1KTMA

Solution structure of fat domain of focal adhesion kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
b'MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Insight into the Mechanisms of Targeting and Signaling of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 53
structure length 139
sequence length 139
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ktmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ktmA02
3C8GA 1K04A 3JYYA 4EBKA 2H88C 1ZOYC 2L6GA 2L6FA 1WOLA 1K05A 3C8GB 2L6HA 3GM3A 3RQEA 3U0CA 1QVXA 4NQFA 4XEVA 2PBEA 3S9OA 3AE7C 2LK4A 2KK1A 1OW7A 3AE3C 3TULA 3AECC 4YTPC 3AE4C 1PV3A 2G3AA 1O3UA 5F28E 4XEKA 1YQ3C 2JX0A 2YWAA 3SFEC 1KNYA 2HSBA 3AE5C 1WWPA 3L8IA 2WQYC 3C18A 3AEDC 3C8GD 1V4AA 3K7DA 1K40A 3AEBC 1KTMA 3MFNA 3AE6C 3AJMA 3GM2A 4R32A 3AEFC 3AE8C 1ZZPA 3AE1C 3AEAC 1UFBA 4EBJA 3AE9C 2Q00A 2H89C 3JZ0A 3BRJA 3SFDC 4XEFA 3L8JA 1WTYA 3AEGC 3U3FA 3AE2C 3B71A 3RQFA 2JPUA 1ZP0C 2FBWC 1OW6A 1YQ4C 3GM1A 3ABVC 1OW8A 3O10A 3RQGA 1JOGA 3AEEC 4YXDC
chains in the Genus database with same CATH superfamily
1FDMA 3U2LA 3RK2D 3C62A 3WHNA 3TGUJ 2HODB 5AVSB 2LIGA 3F46A 3K1IA 3K6BA 2L9JA 1KILE 3FAPB 1T2KC 5DJTB 2FYZA 2BCCJ 1ORYA 2AU5A 1PPJE 3V2QA 1QKRA 2B0HA 2J7PA 4U5DE 3B5NA 2Y9YA 3DE8A 1TWCA 1SQBG 3MTUE 2HUJA 3DM9B 4GODA 2HYNA 1Q0MA 2IZ0A 1IFIA 2LK4A 3LS1A 4W8KA 2QJKC 2E87A 1AFOA 2Y3GA 3ZWIA 2A06E 2HLOA 1EKYA 1EQ7A 1RH5B 2Q1KA 3AECC 4KBLA 4YTPC 5KLVJ 2ZT9B 1BSHA 1V55C 3H1IE 2V26A 3L73G 2P0NA 1TFOB 4IARA 3RL0C 3U59A 2K1AA 1CPRA 3F89A 3TNUB 1KB9I 1QZXA 2WL8A 2QA4P 4YPCA 1HW2A 2W6AA 2DW3A 2YLDA 1DD3A 3EFOA 1OZHA 1C03A 1HUCA 3ITKA 1MMGA 5A6BA 2UUIA 1EXIA 3E70C 3H1JE 3M4BA 3AEBC 2FFDB 2WZLA 3FWLA 1OKKD 1Q86Q 2YVKA 4CJGA 2A6EF 1ZW0A 4NPEA 4CIHA 3S90A 1L3PA 2XM4A 3QWOC 2YL3A 3W2VA 1NKNA 3EFFK 1M6TA 1UFBA 3V2NA 3FAJA 1S2EA 2FYUD 2KK7A 4EBJA 3E9VA 3O6QA 1G4US 2XLDA 5L0GA 2A06D 1LKXA 2M3EA 1EDKA 2H89C 5KYUA 1YLMA 1MMAA 4DJ9A 5AC4A 1OR3A 1SLQA 5KYWA 2CCYA 4BPMA 4TT3H 1ZV8A 1ZHWA 4RO0A 4H44C 2JDIH 1LS1A 3H1LD 1S9KD 4JQ0D 1QPUA 1MFZA 1YHQP 1NTMD 1S4XA 3ABVC 1GK4A 3TD7A 5APXA 1UIXA 2ZT9D 1BR4A 1G5ZA 2CK3H 1O87A 2DI3A 2GA0A 3UIAA 4J32B 3U1CA 3J06A 3CX5H 5COGA 5K0IA 3BVHA 1A7EA 2OYHB 1ZOYC 1OQCA 2K9JB 4O9BA 2XS8A 1NOHA 3RK3C 1YYCA 3QMKA 3AGUA 3P8CD 1YI2P 4FAPB 2IYPA 1N7SA 1Y6DA 2J46A 2H43A 4MVSA 1G2CA 3UGPA 1D0XA 4D6TD 1NLXA 4RJTA 1RE3A 4B6IA 2V4HA 2W83C 1OX3A 1RF1A 1KB9E 2AXTH 1CGOA 2O1KA 3HD7C 4YWQA 2QRXA 1KFMA 4G0HA 4BWNA 2LXCB 1LTTC 1HBWA 4LERA 1NAYA 4Y28J 2CDQA 4BJ5C 1RHZB 4GOFA 2LP4A 2P7VA 2UUHA 2XL8A 3BRTB 3EQLF 5KJ7A 3G4XA 2Q9CA 1KYOH 3L1MA 1AVYA 1CPQA 1BE3G 2KJGA 2RMZA 1S5LH 1PL5A 2NUPB 4DOJA 1CI6A 1FBMA 2FYNB 1C02A 3JCUE 2KW3C 3E1IA 2FYUK 2A0UA 1AVOA 1RJ9A 3AGTA 3L8IA 4HE8D 4D4NA 3ZG1A 2AEJA 2KB7P 2M4EA 4F4BA 4OGQB 2HPCB 1YA7O 1SQVJ 3GWLA 1NU1G 1Q81Q 1T6QA 3L75D 2HSQA 2XU6A 2OARA 1Q82Q 3AEFC 2KSJA 4IFMA 1P84D 2J9UA 3DM5A 5K5GB 3AE1C 1Q0DA 1D1BA 1IK9A 3BASA 2A45H 1NTMK 1SFCC 4DJGA 1M2VA 5AVQB 2IXMA 4DVYP 1FZBA 1DD4A 2LD6A 5KYXA 1SYQA 2HV6A 1M1JA 1T6UA 2W27A 5APVA 3H32B 4L75A 1WTYA 1NU7D 2AXCA 2G8YA 1FZAA 1VQ8P 3RFYA 3RQFA 1VL2A 2N1TD 3B0PA 4AX2A 3EFGA 2PX0A 3VMZA 3PCVA 2R44A 1LS4A 4BG0A 3EGXA 3ABLC 1N86A 1RE4C 3AEEC 1WATA 4Q7CA 3I5QA 5DQTA 3JYYA 2KNCB 4ASVA 4DT0A 4A2NB 2J9WA 3L71J 3U2MA 2J5UA 3TOLA 5KLVK 1DEBA 3C9IA 5BVZA 3EPVA 2KUBA 2YZSA 1NTZG 1RF0C 3IHUA 4MVRA 3ZQYA 3H1HE 4D4XA 2K37A 3GM3A 5APWA 3DKAA 1FU1A 3TK1A 2R05A 2R03A 1FMVA 1MQVA 3M1CB 1LI5A 4TLFA 4OGQD 5APUA 3L70J 1A7DA 3C8ZA 4DRIB 3VP9A 1SQBD 1RQUA 3H65A 3AOUA 1JR8A 1GW3A 3AE3C 1U6HA 1Z56A 3C63A 5E3CA 1AQTA 4MTOA 2W45A 2QJPB 1I4YA 2G3AA 2NPSB 2YLIA 4NTFA 3GHGA 4MVUA 1NVOA 2OQQA 1J1DB 3L73D 2AP3A 3ASOC 1VQPP 2A6HF 2Q3EA 3EHNA 1A41A 3RIPA 1J8YF 1VF5C 3HUSA 1TWGA 1VYKA 3K33A 3WU2H 2YIUC 3T4RA 2R02A 3VN0A 2Y3BA 3M79A 3II6A 3GM2A 1J1EB 3DMDA 3TDKA 3CLQA 4ZKUA 4J7TA 4PJ0E 5KAFE 1T01A 2R32A 2QSIA 3GLMA 4OWFA 5BQIA 1KMIZ 1L0LE 3QW0A 5JRAA 2CPBA 1ZHXA 2OYIA 4ZLDA 5F5HA 1URQC 4NTBA 4DZOA 1JMMA 1MMNA 2OGUA 3HTKC 3CXHI 3FGAD 3B29A 1HH0A 2XL4A 3MUDC 3HLZA 2NPUA 1LWUC 3S4RA 2FKWB 5CCGD 3V7OA 2K3RA 1N73B 4XPYA 2E5TA 5E2QA 2A45G 4DXWA 2P10A 2E76B 3JCUQ 1BDJB 1SQBK 2C0XA 3CX5I 2W4MA 1OVUA 1L0NJ 3W8IA 1BDDA 4JCZA 4H13C 3JRMO 4MVOA 3EG9B 2WZGA 4NCQA 4IAOA 1KQLA 2E74D 1LT9C 4PD4D 3T6JA 4KNVA 1KN7A 2P2UA 3RVZA 3H1KJ 3HNKA 1NH4A 1GU5A 1T2KD 1VDFA 5C39A 1SQVK 5D91A 3HE5A 3K1IC 4JYCA 2W6BA 1JNMA 4NC3A 1KYOI 5AW9B 5L0JA 1SQPJ 1Y47A 2C04A 1HJ0A 2SPZA 2CNWA 3B5NC 2DGJA 2HSBA 3ZVRA 1BE3D 3RVYA 2XSEA 4PJNA 1ZR4A 4WY4B 4PV1C 4N6CA 2Y69C 2W90A 3RL0D 2HJMA 3KXDA 2VC9A 5L0CA 3M0AA 1OFCX 2LXBA 2P1AA 2B87A 3T97A 4HEAJ 5CJ4A 4LACB 5DS4A 5T3TA 5L3QA 3EQ2A 1NU1D 2L7AA 5CCHC 1SFCA 1Y4CA 2E76D 3K1HA 3CXHE 1FOSF 1HGZA 4NTAA 3NFQA 3EZHA 1HE1A 3DI5A 2O01N 3AE9C 3SSUA 5AVZB 2KYHA 1FE6A 3H2UA 3EZIA 2A45I 2LFDA 1LTJB 3A0BH 4K3AA 2QTVA 5APQA 3FHDA 1JCCA 4LLHA 3NDBB 1GL2B 1RQVA 5B66E 3WAQA 2RN0A 3G6EP 3L72E 4FWVA 4AL1A 3GG2A 2MKVA 3BATA 1JOGA 4GYTA 3A2AA 4AUWA 3LESA 3SWFA 3IFMA 2J0WA 3C8GA 3B4SA 1IK7A 3W4YA 2ETSA 5E33A 3M4CA 1MUUA 4H44D 1SQXJ 1NO4A 5KLIB 1WOLA 1CSBA 2FGYA 3M9BA 5APTA 3LEVA 3X2QC 4IB4A 1KORA 2OTLP 3CWBJ 3MP7B 1NTZD 3CXHD 3P8MC 3LNRA 4U3FJ 3GEHA 4IJJA 3CAXA 4WY4D 4I7ZB 3TGUG 1EC5A 5TJHA 3I56P 3O39A 1E5WA 2XLEA 4EDFA 1OW7A 3CSKA 2BCCG 5GTHH 3SNHA 3RK3D 2YXQB 1WRGA 2QG4A 2ZAEB 3LJBA 1R5LA 5AVXB 3CX5D 1VTMP 4A4AA 4GOEA 1LT1A 2ZVOB 1YITP 2YEVA 3QVYA 3HD7D 4IRUA 5KLVG 5IY5C 3A0HH 1RE3C 3N7NA 4FESA 3GANA 1LP1B 3ATPA 1CW5A 1TQGA 3PH0A 5KKZC 3AQBA 3L74E 1VMAA 2JP3A 3NMKA 3D71A 4HH2A 4E7ZA 5AW7B 3N2ZB 2Q7CA 2EPLX 1S3JA 2R9RB 1PP9J 1VQKP 4P6IC 5KJ7C 5TISE 4CS9A 4AE4B 2E75C 1S05A 3DXJF 1KC8Q 5CI8A 5B1BC 3WUVA 1KYOD 2A68F 2ZXWC 4G7OF 2WMMA 4IGGA 1URQA 1BGYE 3KH2A 2MWQA 4R4MA 1NBBA 1KILA 1NTKJ 3SFDC 2ZXRA 4I3MA 1ZRTD 4N06A 1L0NK 2POHA 256BA 2IM8A 3PHF2 2JPUA 1NJIQ 2XLOA 2FBWC 1SF8A 3TJ5A 2D4UA 2HODA 4XWJA 1VQLP 4EIYA 5EGYA 5B3SC 1HMDA 1BCCJ 2PNOA 2ZYDA 4YL1A 4U5CE 1NSGB 1C17M 4NPFX 1KFNA 3K5BA 1FFHA 1VF5B 1YJWP 5KYYB 5AVRB 1M57C 3VM6A 1YVIA 2L6HA 1LTAC 2YIUB 1RKEB 2PAJA 5B5EH 1QVXA 4CDYA 3SXKA 1SQPK 2KLUA 3H25A 2XKMA 1K9MQ 2KLVA 5DVWA 3TF5A 2CGEA 4EIJA 3O8ZA 4WB4A 1T3UA 1KZUB 3KHUA 1OCOC 4CDVA 3MZWB 3H1IJ 1K8AQ 5CBNA 1Z3IX 2XLWA 1RKCA 1Z7Qc 5L0IA 4UB8E 3U9JA 2KXPB 2E43A 4AQRD 3UMIA 1YYJA 3P7KA 4PACA 3A9CA 3K66A 4HFKB 1JRAA 1ZXGA 3OAKA 1LIHA 1JY3O 2FFDA 1K73Q 1KNYA 4P9FA 3EGDA 2WSFJ 5T3WA 2R7XA 2EPMX 2M8RA 5AW4B 2FYUE 2R7WA 1D1AA 1JB0J 2JEEA 2VH3A 4XQ1A 3V5YA 3H1JJ 5DS6A 1KTMA 4BJTA 2DYSC 5E79H 1P84I 2OEXA 4U5BE 3V2PA 5CCHA 4Y99B 2OTKE 4RDAA 2QJYC 3GHGC 3N0TA 3Q6NA 2MJZA 3H1LE 1S9KE 1BDCA 3W8HA 2IOQA 1NTME 3M91A 1ZU5A 1VF5D 2WT7A 2OG2A 1SQVG 1X9VA 4HKZH 2B89A 3CPWO 4UB6E 1L4AA 1NFOA 3DE9A 2NZ2A 4ULWA 2ZXOA 3Q5RA 2ZXEB 1SQXK 3HUSC 3VMYA 3AEGC 4PFPA 4JTAB 2YL0A 1OVRA 2IDBA 2GA1A 4GKGA 3Q6MA 2GUSA 1ZP0C 1YIJP 3GMAA 4E7SA 1SQQK 3P8CE 1LVKA 5COFA 3FXDA 1YJNP 3I4UA 1EA8A 4D6TE 1GS9A 2G3VA 3CD6P 2X0CA 4AK9A 4BRYB 4N6HA 2OYIC 4QMAA 4Z9IA 5F5FA 1FZCB 1JMWA 4U5GA 1A02F 2P61A 1NGMB 3NKDA 1E86A 1QQ3A 1N2DC 5APYA 1FC2C 4Z9JA 3CMAP 4CX9A 3U0CA 3EH1A 1OIPA 3DWWA 1QL1A 2Y3DA 3L71G 3MLGA 5AW8B 3RBZA 3US6A 2KK1A 3CMEP 2VB6A 2NRGA 4CS7A 5B3IA 1MFTA 3TGUD 1ZHTA 1E83A 2Y0DA 5AVYB 4J30B 3GF3A 4I1LA 2NUPA 3EFOB 3KZIH 3RH3A 2BCCD 1FZFA 5F28E 4I44A 1S1CX 1N7LA 2D2CC 5D92A 3KMIA 1YTZI 3L70G 1YBKA 5JUAA 3L75E 1E85A 4LGDE 4C7RA 2IYLD 2LR2A 1P84E 2HPCA 1OCZC 3CI9A 1HW1A 2IZ1A 2N1TB 2NUTB 3FXEA 1ZYRF 3PJSK 4H54A 1PD0A 5KLVD 2PP4A 2P6VA 2JD3A 2LQGA 3O6QB 1LE2A 5GTIE 1YZCA 1ZU4A 1JTHB 1S5LX 2QY9A 3N24A 5KYUB 4MVZA 3CCMP 2J7PD 3B5ND 2XDJA 5CMZA 2IFMA 4PFOA 5JP7A 1FFTC 1F1MA 2CW0F 4KI2A 4XLPF 4ZMDA 4X0RA 1M7LA 3SYNA 3V4QA 4E18A 4PV1D 1TWAA 3V5XA 3WG7C 3BCCG 1MMDA 3NYJA 2MYSA 4Z9HA 1MNDA 4ONSA 1JM0A 1HGVA 1M90Q 1PIXA 3BRVB 3GM1A 1JY2P 1A02J 4JF7A 3T6BA 1TKNA 4UDVA 2FY8A 3QW1A 4N6JA 4XPWA 1T9KA 3O55A 5H2FH 4IFFA 4YXDC 2M3BA 1N7SB 3WUUA 2EIJC 2RD9A 1GW4A 4O6NA 5A6BD 4YJWA 4O7GA 1JY3P 1LPEA 1UG7A 1SQBE 1BR1A 1RF1B 2V7QJ 3H1HJ 1M56D 4IWBA 3HNLA 1T8ZA 3D6ZA 3KPEA 3UMKA 4O6YA 4PR9A 3IEEA 3L35A 3U1AA 4K0DA 2Q7RA 2XV5A 4PD4I 1YA9A 3IQCA 3RKOF 4GQHA 4RESB 2KZJA 3L73E 3AG1C 1E2XA 2NPSA 1NKZB 3G4ZA 1FS0E 2YO3A 3DAGA 4WGZA 1L0NG 5M1BA 1WN0A 5EHHA 1Q2NA 4JVSA 4KJMA 2WPRA 1CI6B 5AGFA 1QX8A 4WWIA 1XZPA 4YN0B 3SWKA 2YL1A 3A3YB 2ZD9A 4C3EA 1HE9A 2KS1B 4P9TA 2WVQA 2WPVB 3U8PA 3FDQA 2WVRA 1X8YA 2J0XA 1GU4A 3MYFA 3LNMB 1T3JA 5DJUB 4ZKPA 1W2EA 1GZLA 1M2VB 1SQPG 1NAFA 3S27A 3AE6C 3HE4B 3V5ZA 3RYLA 3ASNC 5KYXB 2QVAA 4L73A 4GEHA 2H7OA 1N7SD 3CCUP 1M1JB 3WUTA 4H0LC 3PMRA 3NMJA 4YT4A 4K7BA 2KP8A 1L0LJ 1IFMA 2QUPA 1AA0A 2CPSA 3I5CA 3SXYA 1OWAA 3USSA 2CYDA 2H8AA 2H7BA 1RY3A 4IL6H 5DQZA 3BRJA 3VTPC 2H7HA 5KAIH 1SQVD 2E74B 1FZEA 3G71P 3EGXB 2GFHA 1EZVG 5KJ7D 2E75D 1LM3B 3B71A 3LIEA 2IXNA 1LE4A 2ITAA 4L74A 2Q9IA 1ZHYA 2DYRC 4JCHA 4CS9C 1NFNA 1EDJA 1OVVA 1R4TA 3T6GB 4CIPA 2XM0A 3MX3A 4PD4E 2OQMA 1LI7A 2PP6A 1QSPA 3EG9A 5DLJA 1V54C 2J58A 2M64A 2QJKB 4ASWA 1GTWA 4I1OB 1KILC 2WITA 2HR3A 4DRHB 1H89A 1JY3N 1FTSA 2K88A 2WZFA 3NTNA 3LLIA 3RL0B 1T6AA 3IQTA 4JKVA 1H9GA 4NQFA 1DOWA 4XPXA 3UGOA 4JBZA 2ZXPA 1I4ZA 3VAYA 3AE7C 1SQXG 2XXAB 3L71D 1BE3E 3CCJP 2IPPA 3UNGC 5AW0B 1A7VA 3TULA 4OIPF 3CWBG 1XZQA 1M57D 1SQQG 2WSFH 2XNDH 3N4XA 3GF7A 1LTSC 3X1OA 4BEMJ 3AG4C 2JX0A 4YK5A 2LFFA 3HUSB 2Y9ZA 3BCCE 4OVNF 3F47A 1PGJA 3S0XA 1NU1E 2IBZG 3L70D 2OYOA 3OW2O 4OD4A 4PJMA 4U5EE 2PX3A 2ZT9C 3D6YA 3ZIBA 4JC7A 2Y39A 2OU6A 1VYIA 1H0TB 3RGUA 4MW3A 2I8BA 4MVMA 1EZVI 4NPDA 2WPSA 1Q7YQ 1IO4A 3CCQP 2P1JA 4J7YA 3KL4A 2D5RB 3QH9A 5HV9A 2YKQA 1LTJA 4H44B 3U5SA 4U5HA 2YO2A 1SMYF 1TR2A 3LS0A 2HFIA 1GL2A 1WMKA 1NU9C 2FFDC 3KKBA 3L0IA 4CSAA 3MBGA 1PGPA 4W7ZA 2Q3IA 3R4YA 1PP9G 2M0BA 3JRTA 3JTLO 4C7OA 1Z6AA 3BCCD 2J9VA 3R2PA 5AVWB 3L72J 1QLEC 5JLIA 3RK3B 2E5YA 3PRJA 1NTZE 1W2BO 1NTKG 2M5AB 3FXHA 5E3AA 4E0IA 2L81A 3I55P 2NSGA 1AV1A 5AVTB 2G62A 5CI9A 3ABMC 3EH2A 5CIVA 1KB9H 1CGNA 1L4AC 4ZLCA 1TU3F 3HD7B 4CBEA 3RK3E 2WVNA 1KV4A 1JMBA 2TMVP 1BCCG 3CX5E 1CGME 1HJBA 1H6GA 2I1JA 1T5OA 3DZAA 2BEQD 2OYHC 4DBQA 2WTYA 1SVFA 1PPJG 3PP5A 2P7JA 2J9BA 2KZIA 5T1DB 1G4WR 3JCUH 1L0ND 2YXRB 2RKLA 2Q6QA 4WBAA 3Q3DA 2R5BA 2AXTE 1GQAA 3WMM0 3NYMA 3V6IA 3H1IG 1L0LK 4C3BA 1X79B 2KGOA 3H6PA 1KQFB 3L74J 1SFCB 1KYOE 3AQCA 4AE4A 3GW6A 1DX7A 3ZTMA 2D2CD 3MFNA 1S5LE 3AJMA 4R32A 1ZRTE 4M63A 3IR9A 4U5FE 5AW6B 2KSEA 2FYNC 1SQPD 5BUOA 1H88A 3A11A 3H1JG 2B9BA 3AEAC 3RL0g 4N78D 1B68A 4G7HF 4OGQC 1BGYJ 2L91A 2EPOA 4OIRF 4PJLA 2GDCA 4RBNA 1LTBC 3LEOA 1LGHB 4MNDA 2IXPA 1FDIA 1BZ4A 3TK0A 1JUNA 3U3FA 4R4LA 1LTGC 1PFIA 1EZVD 2GUVA 4Q4ZF 1SQQE 2V7QH 4C7NA 3ZDMA 2C9NY 3RQGA 1Y8AA 2CNWD 2HFED 4B86A 3AG3C 1O5HA 1BR2A 4JPZB 3CZ6A 3L34A 2R3CA 3IQ5A 2H88C 2P58A 1S7ZA 2A69F 2BASA 1OKKA 2BE5F 4EHPA 2Q4FA 2JKVA 3TYYA 3HRNA 1AEPA 1K05A 2WSSH 3UR3C 1JO5A 1JAFA 2ZXXA 1YJGA 1SFCD 2KI7B 3CCRP 2R7UA 2WVOA 3HJCA 4I1MA 2VCBA 3SXMA 1FOSE 2FXPA 1SQXD 3DD7A 2Y0CA 1APCA 5AW2B 1D1CA 3LLKA 4W80A 1SS1A 1O3UA 3JSEO 5JVEA 3CWBD 4U3FD 3M15A 1SQQD 1EXJA 2B88A 4YT2A 3KPHA 2Q5UA 3B9QA 1S72P 3SWYA 5L3VA 1KQGB 4N4WA 2UWJE 2FYUJ 4I6MC 3L36A 3C7JA 1HVVA 2VRSA 3NRHA 2QJPC 2HKVA 4PJ0H 2WQYC 5KAFH 2NPSC 3TNUA 3C8GD 2IBZD 4LDKA 4DCKA 3CCSP 3CC2P 3CCVP 4XLNF 4A7PA 1J1DC 1H9TA 1JY2O 5L0HA 2PFXA 1URQB 3AE8C 3H1LJ 3HTKB 1KU2A 1NTMJ 3NKEA 2GWWA 1OXKA 1OCRC 2WB7A 1LWUB 2PGDA 3EWKA 4LC1A 1MKMA 3WU2E 3KDPB 3S29A 1Q0FA 1QVFO 1J1EC 3DJUB 3ZTZA 1SP4A 5AW5B 3L8JA 3A5TA 4OIOF 3MD0A 1PP9D 4H0LD 4JEBA 2I1KA 2R7OA 4YL0A 1OW6A 4D6TJ 2Z5HA 4BRYA 4H13B 3O10A 4EBBA 3R7CA 1FZCA 1FZGA 3IN6A 3ECSA 3W68A 2KQ9A 1VK5A 1LT9B 1NTKD 5CHXA 2C03A 1AJYA 4ANJA 2XLMA 4AYCA 2QE9A 3TGUE 1CZQA 4JTDB 2L6FA 2R7RA 2HJ3A 1LNQA 3KYIA 1USDA 2B0JA 4IOIH 4AL0A 1N73C 1D0YA 2BCCE 3O6XA 3CCLP 2K9YA 4O79A 5BU5A 1XTGB 2OYHA 3T9OA 2E76C 1BCCD 1VOMA 4C3DA 3NMIA 1FNTc 2K9JA 2I15A 3H1HG 3A7OA 1ZVZA 3JYHA 1FAVA 3G9RA 1URQD 1Z63A 3B5NB 1KILD 3CQZA 3VMAA 3MGNA 1XTCC 5KLVE 4GDOA 3EGDB 1PPJD 2WSCJ 3G50A 2PF4E 4PV1B 3L75J 4PJJA 1YQ3C 2FXMA 2N1TA 2GAQA 4MTFA 1L7CA 2NUTA 5HSWA 4FX5A 1OMIA 2N9YB 4RKUJ 2KSFA 1YDIA 2Z5IA 3NMDA 1U0BB 1JTHA 3ITFA 2AWCA 4GIFA 4LLEA 1AUEA 1OR2A 1VQ6P 3H1ID 3CXHH 2ICWG 1T6IA 3SP1A 1FJPA 1GM5A 1QGKB 5L0FA 1J8MF 1H8AA 4Q5SF 1ORSC 1YARO 4HB1A 2ZVNB 2WT7B 2Z15A 3G3ZA 4H13D 5A6AA 4BJ6A 1L4AB 1QL2A 1FDOA 3VP8A 3Q2YA 3IAOA 4YL3A 1GDTA 3NXSA 3KYJA 4WABA 2YHSA 5B66H 2YKPA 4WY4C 3F5HA 2XNXA 5JT4A 4EYYQ 1M8OB 3H1JD 3JZ0A 3SEOA 3FWNA 5B1AC 5AW3B 3HNJA 5JSLA 2IXOA 1FR0A 4K35A 1NTKK 3FOPA 2QM8A 1L0LG 1V74B 2MHRA 3SZRA 1VQ4P 2HS5A 1ST6A 3VF0A 5KYWB 1W5CE 1EDLA 2AWYA 5BQGA 4CS8C 3H32A 5L8RJ 1TWHA 1LTJC 1UIIA 2XRHA 3A0BE 3CEXA 5GPGB 3P32A 4JYBA 1QVGO 3M0DA 4BJ1A 1SQBJ 1KQSO 1GL2C 3EJNA 4CSAC 1YYXA 2NG1A 2GM4A 3QTHA 2Y0EA 2O9XA 1QLED 2JWAA 3MIWA 3M9QA 5CCHD 2WZ7A 4E0HA 2KNCA 3L73J 4MS2A 2Q9AA 1QEXA 4OINF 3Q7LA 1A0BA 3S9OA 1VQOP 1I5NA 2XZRA 4IFDK 3JT1A 3FX0A 5KLIC 3V4WA 1L4AD 2OJED 1G2CB 1OCCC 4NY3A 4K1OA 2KS1A 3AE4C 3AG2C 1GD2E 4BXLA 4CJOA 4KHXA 5KKZB 3C8VA 2FAPB 4OH8B 4I7ZC 2EPKX 4MW8A 2ZPAA 2QM7A 4PK4A 1X22A 1M2OA 3E1RA 1EI7A 5CCGA 1KB9D 4CPGA 3W2WA 2R7SA 5GTHE 2OJQA 1FJKA 5TISH 3HE4A 2HZ8A 2E75B 3AE5C 1WWPA 3AEDC 1V4AA 3NYLA 3K7DA 4DOZA 2KYVA 1JOCA 3FOOA 2EIKC 4JIOA 3OA1A 1SQVE 1ZLLA 1YZAA 3IPMO 3PDMP 1AVOB 1RJ9B 1JPNA 3A0HE 4HFFB 3H1KG 4U9EA 4QDLA 5A6KA 5APSA 1PGQA 2Q00A 4JZAA 1IC2A 3WODF 1IZMA 5EK0A 2X51A 1L2PA 2VCCA 1ZHZA 1VQNP 2AVKA 1Z5ZA 3RK2C 2WSEJ 4YXWH 4HJGH 1MNEA 3I5PA 1NYHA 4H4KC 2KNHA 2JO1A 3C1LA 1N8RQ 3TSIA 2Y3HA 2JWDA 1YQ4C 5A69A 3VOPA 3ABKC 1OW8A 4IL6X 4I2LC 4N3YB 5BU8B 1VQ7P 5BQHA 1NWQA 2O01J 3L72G 2O3JA 3L71E 3GEEA 5AC5A 4JJFA 3LW5J 4JTCB 1N73A 4KT0J 4KNWA 2XXAA 3JC22 2HV7A 4HYTB 3TOMA 4UB8H 3S84A 2LCHA 4IAQA 4XEVA 1OXBA 2RH0A 4O6MA 2A0BA 2XS1A 1OXZA 4EI2A 3CCEP 2R7VA 1BE3J 3L70E 1MZ9A 1HY5A 1JY2N 3G4SP 5AVVB 1FMWA 2J45A 4XE5B 3H1HD 2QLAA 1WASA 5B5EE 3OJAB 3JSVC 3RF3A 4XEKA 4QI2A 3BCCJ 2YMYA 3L37A 2YWAA 1IZNB 1M1KQ 1JEKA 1NU1J 3ZSUA 2IBFA 3IQ6A 1H0TA 2QIWA 2QJYB 3GHGB 2WWWA 3U8VA 3DJNB 1NZEA 2C9LY 3GODA 2YNYA 5CJ0A 4EUKB 4U3FG 4UB6H 3S28A 1VLSA 4U7JA 1GGQA 3SXZA 2RSEB 4LDRA 2W9YA 4RD9A 4BEJA 1HMOA 3L74G 4WY4A 3OA7A 4YT5A 3PTZA 4ULVA 1EDIA 2NPSD 2IFNA 2QNLA 4M3LA 1IFDA 5E79E 1YJ9P 1JPJA 1YAUO 2C0WA 1WGWA 1JCDA 2ZJSE 3TJ6A 1BSNA 1J2JB 4Y99C 2W6JH 1ZW2A 2M5AA 3BEHA 3HKKA 1NHLA 5JS5A 4MN4C 3GEIA 3PLNA 4ER9A 1YTZT 4JE9A 1ORJA 2OYIB 3Q5PA 1BGYG 4CS8A 2BL2A 3PHLA 1NTZJ 2L5GB 1PGOA 1L0LD 3HD7A 3EHMA 2I8DA 3OEOA 4BJ5A 4XA4A 2F22A 3JSZA 4U9DA 1Q90D 1N1CA 3Q5SA 4WVZA 4MTGA 2KIKA 2V3CC 2JJLA 4JRZA 1HF9A 2R7TA 2W8ZA 2R5DA 2XLVA 1L0NE 3KYQA 1U7MA 1U7JA 2W4BA 1PZQA 3RQEA 4Z1MH 2D2CB 3L4FA 2WSCH 2EPNA 2QE7H 3QZCA 3H2VA 4EWCA 2BEZF 1FZCC 2HMQA 1P84H 1Y9BA 4DVZA 3H1KE 4W7YA 1E79H 1G8XA 2IX7C 3VRCA 2PFDA 3M06A 1DH3A 1IFJA 2Q9BA 1ZN5A 1PD1A 2J59M 3W67A 2VASA 3LAYA 5GTIH 5AW1B 2HMZA 2YLGA 2OOCA 1DIPA 3U3BA 1HTLC 1SQPE 4EOTA 3HE5B 3GWNA 5KTBA 2IBZI 3KZIE 4N78E 4JJGA 1VQMP 1TFKB 5EFWB 4L6RA 1K40A 1R5ID 3TQOA 4G78A 1AQ5A 1G1JA 2HG5D 1VQ9P 1M56C 3CC7P 2FYUG 1LP1A 2A06G 2R3SA 1RE4A 2N1TC 4C7OB 3VYWA 2LSEA 5CBOA 3LUTB 1EZVE 2A1DD 3Q7GA 5DS5A 2B87B 3T97B 3ZDLA 3H1KD 2EIMC 2WPQA 4WJ0A 1VQ5P 1RF0A 1LJ2A 1E84A 3H1LG 2Z4EA 4OD5A 1NTMG 1R5SA 1X0TA 2YKZA 1ZMEC 2AEFA 2PRRA 1USEA 3MYIA 1G1IA 3D70A 1WT6A 1R8EA 1SQQJ 1DOVA 1Q0GA 4BJ6C 1SZIA 1KD1Q 1GMJA 3RW0A 1LTIC 1FAPB 3HNIA 3V2RA 1Z23A 4JW1A 2AEMA 1U89A 1PCXA 3CL3D 3ZQVA 1MV8A 4EBKA 1K04A 1HWTC 2YQYA 4LDQA 3M9HA 1SR2A 1DEEG 2FFHA 2L6GA 5COMA 2JR8A 4D6TG 4MVQA 1SQXE 3L72D 3POVA 2IYOA 3C8GB 2ZYGA 5H2FE 2OEVA 1VPCA 3QVZA 2XLHA 1VB5A 3CWBE 1N7SC 3CC4P 4U3FE 1NU1K 2LKMA 2PBEA 4W8PA 2KOGA 3E7KA 3UMHA 5A6JA 2YL7A 4ZNCA 5KYYA 1GL2D 1RF1C 2OCCC 4CDAA 3Q1MA 1D7MA 5TJ5E 3B0UX 3MHVA 4GT1A 4DRJB 2YMKA 3IF4A 1EQ1A 1RKEA 1IFPA 2R7QA 3S1KA 5FCLA 3FVYA 2H7VC 2FXOA 2IBZE 3M0DC 1PV3A 5FZTA 3LIDA 2ZFCA 4QI0A 1IW7F 4WGYA 2QEXP 3RK2B 3FMSA 2YKOA 1D0ZA 5KYNA 3SFEC 2ZYAA 4OIQF 3U9MA 2YRFA 3KQGA 1IFNA 3ZC4A 4H0LB 4EKWA 4YT8A 2KC3A 3NG1A 1GK6A 1VLTA 2XL6A 3C18A 2OKUA 3L75G 4XTKA 2G3KA 1RMVA 3HTKA 2E42A 1W2WA 2O1JA 1BBHA 2OTJP 3MUDA 4G7ZF 3V5BA 5AVUB 1Q0KA 4C46A 2EILC 3RBXA 2N9BA 1LWUA 2P67A 2Q3TA 1ZZPA 1PP9E 3VYIA 1NTZK 2WSEH 4E17A 2ASRA 5CCGC 2DB4A 4KC9A 3L74D 2NSFA 1ZR2A 1RXQA 4C7NB 1IJDB 1U57A 3GORA 4JEAA 4XEFA 4DBRA 3VMXA 2BC5A 1XWJA 1NTKE 1M1JC 1H7IA 4PD4H 4JURI 3OWTA 2H8PD 5L0DA 3DAFA 2EINC 4LLCA 1ZW3A 4XFJA 3AE2C 2O01H 3B0VC 1LT9A 1KILB 3B8EB 4IL6E 3LW5H 4L76A 1RCPA 1NG1A 5KAIE 2VCAA 2R25A 1BGYD 2J8WA 2E74C 4MQ9F 1BCCE
chains in the Genus database with same CATH topology
3C8GA 1K04A 3Q5SA 3JYYA 1IK7A 2E76B 4EBKA 2O01J 1AJYA 2J5UA 2H88C 1ZOYC 4H44D 1TU3F 1HF9A 2V7QJ 2L6GA 1VF5B 2L6FA 3LW5J 1WOLA 3RK3E 1KILE 1K05A 4KT0J 3D6ZA 1NGMB 4H13C 3C8GB 1KORA 2L6HA 3GM3A 3RQEA 3U0CA 4Z1MH 1QVXA 4NQFA 2D2CB 4I7ZB 4XEVA 2K9YA 2PBEA 2E74D 3H25A 3S9OA 2E76C 4OGQD 3AE7C 2BEQD 2LK4A 2KK1A 2QJKC 5M1BA 3Q1MA 2BEZF 5KLIC 1OW7A 1RQUA 3G9RA 2FXPA 4Y28J 1Y9BA 3AE3C 2YMKA 3AECC 3TULA 4YTPC 2ZT9B 3AE4C 3GF3A 4GDOA 1PV3A 3C8VA 2G3AA 3GF7A 2WSCJ 1O3UA 5F28E 4PV1B 1S1CX 2D2CC 4I7ZC 4XEKA 1YQ3C 2JX0A 2OQQA 3Q3DA 1EXJA 2YWAA 3SFEC 1OMIA 4RKUJ 1PL5A 1DIPA 1KQGB 2QIWA 1DD3A 2WPVB 1HJ0A 1KNYA 2HSBA 2WSFJ 4H0LB 2ZT9C 3D6YA 2E75B 3AE5C 1WWPA 2QJPC 5KKZC 1KQFB 2WQYC 3L8IA 1JB0J 1VF5C 3AEDC 3C18A 3C8GD 1V4AA 4PV1C 3K7DA 1EXIA 1K40A 3AEBC 2D2CD 1KTMA 2JP3A 4OGQB 3MFNA 3D71A 1S5LX 2YIUC 4H13D 3U3FA 3AE6C 3AJMA 4U7JA 3GM2A 1ZRTE 4R32A 3AEFC 1FDOA 3AE8C 2QJYC 3IAOA 3Q2YA 1ZZPA 2FYNC 4H0LC 2E75C 2E76D 3AE1C 4H44B 3AEAC 1UFBA 3RL0g 4EBJA 3AE9C 2QSIA 3O6QA 1VF5D 3GLMA 2Q00A 1KMIZ 1WMKA 4PV1D 3EWKA 1MKMA 4OGQC 3T97B 2H89C 3JZ0A 1DD4A 2NZ2A 3R4YA 3BRJA 4R4MA 1U57A 3SFDC 4XEFA 3Q5RA 2E74B 3L8JA 1FDIA 2WSEJ 1WTYA 4TT3H 3AEGC 1ZMEC 3FGAD 2G8YA 4H44C 4H0LD 1RQVA 1NYHA 2E75D 3AE2C 4XFJA 3B71A 1VL2A 2IDBA 4R4LA 2JO1A 3D70A 3RQFA 2JPUA 1R8EA 3Q5PA 1ZP0C 2FBWC 3GMAA 1OW6A 1PIXA 1YQ4C 3GM1A 3ABVC 1GMJA 1UIXA 1OW8A 2ZT9D 4IL6X 4H13B 3O10A 3RQGA 5L8RJ 2MKVA 1JOGA 3AEEC 4YXDC 2E74C 3IN6A 1Q90D 2P10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G A;  1K04 A;  3JYY A;  4EBK A;  2H88 C;  1ZOY C;  2L6G A;  2L6F A;  1WOL A;  1K05 A;  3C8G B;  2L6H A;  3GM3 A;  3RQE A;  3U0C A;  1QVX A;  4NQF A;  4XEV A;  2PBE A;  3S9O A;  3AE7 C;  2LK4 A;  2KK1 A;  1OW7 A;  3AE3 C;  3TUL A;  3AEC C;  4YTP C;  3AE4 C;  1PV3 A;  2G3A A;  1O3U A;  5F28 E;  4XEK A;  1YQ3 C;  2JX0 A;  2YWA A;  3SFE C;  1KNY A;  2HSB A;  3AE5 C;  1WWP A;  3L8I A;  2WQY C;  3C18 A;  3AED C;  3C8G D;  1V4A A;  3K7D A;  1K40 A;  3AEB C;  1KTM A;  3MFN A;  3AE6 C;  3AJM A;  3GM2 A;  4R32 A;  3AEF C;  3AE8 C;  1ZZP A;  3AE1 C;  3AEA C;  1UFB A;  4EBJ A;  3AE9 C;  2Q00 A;  2H89 C;  3JZ0 A;  3BRJ A;  3SFD C;  4XEF A;  3L8J A;  1WTY A;  3AEG C;  3U3F A;  3AE2 C;  3B71 A;  3RQF A;  2JPU A;  1ZP0 C;  2FBW C;  1OW6 A;  1YQ4 C;  3GM1 A;  3ABV C;  1OW8 A;  3O10 A;  3RQG A;  1JOG A;  3AEE C;  4YXD C; 
#chains in the Genus database with same CATH topology
 1FDM A;  3U2L A;  3RK2 D;  3C62 A;  3WHN A;  3TGU J;  2HOD B;  5AVS B;  2LIG A;  3F46 A;  3K1I A;  3K6B A;  2L9J A;  1KIL E;  3FAP B;  1T2K C;  5DJT B;  2FYZ A;  2BCC J;  1ORY A;  2AU5 A;  1PPJ E;  3V2Q A;  1QKR A;  2B0H A;  2J7P A;  4U5D E;  3B5N A;  2Y9Y A;  3DE8 A;  1TWC A;  1SQB G;  3MTU E;  2HUJ A;  3DM9 B;  4GOD A;  2HYN A;  1Q0M A;  2IZ0 A;  1IFI A;  2LK4 A;  3LS1 A;  4W8K A;  2QJK C;  2E87 A;  1AFO A;  2Y3G A;  3ZWI A;  2A06 E;  2HLO A;  1EKY A;  1EQ7 A;  1RH5 B;  2Q1K A;  3AEC C;  4KBL A;  4YTP C;  5KLV J;  2ZT9 B;  1BSH A;  1V55 C;  3H1I E;  2V26 A;  3L73 G;  2P0N A;  1TFO B;  4IAR A;  3RL0 C;  3U59 A;  2K1A A;  1CPR A;  3F89 A;  3TNU B;  1KB9 I;  1QZX A;  2WL8 A;  2QA4 P;  4YPC A;  1HW2 A;  2W6A A;  2DW3 A;  2YLD A;  1DD3 A;  3EFO A;  1OZH A;  1C03 A;  1HUC A;  3ITK A;  1MMG A;  5A6B A;  2UUI A;  1EXI A;  3E70 C;  3H1J E;  3M4B A;  3AEB C;  2FFD B;  2WZL A;  3FWL A;  1OKK D;  1Q86 Q;  2YVK A;  4CJG A;  2A6E F;  1ZW0 A;  4NPE A;  4CIH A;  3S90 A;  1L3P A;  2XM4 A;  3QWO C;  2YL3 A;  3W2V A;  1NKN A;  3EFF K;  1M6T A;  1UFB A;  3V2N A;  3FAJ A;  1S2E A;  2FYU D;  2KK7 A;  4EBJ A;  3E9V A;  3O6Q A;  1G4U S;  2XLD A;  5L0G A;  2A06 D;  1LKX A;  2M3E A;  1EDK A;  2H89 C;  5KYU A;  1YLM A;  1MMA A;  4DJ9 A;  5AC4 A;  1OR3 A;  1SLQ A;  5KYW A;  2CCY A;  4BPM A;  4TT3 H;  1ZV8 A;  1ZHW A;  4RO0 A;  4H44 C;  2JDI H;  1LS1 A;  3H1L D;  1S9K D;  4JQ0 D;  1QPU A;  1MFZ A;  1YHQ P;  1NTM D;  1S4X A;  3ABV C;  1GK4 A;  3TD7 A;  5APX A;  1UIX A;  2ZT9 D;  1BR4 A;  1G5Z A;  2CK3 H;  1O87 A;  2DI3 A;  2GA0 A;  3UIA A;  4J32 B;  3U1C A;  3J06 A;  3CX5 H;  5COG A;  5K0I A;  3BVH A;  1A7E A;  2OYH B;  1ZOY C;  1OQC A;  2K9J B;  4O9B A;  2XS8 A;  1NOH A;  3RK3 C;  1YYC A;  3QMK A;  3AGU A;  3P8C D;  1YI2 P;  4FAP B;  2IYP A;  1N7S A;  1Y6D A;  2J46 A;  2H43 A;  4MVS A;  1G2C A;  3UGP A;  1D0X A;  4D6T D;  1NLX A;  4RJT A;  1RE3 A;  4B6I A;  2V4H A;  2W83 C;  1OX3 A;  1RF1 A;  1KB9 E;  2AXT H;  1CGO A;  2O1K A;  3HD7 C;  4YWQ A;  2QRX A;  1KFM A;  4G0H A;  4BWN A;  2LXC B;  1LTT C;  1HBW A;  4LER A;  1NAY A;  4Y28 J;  2CDQ A;  4BJ5 C;  1RHZ B;  4GOF A;  2LP4 A;  2P7V A;  2UUH A;  2XL8 A;  3BRT B;  3EQL F;  5KJ7 A;  3G4X A;  2Q9C A;  1KYO H;  3L1M A;  1AVY A;  1CPQ A;  1BE3 G;  2KJG A;  2RMZ A;  1S5L H;  1PL5 A;  2NUP B;  4DOJ A;  1CI6 A;  1FBM A;  2FYN B;  1C02 A;  3JCU E;  2KW3 C;  3E1I A;  2FYU K;  2A0U A;  1AVO A;  1RJ9 A;  3AGT A;  3L8I A;  4HE8 D;  4D4N A;  3ZG1 A;  2AEJ A;  2KB7 P;  2M4E A;  4F4B A;  4OGQ B;  2HPC B;  1YA7 O;  1SQV J;  3GWL A;  1NU1 G;  1Q81 Q;  1T6Q A;  3L75 D;  2HSQ A;  2XU6 A;  2OAR A;  1Q82 Q;  3AEF C;  2KSJ A;  4IFM A;  1P84 D;  2J9U A;  3DM5 A;  5K5G B;  3AE1 C;  1Q0D A;  1D1B A;  1IK9 A;  3BAS A;  2A45 H;  1NTM K;  1SFC C;  4DJG A;  1M2V A;  5AVQ B;  2IXM A;  4DVY P;  1FZB A;  1DD4 A;  2LD6 A;  5KYX A;  1SYQ A;  2HV6 A;  1M1J A;  1T6U A;  2W27 A;  5APV A;  3H32 B;  4L75 A;  1WTY A;  1NU7 D;  2AXC A;  2G8Y A;  1FZA A;  1VQ8 P;  3RFY A;  3RQF A;  1VL2 A;  2N1T D;  3B0P A;  4AX2 A;  3EFG A;  2PX0 A;  3VMZ A;  3PCV A;  2R44 A;  1LS4 A;  4BG0 A;  3EGX A;  3ABL C;  1N86 A;  1RE4 C;  3AEE C;  1WAT A;  4Q7C A;  3I5Q A;  5DQT A;  3JYY A;  2KNC B;  4ASV A;  4DT0 A;  4A2N B;  2J9W A;  3L71 J;  3U2M A;  2J5U A;  3TOL A;  5KLV K;  1DEB A;  3C9I A;  5BVZ A;  3EPV A;  2KUB A;  2YZS A;  1NTZ G;  1RF0 C;  3IHU A;  4MVR A;  3ZQY A;  3H1H E;  4D4X A;  2K37 A;  3GM3 A;  5APW A;  3DKA A;  1FU1 A;  3TK1 A;  2R05 A;  2R03 A;  1FMV A;  1MQV A;  3M1C B;  1LI5 A;  4TLF A;  4OGQ D;  5APU A;  3L70 J;  1A7D A;  3C8Z A;  4DRI B;  3VP9 A;  1SQB D;  1RQU A;  3H65 A;  3AOU A;  1JR8 A;  1GW3 A;  3AE3 C;  1U6H A;  1Z56 A;  3C63 A;  5E3C A;  1AQT A;  4MTO A;  2W45 A;  2QJP B;  1I4Y A;  2G3A A;  2NPS B;  2YLI A;  4NTF A;  3GHG A;  4MVU A;  1NVO A;  2OQQ A;  1J1D B;  3L73 D;  2AP3 A;  3ASO C;  1VQP P;  2A6H F;  2Q3E A;  3EHN A;  1A41 A;  3RIP A;  1J8Y F;  1VF5 C;  3HUS A;  1TWG A;  1VYK A;  3K33 A;  3WU2 H;  2YIU C;  3T4R A;  2R02 A;  3VN0 A;  2Y3B A;  3M79 A;  3II6 A;  3GM2 A;  1J1E B;  3DMD A;  3TDK A;  3CLQ A;  4ZKU A;  4J7T A;  4PJ0 E;  5KAF E;  1T01 A;  2R32 A;  2QSI A;  3GLM A;  4OWF A;  5BQI A;  1KMI Z;  1L0L E;  3QW0 A;  5JRA A;  2CPB A;  1ZHX A;  2OYI A;  4ZLD A;  5F5H A;  1URQ C;  4NTB A;  4DZO A;  1JMM A;  1MMN A;  2OGU A;  3HTK C;  3CXH I;  3FGA D;  3B29 A;  1HH0 A;  2XL4 A;  3MUD C;  3HLZ A;  2NPU A;  1LWU C;  3S4R A;  2FKW B;  5CCG D;  3V7O A;  2K3R A;  1N73 B;  4XPY A;  2E5T A;  5E2Q A;  2A45 G;  4DXW A;  2P10 A;  2E76 B;  3JCU Q;  1BDJ B;  1SQB K;  2C0X A;  3CX5 I;  2W4M A;  1OVU A;  1L0N J;  3W8I A;  1BDD A;  4JCZ A;  4H13 C;  3JRM O;  4MVO A;  3EG9 B;  2WZG A;  4NCQ A;  4IAO A;  1KQL A;  2E74 D;  1LT9 C;  4PD4 D;  3T6J A;  4KNV A;  1KN7 A;  2P2U A;  3RVZ A;  3H1K J;  3HNK A;  1NH4 A;  1GU5 A;  1T2K D;  1VDF A;  5C39 A;  1SQV K;  5D91 A;  3HE5 A;  3K1I C;  4JYC A;  2W6B A;  1JNM A;  4NC3 A;  1KYO I;  5AW9 B;  5L0J A;  1SQP J;  1Y47 A;  2C04 A;  1HJ0 A;  2SPZ A;  2CNW A;  3B5N C;  2DGJ A;  2HSB A;  3ZVR A;  1BE3 D;  3RVY A;  2XSE A;  4PJN A;  1ZR4 A;  4WY4 B;  4PV1 C;  4N6C A;  2Y69 C;  2W90 A;  3RL0 D;  2HJM A;  3KXD A;  2VC9 A;  5L0C A;  3M0A A;  1OFC X;  2LXB A;  2P1A A;  2B87 A;  3T97 A;  4HEA J;  5CJ4 A;  4LAC B;  5DS4 A;  5T3T A;  5L3Q A;  3EQ2 A;  1NU1 D;  2L7A A;  5CCH C;  1SFC A;  1Y4C A;  2E76 D;  3K1H A;  3CXH E;  1FOS F;  1HGZ A;  4NTA A;  3NFQ A;  3EZH A;  1HE1 A;  3DI5 A;  2O01 N;  3AE9 C;  3SSU A;  5AVZ B;  2KYH A;  1FE6 A;  3H2U A;  3EZI A;  2A45 I;  2LFD A;  1LTJ B;  3A0B H;  4K3A A;  2QTV A;  5APQ A;  3FHD A;  1JCC A;  4LLH A;  3NDB B;  1GL2 B;  1RQV A;  5B66 E;  3WAQ A;  2RN0 A;  3G6E P;  3L72 E;  4FWV A;  4AL1 A;  3GG2 A;  2MKV A;  3BAT A;  1JOG A;  4GYT A;  3A2A A;  4AUW A;  3LES A;  3SWF A;  3IFM A;  2J0W A;  3C8G A;  3B4S A;  1IK7 A;  3W4Y A;  2ETS A;  5E33 A;  3M4C A;  1MUU A;  4H44 D;  1SQX J;  1NO4 A;  5KLI B;  1WOL A;  1CSB A;  2FGY A;  3M9B A;  5APT A;  3LEV A;  3X2Q C;  4IB4 A;  1KOR A;  2OTL P;  3CWB J;  3MP7 B;  1NTZ D;  3CXH D;  3P8M C;  3LNR A;  4U3F J;  3GEH A;  4IJJ A;  3CAX A;  4WY4 D;  4I7Z B;  3TGU G;  1EC5 A;  5TJH A;  3I56 P;  3O39 A;  1E5W A;  2XLE A;  4EDF A;  1OW7 A;  3CSK A;  2BCC G;  5GTH H;  3SNH A;  3RK3 D;  2YXQ B;  1WRG A;  2QG4 A;  2ZAE B;  3LJB A;  1R5L A;  5AVX B;  3CX5 D;  1VTM P;  4A4A A;  4GOE A;  1LT1 A;  2ZVO B;  1YIT P;  2YEV A;  3QVY A;  3HD7 D;  4IRU A;  5KLV G;  5IY5 C;  3A0H H;  1RE3 C;  3N7N A;  4FES A;  3GAN A;  1LP1 B;  3ATP A;  1CW5 A;  1TQG A;  3PH0 A;  5KKZ C;  3AQB A;  3L74 E;  1VMA A;  2JP3 A;  3NMK A;  3D71 A;  4HH2 A;  4E7Z A;  5AW7 B;  3N2Z B;  2Q7C A;  2EPL X;  1S3J A;  2R9R B;  1PP9 J;  1VQK P;  4P6I C;  5KJ7 C;  5TIS E;  4CS9 A;  4AE4 B;  2E75 C;  1S05 A;  3DXJ F;  1KC8 Q;  5CI8 A;  5B1B C;  3WUV A;  1KYO D;  2A68 F;  2ZXW C;  4G7O F;  2WMM A;  4IGG A;  1URQ A;  1BGY E;  3KH2 A;  2MWQ A;  4R4M A;  1NBB A;  1KIL A;  1NTK J;  3SFD C;  2ZXR A;  4I3M A;  1ZRT D;  4N06 A;  1L0N K;  2POH A;  256B A;  2IM8 A;  3PHF 2;  2JPU A;  1NJI Q;  2XLO A;  2FBW C;  1SF8 A;  3TJ5 A;  2D4U A;  2HOD A;  4XWJ A;  1VQL P;  4EIY A;  5EGY A;  5B3S C;  1HMD A;  1BCC J;  2PNO A;  2ZYD A;  4YL1 A;  4U5C E;  1NSG B;  1C17 M;  4NPF X;  1KFN A;  3K5B A;  1FFH A;  1VF5 B;  1YJW P;  5KYY B;  5AVR B;  1M57 C;  3VM6 A;  1YVI A;  2L6H A;  1LTA C;  2YIU B;  1RKE B;  2PAJ A;  5B5E H;  1QVX A;  4CDY A;  3SXK A;  1SQP K;  2KLU A;  3H25 A;  2XKM A;  1K9M Q;  2KLV A;  5DVW A;  3TF5 A;  2CGE A;  4EIJ A;  3O8Z A;  4WB4 A;  1T3U A;  1KZU B;  3KHU A;  1OCO C;  4CDV A;  3MZW B;  3H1I J;  1K8A Q;  5CBN A;  1Z3I X;  2XLW A;  1RKC A;  1Z7Q c;  5L0I A;  4UB8 E;  3U9J A;  2KXP B;  2E43 A;  4AQR D;  3UMI A;  1YYJ A;  3P7K A;  4PAC A;  3A9C A;  3K66 A;  4HFK B;  1JRA A;  1ZXG A;  3OAK A;  1LIH A;  1JY3 O;  2FFD A;  1K73 Q;  1KNY A;  4P9F A;  3EGD A;  2WSF J;  5T3W A;  2R7X A;  2EPM X;  2M8R A;  5AW4 B;  2FYU E;  2R7W A;  1D1A A;  1JB0 J;  2JEE A;  2VH3 A;  4XQ1 A;  3V5Y A;  3H1J J;  5DS6 A;  1KTM A;  4BJT A;  2DYS C;  5E79 H;  1P84 I;  2OEX A;  4U5B E;  3V2P A;  5CCH A;  4Y99 B;  2OTK E;  4RDA A;  2QJY C;  3GHG C;  3N0T A;  3Q6N A;  2MJZ A;  3H1L E;  1S9K E;  1BDC A;  3W8H A;  2IOQ A;  1NTM E;  3M91 A;  1ZU5 A;  1VF5 D;  2WT7 A;  2OG2 A;  1SQV G;  1X9V A;  4HKZ H;  2B89 A;  3CPW O;  4UB6 E;  1L4A A;  1NFO A;  3DE9 A;  2NZ2 A;  4ULW A;  2ZXO A;  3Q5R A;  2ZXE B;  1SQX K;  3HUS C;  3VMY A;  3AEG C;  4PFP A;  4JTA B;  2YL0 A;  1OVR A;  2IDB A;  2GA1 A;  4GKG A;  3Q6M A;  2GUS A;  1ZP0 C;  1YIJ P;  3GMA A;  4E7S A;  1SQQ K;  3P8C E;  1LVK A;  5COF A;  3FXD A;  1YJN P;  3I4U A;  1EA8 A;  4D6T E;  1GS9 A;  2G3V A;  3CD6 P;  2X0C A;  4AK9 A;  4BRY B;  4N6H A;  2OYI C;  4QMA A;  4Z9I A;  5F5F A;  1FZC B;  1JMW A;  4U5G A;  1A02 F;  2P61 A;  1NGM B;  3NKD A;  1E86 A;  1QQ3 A;  1N2D C;  5APY A;  1FC2 C;  4Z9J A;  3CMA P;  4CX9 A;  3U0C A;  3EH1 A;  1OIP A;  3DWW A;  1QL1 A;  2Y3D A;  3L71 G;  3MLG A;  5AW8 B;  3RBZ A;  3US6 A;  2KK1 A;  3CME P;  2VB6 A;  2NRG A;  4CS7 A;  5B3I A;  1MFT A;  3TGU D;  1ZHT A;  1E83 A;  2Y0D A;  5AVY B;  4J30 B;  3GF3 A;  4I1L A;  2NUP A;  3EFO B;  3KZI H;  3RH3 A;  2BCC D;  1FZF A;  5F28 E;  4I44 A;  1S1C X;  1N7L A;  2D2C C;  5D92 A;  3KMI A;  1YTZ I;  3L70 G;  1YBK A;  5JUA A;  3L75 E;  1E85 A;  4LGD E;  4C7R A;  2IYL D;  2LR2 A;  1P84 E;  2HPC A;  1OCZ C;  3CI9 A;  1HW1 A;  2IZ1 A;  2N1T B;  2NUT B;  3FXE A;  1ZYR F;  3PJS K;  4H54 A;  1PD0 A;  5KLV D;  2PP4 A;  2P6V A;  2JD3 A;  2LQG A;  3O6Q B;  1LE2 A;  5GTI E;  1YZC A;  1ZU4 A;  1JTH B;  1S5L X;  2QY9 A;  3N24 A;  5KYU B;  4MVZ A;  3CCM P;  2J7P D;  3B5N D;  2XDJ A;  5CMZ A;  2IFM A;  4PFO A;  5JP7 A;  1FFT C;  1F1M A;  2CW0 F;  4KI2 A;  4XLP F;  4ZMD A;  4X0R A;  1M7L A;  3SYN A;  3V4Q A;  4E18 A;  4PV1 D;  1TWA A;  3V5X A;  3WG7 C;  3BCC G;  1MMD A;  3NYJ A;  2MYS A;  4Z9H A;  1MND A;  4ONS A;  1JM0 A;  1HGV A;  1M90 Q;  1PIX A;  3BRV B;  3GM1 A;  1JY2 P;  1A02 J;  4JF7 A;  3T6B A;  1TKN A;  4UDV A;  2FY8 A;  3QW1 A;  4N6J A;  4XPW A;  1T9K A;  3O55 A;  5H2F H;  4IFF A;  4YXD C;  2M3B A;  1N7S B;  3WUU A;  2EIJ C;  2RD9 A;  1GW4 A;  4O6N A;  5A6B D;  4YJW A;  4O7G A;  1JY3 P;  1LPE A;  1UG7 A;  1SQB E;  1BR1 A;  1RF1 B;  2V7Q J;  3H1H J;  1M56 D;  4IWB A;  3HNL A;  1T8Z A;  3D6Z A;  3KPE A;  3UMK A;  4O6Y A;  4PR9 A;  3IEE A;  3L35 A;  3U1A A;  4K0D A;  2Q7R A;  2XV5 A;  4PD4 I;  1YA9 A;  3IQC A;  3RKO F;  4GQH A;  4RES B;  2KZJ A;  3L73 E;  3AG1 C;  1E2X A;  2NPS A;  1NKZ B;  3G4Z A;  1FS0 E;  2YO3 A;  3DAG A;  4WGZ A;  1L0N G;  5M1B A;  1WN0 A;  5EHH A;  1Q2N A;  4JVS A;  4KJM A;  2WPR A;  1CI6 B;  5AGF A;  1QX8 A;  4WWI A;  1XZP A;  4YN0 B;  3SWK A;  2YL1 A;  3A3Y B;  2ZD9 A;  4C3E A;  1HE9 A;  2KS1 B;  4P9T A;  2WVQ A;  2WPV B;  3U8P A;  3FDQ A;  2WVR A;  1X8Y A;  2J0X A;  1GU4 A;  3MYF A;  3LNM B;  1T3J A;  5DJU B;  4ZKP A;  1W2E A;  1GZL A;  1M2V B;  1SQP G;  1NAF A;  3S27 A;  3AE6 C;  3HE4 B;  3V5Z A;  3RYL A;  3ASN C;  5KYX B;  2QVA A;  4L73 A;  4GEH A;  2H7O A;  1N7S D;  3CCU P;  1M1J B;  3WUT A;  4H0L C;  3PMR A;  3NMJ A;  4YT4 A;  4K7B A;  2KP8 A;  1L0L J;  1IFM A;  2QUP A;  1AA0 A;  2CPS A;  3I5C A;  3SXY A;  1OWA A;  3USS A;  2CYD A;  2H8A A;  2H7B A;  1RY3 A;  4IL6 H;  5DQZ A;  3BRJ A;  3VTP C;  2H7H A;  5KAI H;  1SQV D;  2E74 B;  1FZE A;  3G71 P;  3EGX B;  2GFH A;  1EZV G;  5KJ7 D;  2E75 D;  1LM3 B;  3B71 A;  3LIE A;  2IXN A;  1LE4 A;  2ITA A;  4L74 A;  2Q9I A;  1ZHY A;  2DYR C;  4JCH A;  4CS9 C;  1NFN A;  1EDJ A;  1OVV A;  1R4T A;  3T6G B;  4CIP A;  2XM0 A;  3MX3 A;  4PD4 E;  2OQM A;  1LI7 A;  2PP6 A;  1QSP A;  3EG9 A;  5DLJ A;  1V54 C;  2J58 A;  2M64 A;  2QJK B;  4ASW A;  1GTW A;  4I1O B;  1KIL C;  2WIT A;  2HR3 A;  4DRH B;  1H89 A;  1JY3 N;  1FTS A;  2K88 A;  2WZF A;  3NTN A;  3LLI A;  3RL0 B;  1T6A A;  3IQT A;  4JKV A;  1H9G A;  4NQF A;  1DOW A;  4XPX A;  3UGO A;  4JBZ A;  2ZXP A;  1I4Z A;  3VAY A;  3AE7 C;  1SQX G;  2XXA B;  3L71 D;  1BE3 E;  3CCJ P;  2IPP A;  3UNG C;  5AW0 B;  1A7V A;  3TUL A;  4OIP F;  3CWB G;  1XZQ A;  1M57 D;  1SQQ G;  2WSF H;  2XND H;  3N4X A;  3GF7 A;  1LTS C;  3X1O A;  4BEM J;  3AG4 C;  2JX0 A;  4YK5 A;  2LFF A;  3HUS B;  2Y9Z A;  3BCC E;  4OVN F;  3F47 A;  1PGJ A;  3S0X A;  1NU1 E;  2IBZ G;  3L70 D;  2OYO A;  3OW2 O;  4OD4 A;  4PJM A;  4U5E E;  2PX3 A;  2ZT9 C;  3D6Y A;  3ZIB A;  4JC7 A;  2Y39 A;  2OU6 A;  1VYI A;  1H0T B;  3RGU A;  4MW3 A;  2I8B A;  4MVM A;  1EZV I;  4NPD A;  2WPS A;  1Q7Y Q;  1IO4 A;  3CCQ P;  2P1J A;  4J7Y A;  3KL4 A;  2D5R B;  3QH9 A;  5HV9 A;  2YKQ A;  1LTJ A;  4H44 B;  3U5S A;  4U5H A;  2YO2 A;  1SMY F;  1TR2 A;  3LS0 A;  2HFI A;  1GL2 A;  1WMK A;  1NU9 C;  2FFD C;  3KKB A;  3L0I A;  4CSA A;  3MBG A;  1PGP A;  4W7Z A;  2Q3I A;  3R4Y A;  1PP9 G;  2M0B A;  3JRT A;  3JTL O;  4C7O A;  1Z6A A;  3BCC D;  2J9V A;  3R2P A;  5AVW B;  3L72 J;  1QLE C;  5JLI A;  3RK3 B;  2E5Y A;  3PRJ A;  1NTZ E;  1W2B O;  1NTK G;  2M5A B;  3FXH A;  5E3A A;  4E0I A;  2L81 A;  3I55 P;  2NSG A;  1AV1 A;  5AVT B;  2G62 A;  5CI9 A;  3ABM C;  3EH2 A;  5CIV A;  1KB9 H;  1CGN A;  1L4A C;  4ZLC A;  1TU3 F;  3HD7 B;  4CBE A;  3RK3 E;  2WVN A;  1KV4 A;  1JMB A;  2TMV P;  1BCC G;  3CX5 E;  1CGM E;  1HJB A;  1H6G A;  2I1J A;  1T5O A;  3DZA A;  2BEQ D;  2OYH C;  4DBQ A;  2WTY A;  1SVF A;  1PPJ G;  3PP5 A;  2P7J A;  2J9B A;  2KZI A;  5T1D B;  1G4W R;  3JCU H;  1L0N D;  2YXR B;  2RKL A;  2Q6Q A;  4WBA A;  3Q3D A;  2R5B A;  2AXT E;  1GQA A;  3WMM 0;  3NYM A;  3V6I A;  3H1I G;  1L0L K;  4C3B A;  1X79 B;  2KGO A;  3H6P A;  1KQF B;  3L74 J;  1SFC B;  1KYO E;  3AQC A;  4AE4 A;  3GW6 A;  1DX7 A;  3ZTM A;  2D2C D;  3MFN A;  1S5L E;  3AJM A;  4R32 A;  1ZRT E;  4M63 A;  3IR9 A;  4U5F E;  5AW6 B;  2KSE A;  2FYN C;  1SQP D;  5BUO A;  1H88 A;  3A11 A;  3H1J G;  2B9B A;  3AEA C;  3RL0 g;  4N78 D;  1B68 A;  4G7H F;  4OGQ C;  1BGY J;  2L91 A;  2EPO A;  4OIR F;  4PJL A;  2GDC A;  4RBN A;  1LTB C;  3LEO A;  1LGH B;  4MND A;  2IXP A;  1FDI A;  1BZ4 A;  3TK0 A;  1JUN A;  3U3F A;  4R4L A;  1LTG C;  1PFI A;  1EZV D;  2GUV A;  4Q4Z F;  1SQQ E;  2V7Q H;  4C7N A;  3ZDM A;  2C9N Y;  3RQG A;  1Y8A A;  2CNW D;  2HFE D;  4B86 A;  3AG3 C;  1O5H A;  1BR2 A;  4JPZ B;  3CZ6 A;  3L34 A;  2R3C A;  3IQ5 A;  2H88 C;  2P58 A;  1S7Z A;  2A69 F;  2BAS A;  1OKK A;  2BE5 F;  4EHP A;  2Q4F A;  2JKV A;  3TYY A;  3HRN A;  1AEP A;  1K05 A;  2WSS H;  3UR3 C;  1JO5 A;  1JAF A;  2ZXX A;  1YJG A;  1SFC D;  2KI7 B;  3CCR P;  2R7U A;  2WVO A;  3HJC A;  4I1M A;  2VCB A;  3SXM A;  1FOS E;  2FXP A;  1SQX D;  3DD7 A;  2Y0C A;  1APC A;  5AW2 B;  1D1C A;  3LLK A;  4W80 A;  1SS1 A;  1O3U A;  3JSE O;  5JVE A;  3CWB D;  4U3F D;  3M15 A;  1SQQ D;  1EXJ A;  2B88 A;  4YT2 A;  3KPH A;  2Q5U A;  3B9Q A;  1S72 P;  3SWY A;  5L3V A;  1KQG B;  4N4W A;  2UWJ E;  2FYU J;  4I6M C;  3L36 A;  3C7J A;  1HVV A;  2VRS A;  3NRH A;  2QJP C;  2HKV A;  4PJ0 H;  2WQY C;  5KAF H;  2NPS C;  3TNU A;  3C8G D;  2IBZ D;  4LDK A;  4DCK A;  3CCS P;  3CC2 P;  3CCV P;  4XLN F;  4A7P A;  1J1D C;  1H9T A;  1JY2 O;  5L0H A;  2PFX A;  1URQ B;  3AE8 C;  3H1L J;  3HTK B;  1KU2 A;  1NTM J;  3NKE A;  2GWW A;  1OXK A;  1OCR C;  2WB7 A;  1LWU B;  2PGD A;  3EWK A;  4LC1 A;  1MKM A;  3WU2 E;  3KDP B;  3S29 A;  1Q0F A;  1QVF O;  1J1E C;  3DJU B;  3ZTZ A;  1SP4 A;  5AW5 B;  3L8J A;  3A5T A;  4OIO F;  3MD0 A;  1PP9 D;  4H0L D;  4JEB A;  2I1K A;  2R7O A;  4YL0 A;  1OW6 A;  4D6T J;  2Z5H A;  4BRY A;  4H13 B;  3O10 A;  4EBB A;  3R7C A;  1FZC A;  1FZG A;  3IN6 A;  3ECS A;  3W68 A;  2KQ9 A;  1VK5 A;  1LT9 B;  1NTK D;  5CHX A;  2C03 A;  1AJY A;  4ANJ A;  2XLM A;  4AYC A;  2QE9 A;  3TGU E;  1CZQ A;  4JTD B;  2L6F A;  2R7R A;  2HJ3 A;  1LNQ A;  3KYI A;  1USD A;  2B0J A;  4IOI H;  4AL0 A;  1N73 C;  1D0Y A;  2BCC E;  3O6X A;  3CCL P;  2K9Y A;  4O79 A;  5BU5 A;  1XTG B;  2OYH A;  3T9O A;  2E76 C;  1BCC D;  1VOM A;  4C3D A;  3NMI A;  1FNT c;  2K9J A;  2I15 A;  3H1H G;  3A7O A;  1ZVZ A;  3JYH A;  1FAV A;  3G9R A;  1URQ D;  1Z63 A;  3B5N B;  1KIL D;  3CQZ A;  3VMA A;  3MGN A;  1XTC C;  5KLV E;  4GDO A;  3EGD B;  1PPJ D;  2WSC J;  3G50 A;  2PF4 E;  4PV1 B;  3L75 J;  4PJJ A;  1YQ3 C;  2FXM A;  2N1T A;  2GAQ A;  4MTF A;  1L7C A;  2NUT A;  5HSW A;  4FX5 A;  1OMI A;  2N9Y B;  4RKU J;  2KSF A;  1YDI A;  2Z5I A;  3NMD A;  1U0B B;  1JTH A;  3ITF A;  2AWC A;  4GIF A;  4LLE A;  1AUE A;  1OR2 A;  1VQ6 P;  3H1I D;  3CXH H;  2ICW G;  1T6I A;  3SP1 A;  1FJP A;  1GM5 A;  1QGK B;  5L0F A;  1J8M F;  1H8A A;  4Q5S F;  1ORS C;  1YAR O;  4HB1 A;  2ZVN B;  2WT7 B;  2Z15 A;  3G3Z A;  4H13 D;  5A6A A;  4BJ6 A;  1L4A B;  1QL2 A;  1FDO A;  3VP8 A;  3Q2Y A;  3IAO A;  4YL3 A;  1GDT A;  3NXS A;  3KYJ A;  4WAB A;  2YHS A;  5B66 H;  2YKP A;  4WY4 C;  3F5H A;  2XNX A;  5JT4 A;  4EYY Q;  1M8O B;  3H1J D;  3JZ0 A;  3SEO A;  3FWN A;  5B1A C;  5AW3 B;  3HNJ A;  5JSL A;  2IXO A;  1FR0 A;  4K35 A;  1NTK K;  3FOP A;  2QM8 A;  1L0L G;  1V74 B;  2MHR A;  3SZR A;  1VQ4 P;  2HS5 A;  1ST6 A;  3VF0 A;  5KYW B;  1W5C E;  1EDL A;  2AWY A;  5BQG A;  4CS8 C;  3H32 A;  5L8R J;  1TWH A;  1LTJ C;  1UII A;  2XRH A;  3A0B E;  3CEX A;  5GPG B;  3P32 A;  4JYB A;  1QVG O;  3M0D A;  4BJ1 A;  1SQB J;  1KQS O;  1GL2 C;  3EJN A;  4CSA C;  1YYX A;  2NG1 A;  2GM4 A;  3QTH A;  2Y0E A;  2O9X A;  1QLE D;  2JWA A;  3MIW A;  3M9Q A;  5CCH D;  2WZ7 A;  4E0H A;  2KNC A;  3L73 J;  4MS2 A;  2Q9A A;  1QEX A;  4OIN F;  3Q7L A;  1A0B A;  3S9O A;  1VQO P;  1I5N A;  2XZR A;  4IFD K;  3JT1 A;  3FX0 A;  5KLI C;  3V4W A;  1L4A D;  2OJE D;  1G2C B;  1OCC C;  4NY3 A;  4K1O A;  2KS1 A;  3AE4 C;  3AG2 C;  1GD2 E;  4BXL A;  4CJO A;  4KHX A;  5KKZ B;  3C8V A;  2FAP B;  4OH8 B;  4I7Z C;  2EPK X;  4MW8 A;  2ZPA A;  2QM7 A;  4PK4 A;  1X22 A;  1M2O A;  3E1R A;  1EI7 A;  5CCG A;  1KB9 D;  4CPG A;  3W2W A;  2R7S A;  5GTH E;  2OJQ A;  1FJK A;  5TIS H;  3HE4 A;  2HZ8 A;  2E75 B;  3AE5 C;  1WWP A;  3AED C;  1V4A A;  3NYL A;  3K7D A;  4DOZ A;  2KYV A;  1JOC A;  3FOO A;  2EIK C;  4JIO A;  3OA1 A;  1SQV E;  1ZLL A;  1YZA A;  3IPM O;  3PDM P;  1AVO B;  1RJ9 B;  1JPN A;  3A0H E;  4HFF B;  3H1K G;  4U9E A;  4QDL A;  5A6K A;  5APS A;  1PGQ A;  2Q00 A;  4JZA A;  1IC2 A;  3WOD F;  1IZM A;  5EK0 A;  2X51 A;  1L2P A;  2VCC A;  1ZHZ A;  1VQN P;  2AVK A;  1Z5Z A;  3RK2 C;  2WSE J;  4YXW H;  4HJG H;  1MNE A;  3I5P A;  1NYH A;  4H4K C;  2KNH A;  2JO1 A;  3C1L A;  1N8R Q;  3TSI A;  2Y3H A;  2JWD A;  1YQ4 C;  5A69 A;  3VOP A;  3ABK C;  1OW8 A;  4IL6 X;  4I2L C;  4N3Y B;  5BU8 B;  1VQ7 P;  5BQH A;  1NWQ A;  2O01 J;  3L72 G;  2O3J A;  3L71 E;  3GEE A;  5AC5 A;  4JJF A;  3LW5 J;  4JTC B;  1N73 A;  4KT0 J;  4KNW A;  2XXA A;  3JC2 2;  2HV7 A;  4HYT B;  3TOM A;  4UB8 H;  3S84 A;  2LCH A;  4IAQ A;  4XEV A;  1OXB A;  2RH0 A;  4O6M A;  2A0B A;  2XS1 A;  1OXZ A;  4EI2 A;  3CCE P;  2R7V A;  1BE3 J;  3L70 E;  1MZ9 A;  1HY5 A;  1JY2 N;  3G4S P;  5AVV B;  1FMW A;  2J45 A;  4XE5 B;  3H1H D;  2QLA A;  1WAS A;  5B5E E;  3OJA B;  3JSV C;  3RF3 A;  4XEK A;  4QI2 A;  3BCC J;  2YMY A;  3L37 A;  2YWA A;  1IZN B;  1M1K Q;  1JEK A;  1NU1 J;  3ZSU A;  2IBF A;  3IQ6 A;  1H0T A;  2QIW A;  2QJY B;  3GHG B;  2WWW A;  3U8V A;  3DJN B;  1NZE A;  2C9L Y;  3GOD A;  2YNY A;  5CJ0 A;  4EUK B;  4U3F G;  4UB6 H;  3S28 A;  1VLS A;  4U7J A;  1GGQ A;  3SXZ A;  2RSE B;  4LDR A;  2W9Y A;  4RD9 A;  4BEJ A;  1HMO A;  3L74 G;  4WY4 A;  3OA7 A;  4YT5 A;  3PTZ A;  4ULV A;  1EDI A;  2NPS D;  2IFN A;  2QNL A;  4M3L A;  1IFD A;  5E79 E;  1YJ9 P;  1JPJ A;  1YAU O;  2C0W A;  1WGW A;  1JCD A;  2ZJS E;  3TJ6 A;  1BSN A;  1J2J B;  4Y99 C;  2W6J H;  1ZW2 A;  2M5A A;  3BEH A;  3HKK A;  1NHL A;  5JS5 A;  4MN4 C;  3GEI A;  3PLN A;  4ER9 A;  1YTZ T;  4JE9 A;  1ORJ A;  2OYI B;  3Q5P A;  1BGY G;  4CS8 A;  2BL2 A;  3PHL A;  1NTZ J;  2L5G B;  1PGO A;  1L0L D;  3HD7 A;  3EHM A;  2I8D A;  3OEO A;  4BJ5 A;  4XA4 A;  2F22 A;  3JSZ A;  4U9D A;  1Q90 D;  1N1C A;  3Q5S A;  4WVZ A;  4MTG A;  2KIK A;  2V3C C;  2JJL A;  4JRZ A;  1HF9 A;  2R7T A;  2W8Z A;  2R5D A;  2XLV A;  1L0N E;  3KYQ A;  1U7M A;  1U7J A;  2W4B A;  1PZQ A;  3RQE A;  4Z1M H;  2D2C B;  3L4F A;  2WSC H;  2EPN A;  2QE7 H;  3QZC A;  3H2V A;  4EWC A;  2BEZ F;  1FZC C;  2HMQ A;  1P84 H;  1Y9B A;  4DVZ A;  3H1K E;  4W7Y A;  1E79 H;  1G8X A;  2IX7 C;  3VRC A;  2PFD A;  3M06 A;  1DH3 A;  1IFJ A;  2Q9B A;  1ZN5 A;  1PD1 A;  2J59 M;  3W67 A;  2VAS A;  3LAY A;  5GTI H;  5AW1 B;  2HMZ A;  2YLG A;  2OOC A;  1DIP A;  3U3B A;  1HTL C;  1SQP E;  4EOT A;  3HE5 B;  3GWN A;  5KTB A;  2IBZ I;  3KZI E;  4N78 E;  4JJG A;  1VQM P;  1TFK B;  5EFW B;  4L6R A;  1K40 A;  1R5I D;  3TQO A;  4G78 A;  1AQ5 A;  1G1J A;  2HG5 D;  1VQ9 P;  1M56 C;  3CC7 P;  2FYU G;  1LP1 A;  2A06 G;  2R3S A;  1RE4 A;  2N1T C;  4C7O B;  3VYW A;  2LSE A;  5CBO A;  3LUT B;  1EZV E;  2A1D D;  3Q7G A;  5DS5 A;  2B87 B;  3T97 B;  3ZDL A;  3H1K D;  2EIM C;  2WPQ A;  4WJ0 A;  1VQ5 P;  1RF0 A;  1LJ2 A;  1E84 A;  3H1L G;  2Z4E A;  4OD5 A;  1NTM G;  1R5S A;  1X0T A;  2YKZ A;  1ZME C;  2AEF A;  2PRR A;  1USE A;  3MYI A;  1G1I A;  3D70 A;  1WT6 A;  1R8E A;  1SQQ J;  1DOV A;  1Q0G A;  4BJ6 C;  1SZI A;  1KD1 Q;  1GMJ A;  3RW0 A;  1LTI C;  1FAP B;  3HNI A;  3V2R A;  1Z23 A;  4JW1 A;  2AEM A;  1U89 A;  1PCX A;  3CL3 D;  3ZQV A;  1MV8 A;  4EBK A;  1K04 A;  1HWT C;  2YQY A;  4LDQ A;  3M9H A;  1SR2 A;  1DEE G;  2FFH A;  2L6G A;  5COM A;  2JR8 A;  4D6T G;  4MVQ A;  1SQX E;  3L72 D;  3POV A;  2IYO A;  3C8G B;  2ZYG A;  5H2F E;  2OEV A;  1VPC A;  3QVZ A;  2XLH A;  1VB5 A;  3CWB E;  1N7S C;  3CC4 P;  4U3F E;  1NU1 K;  2LKM A;  2PBE A;  4W8P A;  2KOG A;  3E7K A;  3UMH A;  5A6J A;  2YL7 A;  4ZNC A;  5KYY A;  1GL2 D;  1RF1 C;  2OCC C;  4CDA A;  3Q1M A;  1D7M A;  5TJ5 E;  3B0U X;  3MHV A;  4GT1 A;  4DRJ B;  2YMK A;  3IF4 A;  1EQ1 A;  1RKE A;  1IFP A;  2R7Q A;  3S1K A;  5FCL A;  3FVY A;  2H7V C;  2FXO A;  2IBZ E;  3M0D C;  1PV3 A;  5FZT A;  3LID A;  2ZFC A;  4QI0 A;  1IW7 F;  4WGY A;  2QEX P;  3RK2 B;  3FMS A;  2YKO A;  1D0Z A;  5KYN A;  3SFE C;  2ZYA A;  4OIQ F;  3U9M A;  2YRF A;  3KQG A;  1IFN A;  3ZC4 A;  4H0L B;  4EKW A;  4YT8 A;  2KC3 A;  3NG1 A;  1GK6 A;  1VLT A;  2XL6 A;  3C18 A;  2OKU A;  3L75 G;  4XTK A;  2G3K A;  1RMV A;  3HTK A;  2E42 A;  1W2W A;  2O1J A;  1BBH A;  2OTJ P;  3MUD A;  4G7Z F;  3V5B A;  5AVU B;  1Q0K A;  4C46 A;  2EIL C;  3RBX A;  2N9B A;  1LWU A;  2P67 A;  2Q3T A;  1ZZP A;  1PP9 E;  3VYI A;  1NTZ K;  2WSE H;  4E17 A;  2ASR A;  5CCG C;  2DB4 A;  4KC9 A;  3L74 D;  2NSF A;  1ZR2 A;  1RXQ A;  4C7N B;  1IJD B;  1U57 A;  3GOR A;  4JEA A;  4XEF A;  4DBR A;  3VMX A;  2BC5 A;  1XWJ A;  1NTK E;  1M1J C;  1H7I A;  4PD4 H;  4JUR I;  3OWT A;  2H8P D;  5L0D A;  3DAF A;  2EIN C;  4LLC A;  1ZW3 A;  4XFJ A;  3AE2 C;  2O01 H;  3B0V C;  1LT9 A;  1KIL B;  3B8E B;  4IL6 E;  3LW5 H;  4L76 A;  1RCP A;  1NG1 A;  5KAI E;  2VCA A;  2R25 A;  1BGY D;  2J8W A;  2E74 C;  4MQ9 F;  1BCC E; 
#chains in the Genus database with same CATH homology
 3C8G A;  1K04 A;  3Q5S A;  3JYY A;  1IK7 A;  2E76 B;  4EBK A;  2O01 J;  1AJY A;  2J5U A;  2H88 C;  1ZOY C;  4H44 D;  1TU3 F;  1HF9 A;  2V7Q J;  2L6G A;  1VF5 B;  2L6F A;  3LW5 J;  1WOL A;  3RK3 E;  1KIL E;  1K05 A;  4KT0 J;  3D6Z A;  1NGM B;  4H13 C;  3C8G B;  1KOR A;  2L6H A;  3GM3 A;  3RQE A;  3U0C A;  4Z1M H;  1QVX A;  4NQF A;  2D2C B;  4I7Z B;  4XEV A;  2K9Y A;  2PBE A;  2E74 D;  3H25 A;  3S9O A;  2E76 C;  4OGQ D;  3AE7 C;  2BEQ D;  2LK4 A;  2KK1 A;  2QJK C;  5M1B A;  3Q1M A;  2BEZ F;  5KLI C;  1OW7 A;  1RQU A;  3G9R A;  2FXP A;  4Y28 J;  1Y9B A;  3AE3 C;  2YMK A;  3AEC C;  3TUL A;  4YTP C;  2ZT9 B;  3AE4 C;  3GF3 A;  4GDO A;  1PV3 A;  3C8V A;  2G3A A;  3GF7 A;  2WSC J;  1O3U A;  5F28 E;  4PV1 B;  1S1C X;  2D2C C;  4I7Z C;  4XEK A;  1YQ3 C;  2JX0 A;  2OQQ A;  3Q3D A;  1EXJ A;  2YWA A;  3SFE C;  1OMI A;  4RKU J;  1PL5 A;  1DIP A;  1KQG B;  2QIW A;  1DD3 A;  2WPV B;  1HJ0 A;  1KNY A;  2HSB A;  2WSF J;  4H0L B;  2ZT9 C;  3D6Y A;  2E75 B;  3AE5 C;  1WWP A;  2QJP C;  5KKZ C;  1KQF B;  2WQY C;  3L8I A;  1JB0 J;  1VF5 C;  3AED C;  3C18 A;  3C8G D;  1V4A A;  4PV1 C;  3K7D A;  1EXI A;  1K40 A;  3AEB C;  2D2C D;  1KTM A;  2JP3 A;  4OGQ B;  3MFN A;  3D71 A;  1S5L X;  2YIU C;  4H13 D;  3U3F A;  3AE6 C;  3AJM A;  4U7J A;  3GM2 A;  1ZRT E;  4R32 A;  3AEF C;  1FDO A;  3AE8 C;  2QJY C;  3IAO A;  3Q2Y A;  1ZZP A;  2FYN C;  4H0L C;  2E75 C;  2E76 D;  3AE1 C;  4H44 B;  3AEA C;  1UFB A;  3RL0 g;  4EBJ A;  3AE9 C;  2QSI A;  3O6Q A;  1VF5 D;  3GLM A;  2Q00 A;  1KMI Z;  1WMK A;  4PV1 D;  3EWK A;  1MKM A;  4OGQ C;  3T97 B;  2H89 C;  3JZ0 A;  1DD4 A;  2NZ2 A;  3R4Y A;  3BRJ A;  4R4M A;  1U57 A;  3SFD C;  4XEF A;  3Q5R A;  2E74 B;  3L8J A;  1FDI A;  2WSE J;  1WTY A;  4TT3 H;  3AEG C;  1ZME C;  3FGA D;  2G8Y A;  4H44 C;  4H0L D;  1RQV A;  1NYH A;  2E75 D;  3AE2 C;  4XFJ A;  3B71 A;  1VL2 A;  2IDB A;  4R4L A;  2JO1 A;  3D70 A;  3RQF A;  2JPU A;  1R8E A;  3Q5P A;  1ZP0 C;  2FBW C;  3GMA A;  1OW6 A;  1PIX A;  1YQ4 C;  3GM1 A;  3ABV C;  1GMJ A;  1UIX A;  1OW8 A;  2ZT9 D;  4IL6 X;  4H13 B;  3O10 A;  3RQG A;  5L8R J;  2MKV A;  1JOG A;  3AEE C;  4YXD C;  2E74 C;  3IN6 A;  1Q90 D;  2P10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...