2XRAH 3CVHH 4PD4K 5TF1L 4OT1H 5F7DB 3JWDH 4KY1L 2APBA 1QRNA 1AKJD 5EZJB 1RIHL 4WUUA 1S8DB 5HVGB 4OKDA 4NO5A 1NGYA 2RJMA 3IFLL 4M7JL 3MREB 3UJJL 4NKIL 3DV4B 4FQQB 3QUZB 2XTJC 3SCMC 5GRUH 1ZT4A 1JGLL 2VE6B 2WIIA 5DHYA 2YHGA 2APVA 1OW0A 3WUWA 1VFUA 3G5YA 1Y6KR 4V2CB 2BNUB 1TPXB 1TNNA 4LLYA 3HZVA 3QG6B 4YWGH 4MMXC 2EDKA 1C5BH 1YY9D 2D7QA 3TCLB 3P4OB 1WCQA 3H3PH 4R0LA 4OLWH 3C6SB 5TE7L 3G6JB 2VZSA 5T3XH 3U30C 3GRWH 2HT4D 1KULA 1IQWH 2VITB 3QNYA 3QSKB 4TUKH 1OLLA 2GTZB 4YO0B 5DRWA 5JIKA 3ZE1F 4I2XE 4JFHE 1I8LC 1E0OB 4NQVA 5MEOA 5EO0B 1QP1A 1ADQA 1ZHKA 4Z95H 1DJSA 3HPLA 4X7EC 5DVMA 4R26H 3RGVB 1L0XA 4U6XA 4OGYL 5CKGA 4ZTPH 4KXZI 1FN4B 3DVIA 4NQDD 1JZ8A 1UWEL 4ODTH 3OJMB 2QR0A 2Y6SD 3MRNA 1T1ZB 5D7JD 3BFOA 3P9MB 5SWSA 2W9EH 5GGTH 5D96B 4X6EA 2HFGL 1H3PL 5KZCB 4KI1A 2IH3B 1S5HB 2X4SB 3MRPA 5HYJB 4U3XA 2CPCA 2PETA 1WWBX 1YMMA 4K3EH 4J4PA 2E7LA 4HQQL 5GGRB 3QIWB 4L9LC 4OGAC 2JLLA 3VXOB 4W70A 4G8FA 4OZFA 2OM5A 4O51A 3M45A 1I7UB 2RB8A 5IG7A 2GTWA 1FVDB 2A9MH 4NNXA 3BUTA 5E8PA 1HQ4B 3T0WA 3WFBH 2F53E 5E8EB 1OAYL 4RFOH 15C8L 4TVPL 1LP9E 1U8JA 2Z0BA 4ZS6C 1YJDL 3QUML 4IOFD 4KTEH 1NFDA 1O7VA 1C12A 4WWKA 3BIBX 4HXBH 5BVPL 1JWUA 2ATPB 1MAML 5JLZA 5GJSL 3L3JA 4KRPD 4ZFOB 5HI3C 4LSRH 1I75A 2OXGA 4OFYD 2YPLA 5HGBB 2CRIA 4RFNC 1KELL 5IVXF 1FRGH 2X4OA 4PBXA 4LEOA 4WU7B 4XMPL 2JJSA 2YEZB 4IMLA 5JTWA 3BH8B 3MJ9L 2R2CA 2WBJC 3OR7B 4RMVA 5E99L 1G7PA 5KTEH 3S34L 3N9GH 3RWEA 2Y9RT 4F7CA 2VDML 5L7XL 1CDJA 1PSKL 3RAJL 2AJZB 3U7YL 4Y4HD 2X4RB 2BMKA 3NZ8B 3MACL 4G8IB 4LQFL 5CD5D 1D6EA 5JXAH 3MXWH 4LOUC 5GJTH 2DJ4A 2X7LA 3NCEB 1RZGA 1MCEA 2ESVA 4PRHD 1ZVSA 1F2XK 4PJXA 1SQ2N 4MWFA 4BZ2L 3QDMB 4E41A 4K07A 1N4XH 3HHRB 4PJ8C 3DXAD 1VGKA 1EO8L 2BY3A 3HNTH 1IE5A 3AMLA 1IC4L 4DCQA 3QIUC 3KXFE 3TT1H 3G6AB 3ABZA 3JUZA 4NPYB 2WNGA 3JV0A 3MRIB 1BQLL 3BEWA 1DVFC 5D9SA 2VZOA 1N6UA 4PRIA 1IAIM 3JUYA 1MCCA 2ICEB 1HH6B 3WLBA 4MJ5A 4F7EA 4DW2L 4PTTA 3QQ9D 5KW9L 4OLZH 3OJDB 2EDJA 4TUOB 2PN5A 5F7DA 3MLZH 5EZJA 3RFZC 3B2UD 2XA8H 3IAPA 4WHDA 1S8DA 4Y1AD 4FQIL 3M07A 1R3KA 5KSBE 5SWSE 2ED7A 3PGCB 4I48B 1F4WH 3VXUD 3QI9B 5CSZB 4PJDF 3WIHL 3SJVD 4LHUB 5KVFL 4LSVH 3MREA 2VKWA 2Z9TA 3U9UB 3DV4A 4FQQA 3VXMD 3QUZA 1SJEB 2CIKB 1YMME 2VE6A 2ENYA 2ADGB 3OKMB 2FSEB 2OR9L 4OCSH 4NWTH 3MGAA 5B4MC 1KB5L 3STZB 2BNUA 2V2XB 5DD6A 3QG6A 3CU1A 1JIBA 3MLSH 2DBJA 3TCLA 3P4OA 2PF6A 4TSCH 5KSAD 3LKRB 3C6SA 3KWWB 3G6JA 3KGRA 5A40E 4ZUUB 1S3KL 1CGVA 3VFTB 5GS0C 1KEGH 4Z0BL 1SMOA 4Y4KB 5IQ9B 4HFWB 4OF7A 3IDIB 2VITA 1UQSB 3QYCA 2GTZA 4RAHA 2N7AA 3D85D 1QBMH 4TSAL 2EDYA 3UYPA 5JHDB 1NFDE 1QFWL 2RCSL 5DJ2B 5EO0A 5AYUL 1JRHI 3BO8B 1RJCA 4O5LL 5EO9B 4WVRA 4XVTL 5CBEB 5F96H 3HMXL 2ICWJ 4FFYL 3RGVA 2YPLE 2FX9H 5C07B 1OHQA 3IKKA 3GNMH 4UIKH 5DJCB 2R1XB 5TPWH 1T66D 1PZUB 1BAFH 3LS4H 5T1MB 2ADFL 2JE8A 2QADD 5GGVY 1T1ZA 4X4YB 4LLDB 3P9MA 1ZLUK 4RGNE 3VGFA 5DA0B 4MAUL 2J7LA 3OB0H 3WNKA 2IH3A 1S5HA 2X4SA 2ESVE 4WFHE 4FXKB 4OZ4B 5C08D 5HYJA 1F4XH 4M6NH 2P49B 2Y23A 4PJXE 3HZKB 4M3KB 4K71B 5ANMB 3QIWA 1C16B 2V17L 3MV8E 1OTSD 3GEWB 4OD1L 4RAVB 5BQ7B 3VXOA 2K1MA 2YS4A 1SJXA 5J12C 4XVSL 3BP5B 1D5ZB 4I18C 4OFPA 1I7UA 3O9WC 4J3TA 1MRFH 1FVDA 3O3DB 3S36L 2Y06H 2KDGA 1AIFB 1GGYA 1HQ4A 3BW9B 2VH5L 1TFHA 3P0VH 5E8EA 3NCBB 1AR2A 5LJYH 1MI5B 2LU3A 2UWEF 4XVUD 5I18L 2CRZA 4XC3H 4BA8A 4O2EB 4G3YH 1U95B 3EYSL 4JJ5B 3T65A 3N1FC 3FHAA 5CZVH 2ATPA 4NP4L 2HT2D 4LRIA 5E2UL 3C09B 5HGBA 1EAJA 4HHAB 3PWLB 4WU7A 5DZOA 4ZTOH 1MUJB 1RUMH 2YEZA 5BW7A 3BH8A 4GBXB 5DMJB 4JPWH 3ZT5A 1MCDA 3K1DA 3OR7A 5IOPB 1N59B 1M1SA 3PWJB 3DSNA 3LS5H 3EFFB 3F58L 1CDCA 2B1HH 2IBBA 3VWJD 5B3JE 5C3LD 3A0OA 2V5TA 3K80A 2AJZA 5FECB 2X4RA 4KZDL 2F5BH 1ZV5A 1CF8L 3NZ8A 1UM5L 3UJIL 4JFFD 4XP9H 4WFEE 4KKBD 5HYQB 4F8TA 5ITFB 1AGEB 5EO1B 1JF1A 1INEH 4S0TD 5SWZA 2GQHA 3D48R 3QDMA 4HS8H 2A6IB 2WP3T 3E8UL 2YD3A 4M5ZL 3CMOH 3HAEB 2HTKC 1IZKA 4NZUL 3DNKA 3G6AA 3IETB 5E6ZA 5FCUH 4NPYA 2BSTB 4NHUB 3MRIA 5JPNB 2HRLA 4FFZL 3IDJB 3FO1B 2GHWB 1A02N 2WLYA 3AS0A 1JJUA 5GZNC 3BD4A 2ICEA 1MEXL 3DOSA 4G6JH 2BJMH 1ED3B 2DQCH 4H8WL 4L3EB 4AEEA 2R0LH 3U1SL 1ZKAA 3OJDA 4R6UA 4TUOA 1RURL 3TBTB 5KBNC 2YZ1A 5MENB 3QNXB 3T0EC 3KPOB 3MLRH 2Z4QB 1BBDL 3S4SB 3PGCA 4I48A 3QI9A 1JNLH 5CSZA 1WV7T 4LHUA 4FFVD 5D1XB 3AB0B 1GC1H 3UJTL 3U9UA 5DRXB 3QUYD 1YEGH 4HKZB 4WI7A 4HXAL 1SJEA 1J0IA 2CIKA 4YHIB 5EH1A 4HJ0D 3NACL 5TQ2H 2ADGA 3WEXB 1A1OB 3OKMA 2FSEA 3C60D 2R8SH 3STZA 4D9RE 2V2XA 4BQ6A 5H35B 1JPTL 1QYGL 2EDQA 5DRZB 3KPPB 4Y4FD 1EGJA 3MRKB 4X7SL 5L2KD 2AK4B 3LKRA 4Y2DB 3KWWA 5ESQB 4ZUUA 3ARDC 2AEPL 2GSIB 1KN4L 4KI5E 3TLRA 3VFTA 5JHLL 1FC1A 2HVKB 2HWZL 2YD5A 5IQ9A 1FFPB 4HFWA 3IDIA 1UQSA 3DGGB 3G6DH 4W6WB 3OX8B 3L3DB 2PO6B 5JHDA 4L3CB 4M7KH 5GGRY 1OD9A 5DJ2A 3BO8A 4HWUA 2X1WL 1WWCA 4OAWB 5EO9A 5CBEA 5DO2C 1DBBL 3DSFH 3MRDB 3O6LL 4JY4B 5DTFB 3F7VA 3GKZA 4N0RA 3O6MH 1YNLH 5C07A 5DHVB 3V0VB 3UYRH 5E4EC 5DJCA 3CH1B 3D9AL 2R1XA 2FEDC 2VXSH 1LWRA 4X9BA 3MA7B 4FQ2H 3OKOA 2R2HA 5T1MA 4JREC 3SE9H 1VFMA 3IVKB 3MOBL 3VWKD 4LLDA 4JM2D 2XWBB 3SE3C 4P2RB 1EEYB 4JRYB 2R9HD 2DQIL 1Q0XL 1VACB 2VIRA 4FXKA 4OZ4A 4PV8B 5SWZE 4P5TC 3NIFF 3HZKA 2NTFB 3CK0L 4WTZG 5FOBB 4UT6H 4G9DB 3RZCD 5T1KB 3QDME 3ZL4L 2BRRL 1WT5C 2D7PA 1FORH 5ANMA 1C16A 3S37H 3K3QA 4Z7VB 5EOCL 1KCVL 5C86A 4RAVA 5FV2A 1G6VK 5BQ7A 3GI8H 5I1JH 4NQTA 4NCC1 3BP5A 1D5ZA 5I8OL 4OCRL 2M26A 1IL1B 3ULVL 1T89A 3O3DA 3BIAX 1X3DA 1AIFA 4ZO7A 3WFHB 4OTXL 3BW9A 3TV3L 1DBAL 3SGDI 3SDXB 4HAFA 3P30L 3TA3D 1A0QL 1MI5A 2E8YA 4Q0XH 2PR4L 1U95A 4LHQB 5JUEH 5AWNL 1A14H 4JJ5A 4JGUA 4LPTA 1I7RB 5B21A 4P23C 4HHAA 4QEGA 3PWLA 3OAUL 1MCOH 1MUJA 4HIEB 3V0WH 4GBXA 4HCRL 4OIIH 5IOPA 5C0DB 4G8GE 5LXGL 1MCQA 4AG4H 4Q6IB 4YR6B 3PWJA 3EFFA 1WLHA 3VXTB 1NGQH 1WCBB 4XNUL 4JEGB 3SGJA 3KAAA 5CWSB 3BVNB 3HUJE 1G1CA 1IAIL 5FECA 1NAMH 1BWWA 4F9PA 3JTTB 3FB5B 2VLJD 5ACMA 5HYQA 1I1CA 1AGEA 5ITFA 5EO1A 1KXTB 3NIDE 1JWMB 4S1RH 3MA9H 4QLRA 1MRDH 5IB1B 3CZJA 2A1WL 3GZKA 2ZSWB 1J1XL 5C9KA 5BXFB 2YD4A 5DD1L 3X12B 1BMGA 2A6IA 1XF5B 4JN1L 1G1YA 5GRJH 2B0SH 1C8PA 2F74B 3LKQB 3HAEA 1UC6A 5J4MA 3IETA 2JCCF 3KPSD 5AZEH 1JNNH 2BSTA 4NHUA 5JPNA 2VDLH 5JHDE 2K7QA 1L7IH 1VESA 3FT4B 2C1PB 1NBVH 2HA1A 2AABL 3IDJA 3FO1A 3HZMB 4JANB 2VC2H 3AU1B 4OCYL 1ED3A 4RMTA 4CN1A 3S6CA 5D2LB 3FFCE 4R8WL 5C07E 1F90H 4L3EA 5C71A 4FG6C 5JOPE 1AE6L 3C5JB 3PQYB 3SGKC 3FL7A 3LH2H 4KK5C 4LLVB 4LVHB 5CJ5A 3ESUF 4B5EA 4LIQL 3LQAL 1JL8A 2C4XA 5MENA 4XP4L 1CBVL 3KPOA 1JPFB 1TZGH 5TQ0L 2Z4QA 3S4SA 4DUVA 4I8DA 5D1XA 12E8H 2D0FA 4X9IA 1J0KA 5DRXA 4HKZA 25C8L 5D7SH 4DK3A 1IVLA 5E8NB 4WW2F 2HP4A 3K8MA 4YHIA 2BNQB 1KFAL 2EEDA 3ZKMD 3OPZL 2EYSB 2QSVA 3BPLC 5D1ZC 3WEXA 1A1OA 1IGCH 5ICYB 3OTTA 1B4JH 1C5CL 3I6KB 1MJUL 2H8PB 5KANG 5H35A 5F3HB 1GZQB 2Y5TB 4UIMA 3RL2B 5DRZA 3KPPA 2FD6H 3MRKA 5AAWA 2AK1L 3WDJA 1PFCA 2AK4A 4YHNB 4R4NC 4F37F 5ESQA 4NQDB 4MXQD 2GSIA 5HHXH 5KAQG 2HVKA 6FABL 3VFGL 4OF0A 5HHVL 2MFNA 3A67H 3OZ9L 4HWEH 3DGGA 3VGEA 3VE0B 2MQCA 1FAIL 1A7RL 3OX8A 2DI8A 3L3DA 4X8XA 2PO6A 3TBVB 1AGFB 3AAZB 3LQZA 4WJ5B 3DUSB 4L3CA 5IFAL 2LAGB 1TTUA 5IEKB 4JQVA 4OAWA 4G6ML 5DEZA 2OJZL 1AQKL 4K3JH 3MRDA 4JY4A 5DTFA 4LSSH 4CADB 1BFVL 5BV7B 4XAWL 5TE4L 3JWOL 5DHVA 3V0VA 3OKKB 5GSRB 5T1LD 3CH1A 1JUFB 1Q38A 3MA7A 4JPKH 3L3HB 3PDOB 4HIHB 3C5ZB 3PWPD 4P2OD 4QT5B 1D5IH 2KQMA 3QPQC 4KKLC 4F3FB 4RRPA 2XWBA 3AXLB 4YUEH 3M8OH 2APFA 2WK2A 3RA7H 4P2RA 1EEYA 1A3LH 3DUUB 4JRYA 1VACA 3O6FD 1Q1JL 4PV8A 4U1IB 1K85A 1DN0B 2NTFA 5FOBA 2YSSB 2G5BB 4G9DA 1V3KA 5FYJL 5T1KA 3ISWA 4KRPB 2B1AH 2EDRA 3GBMH 4KFZC 3SDYL 1AFVH 1OP9A 4Z7VA 1T5XB 3THML 1NGWB 1HILB 2EDLA 3TJEH 4UBDD 3O4OB 3PXHA 2GT9B 3M1BB 4OI9A 2FB4H 1IL1A 4XWGH 1RZ7H 4U1MB 4BM7A 5D4QA 3ILQC 2IAMD 4J23A 4AIZB 3WFHA 1NMCC 1Y0LB 4KK9C 4OLUL 4Y4HB 4N90E 4MLIA 3SDXA 1OAXL 4L3EE 4ZO9A 1HE7A 2DQGL 4YHZL 4NT6B 5F88A 5EOQL 4PRHB 1CLZH 2DKSA 3WIFB 5F93C 1NLBH 2I60L 35C8L 1F5WA 5KVGL 5MENE 1I7RA 2XTJB 4YBHA 3FQTB 1WEJH 4HIEA 3VDCA 3Q1SL 4AQOA 2DMKA 2V6HA 5C0DA 3BIKB 2VAAB 4Q6IA 4YR6A 3VXTA 1WCBA 1IKFL 2XV6B 5CWSA 4YH6A 3N06B 1Q9LB 3BVNA 1NPUA 4M1DH 4CU8A 3RP1A 1FYHB 1IT9L 3EHBC 4G6KL 2EE9A 3JTTA 5I66B 5I1EL 3FB5A 2ZUQC 4ZO6A 3U30B 1JWMA 2E3VA 5IB1A 3UAJD 1G9ML 2IFFL 2ZSWA 3QFDB 1OAQH 5BXFA 5ENWB 1NCTA 3X12A 3MLWL 1UXSB 5GISL 1XF5A 1YJDC 4Y1AB 3MFFA 4B7IA 3BDBA 1J12A 2F74A 3LKQA 3O41B 3V6OA 5ADOH 3HCVB 2DQFB 5C6WH 2EIDA 2FX7H 1B2WL 2CK0H 3QB7C 1FNFA 3FT4A 3VXMB 2C1PA 2UV3A 1O0VA 4EI5B 4FQPA 4JANA 3AU1A 5ILTL 3KLAB 4N0CD 5ESAB 3MODH 4OB5L 4J3XA 2BDNL 1MHEB 5DWUL 5LG1A 2ZG2A 2NY6B 2ENSA 3PQYA 5IBUG 5BRZD 4LLVA 5C09E 5TF1H 3RJDA 3PABB 4KY1H 1RIHH 2EC9T 4YHKL 2HJKB 4B50A 5HVHB 5BJTB 1JPFA 4X98B 1TJHL 1T04B 1G7HB 3U7WL 3S88L 4N68A 5DK2B 2NY4D 2VN7A 5IBLC 3QA3B 3KPMB 3IFLH 4M7JH 4PGDB 3UJJH 4P2RE 4JFDD 4NKIH 1WTGT 3D85B 3HMWL 4RGOL 3UBXI 4F7MB 3TPUB 5E8NA 4MXWL 1JGLH 3OG6B 4GUPB 2BNQA 1S7UB 2P5WD 2EYSA 4MB3A 4DGIL 4PJCB 4BUGA 3FZUD 3WJJA 1ETZB 5ICYA 4QYOB 4U0RC 4ZOBA 4Z7VE 3FQUB 1NUGA 3DMMB 4CVUA 4PJIF 3I6KA 4M8QB 4JDZB 1IQDB 4QXTB 5F3HA 1GZQA 2Y5TA 1ADQL 1CXLA 4UV4L 3R8BB 3LRSB 4FNLL 4OZIB 5TE7H 4IRJD 3MRMB 4DAGL 4NQDA 1EMTL 3ARXA 4LCCA 4LP4A 2LQRA 2OI9B 3TPKA 3ZSTA 4L8DB 1UEYA 2VISB 3BQUD 3RVWC 4F37K 3SDXE 1EZVX 3VE0A 4NNPL 3SDDD 1KLUB 3TBVA 1AGFA 3HC0B 1KCUL 4WJ5A 1OARL 3DUSA 5HI5C 4WHYH 5C08B 3DRTB 5IEKA 2GY7B 2WBJB 3RU8L 1T2QH 1KOAA 1C1EL 1HK6A 1A6TB 5EN2B 1ZTXL 4LPVA 4OGYH 4YK4C 4CADA 1ZGLP 4PJ5B 1MAJA 4BH8B 2FIKB 4FQHB 1A6UL 3UBXA 3OKKA 5GSRA 1QG3A 4L1DA 4QOKB 1JUFA 3L3HA 1UWEH 1KPUB 4HIHA 3C5ZA 1D6VL 4QT5A 3MUZ1 2X70B 4FMKA 4KROD 1S7RB 4F3FA 1H3PH 5DGQA 3AXLA 4MHHI 4NRYB 5HGAB 3OWEA 3BZDA 4L4JA 5C0JB 5JA8B 1KJ2L 2H2SD 3LB6C 4PJ8B 1U0QA 1S7VB 4U1IA 1HWHB 4YHPB 3E6HB 1DN0A 1A6ZB 1B88A 1HSBB 2YSSA 2BOCB 2G5BA 4HQQH 4HUXB 2KKQA 2W9DL 1IGYB 5F9JB 2D2OA 5M95B 5GGVL 1T5XA 3V6OE 1LDPL 3VD5A 1HILA 5IM7B 4OCNC 1KPRB 2EC8A 4NN5C 5A16B 1X44A 3PDDA 5IVXB 2GT9A 1BX2B 3M1BA 2CKBB 4GFTB 4U1MA 2IGFL 4QXGL 5C2BL 4AIZA 1Y0LA 1X5XA 1XF3B 5EUOE 4Y4HA 1OAYH 1CFSB 2F9BT 15C8H 4U05A 4TVPH 4ISVB 4JFFB 5FUCE 1YJDH 3BN9D 3QUMH 4NT6A 1Z9OA 1ZS8B 4RWYL 4IMKC 4PRHA 5IK3B 5BVPH 3WIFA 1MAMH 4I0CC 5GJSH 5HI4C 4L4TB 1AD9B 5LGHL 1KELH 3ZKSD 5CEZD 4XMPH 3HE7C 1RHFA 1YYLL 2RFXB 3MJ9H 3FQTA 5BMFL 3Q6FA 1UM6L 3DUHA 5E99H 4ZYKB 1L9NA 4RDQG 3S34H 3BIKA 2VAAA 4GAGL 2VDMH 3SDAC 5L7XH 3RZWA 1PSKH 2BNQE 3RAJH 3OKDB 3U7YH 3KPRB 4B7LA 4UTAL 4LQFH 2H6PB 4MB4A 2RBLA 2MQ3A 5I66A 5CS7A 4I0PC 1QBBA 3ZDZE 4OLXL 1K5NB 5T3XD 3NMEA 4NQDE 4BZ2H 3QFDA 4WHYG 4APQB 5ENWA 1UXSA 1EO8H 1FL6B 5C0RL 4Y1AA 2AJXL 2O5YL 3GBNL 4YX2L 3INUL 4AYFA 1IC4H 4LNRB 5FKAB 3O41A 4NC2B 3L9RB 3HCVA 2DQFA 5HYEA 1BQLH 2BVQB 3TJHC 1CT8B 4KZEL 4WTWA 3VXMA 2IBZX 3QXVA 4PJDB 1OQXA 1T0PB 4K9EL 4Y5XC 3FHQA 4EI5A 1ZVHA 4DW2H 3KLAA 5ESAA 5F8QC 2BRQA 3QDJB 4URTB 5KW9H 1MHEA 1P53A 4GQPH 3GI9L 3VFWB 3DI2B 1O7SA 1S7TB 1FL5B 1TVHB 3QUKB 2D31B 5L2KB 3PABA 4ODSL 4ZAKC 3VFUB 2HJKA 4Z76B 1FFOB 5BJTA 4X98A 3MCG1 3P4MB 4FQIH 4TQEL 1FIGL 1T04A 1G7HA 1MQ8A 1VADB 1URLA 4ODHL 4TRPL 5DK2A 1WZKA 3TVMC 3QA3A 3KPMA 1T7XA 3WIHH 4PJ7F 4UB0H 1RK1B 4Z7QF 3B9KD 5KVFH 4PGDA 1ZXQA 2L7UA 3D85A 4OM0H 4RMUA 3VFPB 4XCCL 4F7MA 3MV7B 3TPUA 4K7FB 4GUPA 1S7UA 2OR9H 4QRRD 4PJCA 2X89A 4L4VD 1ETZA 4EN3D 1KB5H 4QYOA 1I1AD 2CJUL 3ARZA 3KYKL 3FQUA 3DMMA 5CJXC 4BQBA 2H2PD 4JDZA 1IQDA 4LCWB 4QXTA 1AH1A 4PJBB 4H0GA 1ZHNB 1YEHL 3LRSA 4OUUB 5A3IC 4OZIA 2GAZB 3MRMA 2AKRB 2WMPA 1S3KH 5J13B 2YD2A 4AEIL 4H8WC 2IANB 1YNTB 4Z0BH 3V8CA 5FYJU 4ZXBC 4ERSL 2VISA 3VWKB 4XP5L 1GOFA 4N0UB 4JM2B 4TSAH 1KLUA 2V9TA 2FRGP 3HC0A 1QFWH 2RCSH 5AYUH 4O2CB 4YC2C 4YDLC 4PRHE 5C08A 5J7CC 4O5LH 3DRTA 4XVTH 2PXYD 2WBJA 2AXJA 4FFYH 3ARED 3QJHB 3RZCB 5I2IB 1T83A 5HXMA 3LVEA 1EZVY 5EU6D 4I1NB 1A6TA 5EN2A 1RJLA 4HPYL 3MUJA 3DXAE 4PJ5A 2FIRT 5GGQL 1GGBL 4BH8A 4PJGF 2FIKA 4FQHA 3EO0B 4C59B 4D0CB 1X7QA 5CIPB 4PBVC 1J0YA 1RD6A 4QOKA 5J8OA 1ZGLM 3WV0A 1KPUA 2ADFH 4KWUA 4W68A 5DMGC 4PGEB 5AD0B 2X70A 1A6WL 4MAUH 1JRHL 3RY4A 1KLFA 5KSVA 5HGAA 1DQTA 4NRYA 5JO5B 3QCTL 3K4AA 2ARWA 4PP1C 5D1QD 5IROA 1ZLWK 4PJ8A 5IBTL 1PJ9A 5DQDL 1S7VA 1HCVA 2NY2D 4S11A 4YHPA 1OSPL 2VLRB 2UWEB 3E6HA 5E8OA 1A6ZA 1HSBA 2BOCA 4UINL 2UVEA 3ME0A 4HUXA 4AK1A 5ERWB 1IGYA 4U1GB 4Y1AE 5F9JA 2PYFB 4G80A 4OD1H 4PJ9B 5IM7A 3A6BL 1KPRA 1FL3B 1DBJL 3SJVE 4XVSH 5A16A 4U3HA 3CXHJ 5IVXA 1EBAA 1CXIA 1BX2A 4TUJB 4ZFOL 5GXBB 1P2CA 3VXME 3NAAL 3S36H 4OQTA 4ZUTA 3IU4L 1U3HC 3VWJA 3DECA 2VH5H 1XF3A 3WNNA 2X10A 1CFSA 5I18H 2FNBA 3B5TA 1T20B 4ISVA 2VLJB 4JFFA 2MTPA 3T0EB 3MRGB 2A83B 1ZS8A 2ITCB 5HYIA 5IK3A 1KPVB 4Y5VC 3GMQB 4GS7C 4NP4H 1I3VA 1AD9A 5E2UH 3WS6A 5I74C 1GZPB 2RFXA 3WFEL 1R24B 1N6QL 4ZYKA 5EBGA 2B4CL 1A4KB 3F58H 2D03L 5DVNA 2APTA 2B8OT 3F7YB 4NQED 3OKDA 1XEDA 5DMIH 4PJCE 1JF6A 4BFIB 3GJFB 3BJ91 1CF8H 1UM5H 1I3UA 4F33B 1N64L 3UJIH 2H6PA 3ARDB 2Q1EA 4KKCC 1ZHLB 1K5NA 4OZIE 2DTML 2VERN 1MNUL 5E2TL 3FB7B 4KK8C 4APQA 3QFJB 5DJAB 1JWSB 3MSPA 1FL6A 3E8UH 3PF2A 5BCAA 4M5ZH 3B3IB 4LNRA 4OGAD 1VERA 4ODUB 4JKKA 1BFOB 5FKAA 1P7QB 4JVUA 3L9RA 5FYLL 3V8OA 5C0FB 2FZ3B 3V4UL 2BVQA 4FFZH 1CT8A 5FKPB 5C08E 3CDFA 3GSUB 3WO4B 4PJDA 1I7TB 5E4EB 2UZIL 2IQAB 4WO4C 1XH3A 1MEXH 2D0HA 1QTYT 5CLTA 3HFML 4DKEL 4LGRB 3QDJA 2JIXD 3U1SH 4JREB 4M43L 2IBZY 1ROWA 1Q9WB 5DD0L 3VFWA 3U6RB 4ZS6D 1FL5A 3UTPE 1TVHA 3QUKA 1RURH 1JN6B 2D31A 3V5KB 5L2KA 1L9MA 1S9XB 3VFUA 1M7DB 1FFOA 4Z76A 1EJOL 4FN0A 4N9GB 5DFWH 3P4MA 2OBGA 1BBDH 2EE2A 1VADA 4XHQA 5FA4B 4P5TB 4QHMB 5JDSB 3KHOA 1NQBA 1RK1A 4OD2B 3IU3A 5EDXA 3UJTH 1QLFA 4HXAH 3W5NA 1PKOA 3VFPA 2YWYA 3MV7A 4V1DD 3KLSA 3WHXA 3GGWA 5FIEA 3U48A 4K7FA 3NACH 1RI8A 4P2QD 1GAFL 3T2QA 1NCDL 4IOIB 4PY8J 2VXVL 2ZCKL 1HXMB 1JPTH 4LCWA 2OK0L 5JW4N 1QYGH 2DICA 4PJBA 1ZHNA 2PYEB 5IMOB 4X9FA 3E0GA 4LOUD 4X7SH 1R5IB 1SYVB 3GIVB 1BM3L 5IJKC 5IVXE 4OUUA 2GAZA 2AKRA 3WLWC 1U8KB 4XB8A 4KUCD 2IANA 4KV5E 1YNTA 5J1AB 2HWZH 5ACZB 5L0QC 1WIOA 3IS0X 3VWKA 5LKNA 2MOVA 1P69B 1QBAA 4N0UA 4JM2A 3UDWC 1WIUA 4JFFE 3QIUD 1XR9B 3P40A 1W2KT 1D9KD 1MHCB 2BSRB 3GIZL 1P9MC 4O2CA 5HYSG 3GUTB 5BVJB 1MAKA 4NWUL 2J88L 3TWCL 1DBBH 3O6LH 3QJHA 3RZCA 5I2IA 4L8BB 1TJGL 3VA2C 1A9BA 4NNYB 3EO0A 4ZS7L 4P5KB 4KDTA 3VGGA 3D9AH 4NRXB 4D0CA 1P4LB 5CIPA 5IEHB 2C3WA 5I1CL 2FL5B 5FO9B 5JZ7C 4BZ1L 5IWLA 1AHWB 3MOBH 2IAMB 4U7MA 4PGEA 5F1OB 5AD0A 2DD8L 1U8QB 4GW1B 1YC8A 1KYOJ 3DYMA 4NGHL 5JO5A 4AH2B 4YEFA 1OY3B 2DQIH 1IAMA 1Q0XH 4QRPD 3S35X 2VLRA 2UWEA 3CK0H 1WBXB 4H26B 3NCCB 3P9WB 4QHKJ 2BRRH 3HB3D 2DBLL 2PYFA 5EOCH 1KCVH 5HDLA 5B4MD 3WBDA 3BPNC 5K9QI 4PJ9A 5FDYA 1C08B 1FL3A 3O2VL 4GOSA 2CDGB 4U7KA 5I8OH 5HVFB 4OCRH 4AT6B 3PHSA 1UGNA 3ULVH 2GW5A 5DJYB 2VZUA 2YRPA 1BPVA 4OTXH 3BMWA 3TV3H 4EDWL 2DRUA 1DBAH 3AFLA 4RIRB 1IGIL 3QDJE 3P30H 1A0QH 1YECH 2PR4H 1T20A 2VLJA 5J3HD 3MRGA 4HT1L 2A83A 3QG7L 4HFUL 2P46B 3ULUF 5AWNH 3NFPB 2ITCA 5L2KE 2X4UB 1KPVA 1QOKA 4ALAL 4JQIL 3GMQA 4N8VB 4Q9BA 3CSPA 1T03L 4YDIL 4BQCA 4EBQL 1JHLL 1G7IB 3O2WL 1QHOA 4HEME 1GZPA 3AUVA 3OAUH 1R24A 4MAYB 4JCLA 4HCRH 4JPIB 3BPLB 1JGDB 3F7QA 5LXGH 5DDHB 1KCRL 1AGBB 1A4KA 4X4ZA 3MV7E 4XNUH 4IDJL 3QXAB 3QDHA 3F7YA 2JCCB 4JFYA 2EIZB 1IAIH 1RFDL 4UT7L 1AR1C 4WFFD 4BFIA 1LQSR 4JFED 3GJFA 3IDUA 5DZNA 3S7GA 4DK6A 4F33A 4KK6C 1KIRB 3CX2A 3ZDYE 4HS6B 3G5VB 3ARDA 4PJBE 5GRYA 3T08A 1ZHLA 4TTDC 4ZOCA 1KNOB 1LP9F 2A1WH 4ONFL 3FB7A 1J1XH 5DD1H 3QFJA 2P8PB 5DJAA 1JWSA 4PB9L 4JN1H 3N1GC 2RHEA 3FN3A 3B3IA 2NY4B 3J8F7 4N0UE 4ODUA 1BFOA 3VD7A 5JW4M 4OBRA 3ZKND 5C0FA 2FZ3A 4YBLC 4EEEA 3BDXA 2F8XC 4JFDB 1WFTA 5FKPA 2AABH 3O9WD 2BCKB 3GSUA 3RI5F 1I7TA 4MQ7B 1AO7B 2IQAA 2V7HA 2P5WB 4OCYH 5DURB 2XXMB 2NXZC 4R8WH 4WW2B 3SBWA 1KTRL 1RK0B 3GSRB 1AE6H 3C8DA 5B22A 2ZG1A 1Q9WA 3U6RA 1A64A 1JN6A 4LIQH 3V5KA 3LQAH 5B39B 3PUCA 4IRJB 3SE3A 4K3GA 1S9XA 1NEZG 1M7DA 4GAJL 5I17B 4XP4H 4RA3A 2QQLL 2IF7A 5TQ0H 4N9GA 3W81A 1T1YB 5GZOC 1R5WB 1OTUC 1P6AB 4NBYB 3QWRD 5JDSA 4OD2A 1LO5B 3SQBA 4L1HA 3SDCC 25C8H 3DARA 1WGOA 2ZJSL 2VLRE 1KFAH 4N1EA 5FFLA 3RPKA 3OPZH 1J1PL 1CGTA 4IOIA 1C5CH 1MJUH 1N7ML 2PCPB 5D6DA 1HXMA 5IMOA 2PYEA 3JV5A 1NMCB 2AK1H 3LIZL 1R5IA 1SYVA 3GIVA 4JDTL 2VWEE 1G6RB 5DC9B 3NVQA 4P3WA 3ARBD 5KG9B 1F2QA 1U8KA 5INCB 4F15B 1J8HB 3LEYL 1DEDA 6FABH 3PWPA 3VFGH 3WE6B 5ACZA 2A77L 1MLCB 4M7LT 3IDXL 5HHVH 3OZ9H 1OW0C 1RUPL 1A7RH 1UENA 2FDBP 1TETL 2VLJE 4GRWB 1XR9A 5KSBF 1TVDA 5IFAH 2BSRA 3GUTA 1FNEB 5BVJA 5CZXC 3U46B 1GXEA 4G6MH 4R0LC 5F97E 2OJZH 1AQKH 1XIWD 4KHTL 4Z0XA 1F45A 3FN0H 4L8BA 1BFVH 2R15A 1EX0A 4NNYA 4XAWH 5TE4H 3T4AB 3JWOH 4NKMB 3OKLB 2QKIB 1QEWB 4P5KA 4NRXA 1AC6A 1P4LA 1YYML 4PGJA 5IEHA 5BOPA 4EUPA 2FL5A 3QIBD 5IKCB 5FO9A 3LN5A 5CKAA 1JNHB 1AHWA 5C6PB 2BOBB 2IAMA 1CD1B 4OQ1A 1YZZA 2H1PL 4Z18A 3O8XB 3VRJB 1U8QA 4D3CL 4GW1A 5F71A 4WIQA 4AH2A 3CVHB 4I3SL 2DWEB 1MJ8L 5GRXG 1Q1JH 3TESA 5FXCH 2ZSVB 5FHBL 5FYJH 3VD9A 1NFDF 3QFJE 1SJVA 3ILPB 3SDYH 3QQNA 1IFHL 3MNVA 3THMH 4X4MA 2NY1D 4GRLC 2X4PB 1XGPB 1C08A 2CDGA 4EXPX 4AT6A 2AEIT 1N0XL 1K8DB 3QNZA 1HHIB 3SGKA 2VB5A 4KQ3L 5KOVC 4HG4J 4LVNC 2VAJA 3E2HB 4OLUH 4RIRA 2CLVB 1OAXH 4J4PC 1RZFL 2B39A 3KJ4C 4LEXL 2E7LC 2DM4A 2DQGH 4YHZH 4M3JA 3LEVL 1T21B 2F5AL 5EOQH 4M62L 4UV7L 5D71H 5LAXB 1U3JA 2X4UA 1CXEA 2I60H 35C8H 2YUXA 5KVGH 1IEAB 3GJEB 5DO2D 5MEPB 1G7IA 3EBAA 4PJXF 1MRCL 4MAYA 2EE3A 4JPIA 2I07B 3Q1SH 1UKQA 2E9WA 5FYKL 1JGDA 1VGEL 2HYMA 1AGBA 1WBYB 2K3TA 4RDQF 3QXAA 4RMQA 3EKCA 2APWA 3PL6D 1CQKA 2JCCA 4JZOB 2EIZA 1G0XA 1NC4D 4QRTB 1YDPB 1IT9H 4WWKC 5F6HI 3OGOE 4G6KH 1KIRA 5I1EH 4HS6A 3G5VA 1TZIB 4KQ4L 4N8PA 2JJSC 2AQ2A 2ZNWA 5BRZA 2BP3A 1KNOA 5DUBB 2X2YA 1G9MH 2Q7NA 2IFFH 5KVEL 1JZ2A 1PD6A 5F7UA 2IPUK 4OI7A 2P8PA 3MLWH 3PWPE 5GISH 5A2JH 4WW1B 1J5OH 4KJYB 4E0RA 5I8CA 5F9DC 4FZ8L 5IVZA 3W9EB 4ODWB 1NEUA 4RGNC 3B9KB 3L3OB 4MD4B 1B2WH 1G7QB 4YK4B 2VDKL 5E70A 1A22B 4JFDA 3D0LB 1LD9A 1GSMA 1CDHA 1JTPA 2BCKA 4G8EB 5FEBA 4MQ7A 1AO7A 1WFOA 4HW6A 3UZEA 2P5WA 5ILTH 4QRRB 5B3JF 4UNTA 3QDGD 4OB5H 1U3ZA 2BDNH 4WW2A 1RK0A 3MGOA 5DWUH 1I3GL 3GSRA 2X4NB 5CGYD 4YPGB 4RCAA 1RSFA 3EZJB 3PWUB 3W0WD 5B39A 1QKZH 4YHKH 4IRJA 4GSDL 4M7LL 5I17A 1L0QA 3VD4A 1TJHH 1FNLA 4P2YA 3U7WH 3VMNA 1PG7X 3L5JA 3S88H 3VJ6B 1T1YA 8CGTA 1R5WA 4FQ1L 3W2DL 3SE8L 1LO5A 2IMMA 2NY5C 2W0FB 3HMWH 4RGOH 4RWHA 4MXWH 2NXYB 1CK0L 4DGIH 2NR6C 4GG6B 2H32B 2FLRT 1GHFL 4X4ME 2PCPA 1ADQH 4UV4H 2R56L 2VLME 4PJAB 1UZ8B 2WINB 4FNLH 3RHWF 3T0AA 5C9JB 1LO3L 3SE4A 1F42A 4DAGH 1G6RA 3ARUA 5KG9A 1EMTH 1UH2A 3UTTB 1J8HA 4YE4L 1CE6B 3WE6A 4JRXD 2OL3B 5J6HB 1MIEL 5DYOB 1LNUA 4NNPH 4J8RB 1KCUH 1OARH 1TPXC 4W4OA 1MCNA 2BY0A 3MQIA 1FNEA 4HK0A 3U46A 3U36B 1KN2L 5DJXB 3RU8H 1RZJL 1C1EH 1AGDB 1I8IB 1ZTXH 2FX8L 4XPFL 4CMMB 1IJ9A 4J3OC 8FABB 5K9OB 3SDAB 5GS1B 3T4AA 4F58L 4NKMA 5T3ZL 4GQ9L 3EJYD 1A6UH 3OKLA 2QKIA 1QEWA 4FG6D 4AIOA 3K81A 1YEKL 3OR6A 4KK5D 3KJ6L 3C8KB 3DGCR 5IKCA 1H3VA 4I0PB 2JCCE 1D6VH 1JNHA 2AI0L 2BOBA 1CD1A 1F4AA 2HTLC 4KI5F 1EBPA 3O8XA 3VRJA 2VOTA 3IFOB 3RGVC 1DEEB 2VMFA 5HTSA 3ZE2E 1KJ2H 2CMRL 3CVHA 2DWEA 1IBGL 1UH4A 2IH1B 3LKOB 5BRZE 2ZSVA 4YHML 1J10A 4UDUB 4EKXA 2W9DH 5GGVH 4K23L 1LDPH 1Q9KA 4NKDB 4ZUSB 3NBNA 1XGPA 4WHTB 2ZKHL 2G5RA 5D96C 4JFDE 1A1NB 5E03A 2IGFH 1K8DA 4R4ND 1WZLA 1HHIA 1NFIB 3WUWG 3BKYL 1AO7E 4K8RC 4QXGH 3SKNB 5C2BH 2P5WE 5H2BB 4LVEA 2CLVA 2VL4A 5FGCB 1JZ5A 1HN1A 2OP4L 4FQXD 1Q9OB 3U0WL 5IF0B 3OGCA 3PP3H 2NW3B 3QIWC 2E6JA 4NQXB 1T21A 3V4PL 4RWYH 2YA2A 2VDPL 4ZOAA 5LAXA 3PNWB 3SKJL 5D7IF 2CDFB 2VABB 1IEAA 2Z31B 3GRWA 5LGHH 4PREB 4UUJB 4M1GL 1YYLH 4F2MB 3LEXB 4KI5C 5BMFH 1UM6H 1MSPA 2I07A 4NJAL 5F7HA 2WWMD 4GAGH 1OM3L 4O02L 1WBYA 1UADC 2AAVA 3O6KL 4JZOA 3S5LB 4UTAH 5CGMA 4QTHB 4QRTA 1YDPA 2QL1A 1U8HA 3QPQD 4LLWB 1GYAA 4P0DA 3SQOL 1TZIA 4LRIC 2NCMA 3EW3B 4PLKC 2CRYA 4OLXH 5BW7C 1N5AB 4OCXL 4N8CL 2XG4A 4Y19D 3ARTA 5DUBA 4ELME 3H2WA 1CCZA 4HKJB 1J8HE 2HH0L 5C0RH 2XZZA 5DD3L 5GGTA 4WW1A 2AJXH 2O5YH 3GBNH 4YX2H 1QR1B 3FAWA 3INUH 4KJYA 5EU3B 2WUBL 4RISL 3W9EA 2YPVL 4M1CD 1D5MB 2VSDA 4GRWE 4ODWA 1P84J 2GITB 2AXFB 3B9KA 3L3OA 4MD4A 1G7QA 1ZA6B 3QEGL 4KZEH 2DJSA 3SKOB 3D0LA 1W72B 2R29L 4G8EA 4K9EH 4V1DB 4NN7B 5HHMB 1CU4L 3BRGC 5F7FA 4QRRA 4WU5B 4WGVB 3RWGB 3HUJF 5JXED 2X4NA 3GI9H 4JLRB 3IS1X 3B6SB 4YPGA 1EFXD 4JFQB 5T5NG 3PIQB 3LHPL 4KRMB 4ODSH 1N6VA 4M4PA 2GK2A 3JTSB 1DFBL 2YA0A 1GRWA 4DGYL 1FIGH 5HVWA 4ODHH 4TRPH 1E6OL 4M9OA 4RMRA 4C4KT 2EYTB 3VJ6A 4Z7UE 4Y16B 4TVSa 5FK9B 1LO4L 5I1DB 2W0FA 2WAHA 5CHNB 1TITA 4XCCH 1FFRA 1D9KB 5EWIL 1D5XB 1M6OA 5AG8A 1X5FA 4ZD3L 4GG6A 3C2SA 2H32A 3LOWA 2CJUH 3KYKH 5C0EB 4ACPA 2BVTA 4F80A 4P2CG 1U3HB 3GHEL 2P4AB 2MCPL 3FRUA 1YEHH 4PJAA 5F1SA 1UZ8A 2WINA 5MEQB 3MUGB 3QI9C 3D39D 5C9JA 3DETD 1DQJB 4PJGB 4AEIH 3UTTA 2WBKA 3RHWK 3WKML 4ERSH 2XACC 1CE6A 4TVPD 4XP5H 2OL3A 4JZJC 1HYSC 3LDBC 5J6HA 43C9B 5DYOA 5I8KL 3NH7L 4H1LG 2R0KL 4J8RA 4MJ4A 5D1QA 5T3XE 4PJHE 4XAKD 1VPOL 3U36A 1K6QL 2OSLB 5D7KD 5DJXA 4OFKA 3DO7B 2CR6A 3FOMB 1AGDA 1I8IA 3O4LB 2WBWB 4CMMA 2CIIB 5IW3A 1FYTD 1RJZB 8FABA 5K9OA 3SDAA 5GGQH 1OP5K 1GGBH 5GS1A 3F7PC 2ICWB 4HKXB 1KCSL 2MHAB 1SEQL 2W91A 4U1SB 2WIMA 3P77B 2V5YA 3RWIA 3HLAB 3IYLW 3C8KA 5JDJA 1CDIA 5FF6B 1TTFA 4I0PA 4M00A 5HGHB 1VCAA 4UOW1 1A6WH 1JRHH 1ZSDB 4OIAA 2JB6B 3X3GL 5F9WB 3IFOA 5IBLD 2VLKD 4G7YL 1DEEA 4D0BA 5IJVB 3QCTH 1J86A 2M1KA 3MV01 5FYKU 2BX5A 1KUMA 2CKBL 4X6FB 5IBTH 4Z8FL 2IH1A 3LKOA 5DQDH 4G6FD 2NY0D 1OSPH 3MO1B 5HDQL 4MS8C 2E7MA 4S1SL 4UINH 4UDUA 2KH2B 3LMJL 4IIQB 1NCCL 3CLFL 2EXWD 1UEMA 4ELKB 4NKDA 1KIQB 3A6BH 1X9QA 4ZUSA 4X7FC 1DBJH 4WO4B 4Y8AA 2FHCA 3OJVC 1YNKL 2QEJA 2GIYA 3NAAH 1A1NA 3KYAA 1SVZA 3IU4H 1NFIA 3SKNA 2PTVA 3E1F1 5GHWH 4QRRE 3LY6A 3IRZA 3RVWD 1Q9OA 4K71C 5IF0A 4YQXL 2CDEB 2NW3A 1EFQA 3HN3A 1TNMA 1HKFA 3ZHKA 1OPGL 5HI5D 3BE1L 3PNWA 4XPBL 3ELAT 5D6CB 2CDFA 1MOEA 2VABA 2Q7YB 3BZEB 4UI2A 1AJ7L 2Z31A 3ARGB 3RTQD 4UUJA 1T89C 2A0LD 3C5SB 4F2MA 3QWOB 3WFEH 2DB8A 3LEXA 5GS0L 1N6QH 4GLRH 2X05A 5EUKB 4A2LA 3ESVF 3AC0A 5ALCL 1A6VL 2B4CH 1RV6X 3NGBB 1FDLL 1YC7A 3RBSA 5DF0A 3C08L 5DEGB 5CJXA 4F9LA 1Z3GL 4CNIB 3VXQA 3V95A 4GG6E 2F8VA 4QTHA 2RAMA 4YHYC 1J18A 2PUQT 1CGWA 5EU6E 2BY1A 1N64H 1OT1A 4LLWA 3C09C 4YXHL 5HD8C 4MZ3A 4ODBD 3P4NB 4PJAE 5L0QB 2DTMH 1N5AA 4BSVB 3FRPA 4GBXC 5B38B 1DQDL 1MNUH 5E2TH 3GMOB 3RUGE 1FNHA 3QEQD 2YD6A 3SKMA 3SGJC 1QR1A 5EU3A 5SX5H 2AJVL 3GMMB 1OD7A 5I9QB 4YBQD 4QGTA 5FYLH 5E6ID 2GITA 2Y36L 3CCHB 3WXWL 4F9PC 2AXFA 3V4UH 4DJMA 3JV4B 5F9OL 1ZA6A 1WWAX 4UU9B 1KB9J 4NC0B 5EU7E 1ORQB 2ZUTA 3SKOA 1GCFA 4V1DA 2UZIH 4B53A 2K9UA 1X4YA 4P2QA 4S10A 3HFMH 4DKEH 4WU5A 4M43H 5I1KL 2EDHA 4JFOB 5DD0H 2XQYG 2JJUA 3MR9B 4JLRA 1RUQL 4JFQA 1F58L 1KJVB 1XGTB 3ARBB 3JTSA 3WN5B 1EJOH 1X5YA 4HGKC 4NM4L 4NM8L 5HI4D 2QSTA 2EYTA 3W11C 1IC5H 3HE7D 4MXVF 4Y16A 3MBEC 1JGVL 4ZFGL 4JQXA 5I1DA 1A5FL 3FJTA 5A2LH 1R3JB 2UUDK 5CHNA 1CYGA 1D9KA 2UVFA 5SX4I 1D5XA 2OTUB 4P48A 3CXDL 1GAFH 4YDVB 1NCDH 4Z77B 1XIWB 4LCYB 1YQ2A 5C0EA 2VXVH 2ZCKH 2OK0H 3D3VD 4N1HB 3MLUL 1U3HA 3I2CL 4PGBB 1RUAL 3WSQL 1BM3H 2FJHA 2XICA 4WEMB 4HMCA 1DQJA 4PJGA 3AB0C 1FE8L 4P5MB 4GW4B 4RMWA 4NQEE 3P73B 4W4NA 3V6FB 4Y88A 3EYQD 1AI1L 5FGCE 3MV9D 4JVWA 43C9A 1CS6A 3MGTB 1M7IB 2YA1A 3EYUL 3MNZB 4UAOB 3GIZH 1A7PL 3QO0B 5T5FL 4NWUH 3KR3L 2J88H 2VR4A 2OSLA 3TWCH 1ZT1B 4X7DC 2HFFB 3DO7A 3FOMA 1TJGH 3O4LA 2VYRE 3GSXB 3EOAB 1RJZA 5F3BB 3TFKC 2ICWA 1U8OB 4ZS7H 4HKXA 4HX1B 4JPVL 1GL4B 2MHAA 2C4FT 4U1SA 2ZUYA 1U6AL 4YLQT 5I1CH 3MFGB 4BZ1H 3GSVB 2PO6C 5FF6A 4GG8B 4X5XB 4X8JB 3FQNB 4XPGL 5HGHA 3F7RA 5HPMA 2DL2A 2DD8H 4JQVC 1UCBL 1ZSDA 3MLTB 5CEYB 2JB6A 1A7QL 3EYVB 2C7UB 4NGHH 5DXWA 5IJVA 3I85A 2DKUA 4NC1E 3SDXF 4X6FA 1DLHB 3MUHL 1M05B 5CBAB 3MO1A 5C0BB 5CJBA 4LVOC 2D7MA 2DBLH 4IIQA 1H3GA 4WEUD 5IMMB 1XF1A 4ELKA 4R2GB 4LHUG 2F19L 1KIQA 2WQRA 3NABL 3O2VH 3TH2T 1UJ3A 1XGYL 1GOHA 3HC4H 5C1MB 4FXLA 4O4YL 5DUPL 4Z7QE 3P3YA 4V1DE 5HHME 3PJSB 4EDWH 1U8NB 3PL6B 4P2QE 2ED9A 4HMDA 1IGIH 4OBSA 4KRLB 2EZ0C 3CDGB 4IRSC 1UWGL 5B8CB 2FO4A 2CDEA 4HT1H 4NO3B 3SKUD 4BK5A 3QG7H 4HFUH 3CNKA 2JELL 4CN4A 3S35L 4ALAH 5D6CA 4JQIH 2Q7YA 1T03H 1HHJB 3BZEA 3ARGA 1YEDB 4YDIH 4EBQH 1YUHB 1JHLH 3O2WH 1TDQA 3C5SA 4ZNCD 3QWOA 3UX9B 1LP9B 1U42A 3HNVL 1GGCL 1ZVYA 5C0CD 5LBSL 3QRGL 2J5LB 4XX1G 4IDJH 5DEGA 4DN4L 3CXHK 4CNIA 4HMEA 1CR9L 1BVLB 1RFDH 4UT7H 1I9JL 5IJKA 1NGYB 4GAYB 2P7TB 4JRWA 5KANI 3QDGB 4Z78B 4NN6B 4H88L 4NQCD 1Z9SA 1NCBL 5EUOF 1JZ6A 3S3PA 3P4NA </