1KVJA

Solution structure of the cu(i) bound form of the first heavy metal binding motif of the menkes protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
b'MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title Solution structures of the reduced and Cu(I) bound forms of the first metal binding sequence of ATP7A associated with Menkes disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 79
sequence length 79
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2002-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kvjA00
2QYCA 3QGPA 2RU9A 1P8GA 4EFAC 2K1RB 5IXUA 2XMTA 3MCSA 1VQSA 3DCAA 4A46A 2K1RA 2IFXA 3QMQA 3HF5A 4QOTA 5T7LA 2ZDOA 1YG0A 4ZOSA 1YJRA 1YRXA 4HH0A 4U9RA 5K9FA 5B0CA 1FD8A 2HIQA 2VV5A 1Q8LA 2ASYA 1KVIA 4ZA1A 2ACYA 1TZ0A 2KYZA 5T7LB 2RMLA 2AP6A 4YDXA 1OQ6A 5B0DA 3LGNA 2GCFA 2OP5A 4OJHA 1MWZA 1URRA 1Y3KA 1WD6A 3I9ZA 2QLWA 2XMWA 3HHLC 3F44A 1S6UA 2G9OA 1N5SA 1TL5A 2OAUA 1TL4A 4OIXA 1FESA 2GFFA 3BB5A 1CC8A 1Q53A 3TOQA 1LQ9A 2OFHX 2KKHA 3HDSA 3GZ7A 1KQKA 1P6TA 1X0PA 3BM7A 2QLXA 5B0FA 4Y2MA 5B0BA 1FE4A 1X7VA 1TUVA 1RJJA 2BUNA 2GGPB 5F0WA 1MWYA 1Y9OA 2AW0A 2IYIA 2ZDPA 5KAKA 2GGPA 3BR8A 1S6OA 3UDCA 3VTIA 3BN7A 4FNHA 1CPZA 2BBEA 2BJDA 2OD6A 1V3ZA 2FHMA 2K2PA 3FRYA 3HHLD 5B0GA 3IWLA 2OKQA 3FMBA 5B0AA 3WDOA 2ROGA 2CRLA 2W4PA 3MZIA 3KNGA 1KVJA 3K7RA 2FTRA 3TRGA 1AW0A 1FVSA 4Q2MA 2GA7A 1SB6A 4YEAA 4F67A 2KT2A 1K0VA 1IUJA 2RILA 2ROPA 2N4DA 1N5QA 2FB0A 2XMJA 1APSA 1R6YA 4OJ3A 2N7YA 3BF4A 3FGVA 2LDIA 2W4DA 3KG0A 1VQYA 1XBWA 4HI2A 2ROEA 2LXFA 2HFNA 1CC7A 2GV1A 2PD1A 1TR0A 3HFKA 1U7LA 1ULRA 1FEEA 1W2IA 3BDEA 3LO3A 2JDJA 4A48A 3TNVA 1AFJA 1AFIA 1Q4RA 1JK9B 5B09A 2HFOA 1X8DA 3IWXA 4FNIA 4HL9A 1YJUA 2IYGA 2XMKA 4A4JA 2W4CA 2HLTA 1QUPA 3CJKB 3T9NA 3HX9A 1N5VA 2BYCA 3BGUA 2FIUA 3CJKA 2L3MA 5A6PA 1GXUA 2N4CA 1FVQA 2GO8A 2LQ9A 3E8OA 2EW9A 4A47A 1Y0HA 4HI1A 1FE0A 2AJ0A 1JWWA 4NL5A 2LQBA 1N5TA 1OSDA 2PGCA 1YJVA 3KG1A 5A6WA 1GXTA 2KT3A 1Y3JA 2AJ1A 2K7KA 5B08A 4DPOA 1SI9A 4Q2LA 4OJ1A 2HQIA 4DL0C 2XMMA 2XMUA 5B0EA 4HH1A 2HLUA 4NPOA 2BJEA 2RSQA 5F0UA 1OPZA 1YJTA 4Y2KA 3DXSX 2OD4A 3LGMA 2XMVA 4Y2IA 2Q3PA 3HHLB 1SQEA 1OQ3A 3KKFA 1Q8BA 2OFGX 2OMOA 4OJGA 2QIFA 2K7JA 3HHLA 4DN9A 2VH7A
chains in the Genus database with same CATH superfamily
1X4BA 4UUXA 1ZZFA 1S77D 4NLVA 1O5JA 2HBRB 4PG4A 2H4YB 3FNNA 3KLFB 2AYBA 3CJ8A 4JI1F 3BBFA 4JI8J 4M8LA 1S1WB 4RUHA 2DGUA 4FYWB 1FF2A 3KHHA 3MAAA 3EPGA 3KG4A 1YITS 4F4YA 4IUFA 2Z56B 2D3UA 3C15A 4CH0S 2HHUA 5JMNA 1FNOA 1C1CB 1VC6A 3MEGB 2UXBJ 2V4JA 1WF2A 4DU7A 5B0AA 3OXFA 2X1BA 3K7RA 2Y1IA 4J9MA 3ZNUA 1SUQA 2U2FA 3CCMS 4CLLA 1VQYA 4GKKF 3R8YA 3I55S 1KS2A 3DHWC 3R5GA 5EWFA 4YB5A 2XZWA 1M5HA 2Y8WA 3JS9A 1SJ3P 3PZPA 3QT6A 3OR1A 1P9QC 4IFVA 1I51B 3WC2A 2IC3B 1CEZA 3QO9B 3TZWA 2HFVA 4KKOB 3CJ2A 4ALZA 1Q1KA 1AXQA 1N33F 4ANCA 3I82A 1EKRA 4HEA9 2MLZA 4DSEA 1UAWA 4FVMA 1R31A 1TV6B 1IR1A 3WC0A 3VZIA 3CULA 4L76A 2OPRB 2R7RA 4QW9A 4JI6J 2F9JA 2BE2B 1AROP 3MM5B 2V50A 3DGPA 1S79A 5BJRA 1MG7A 1NXIA 1SKUB 3AQPA 3TYTA 3MM9B 2BXJA 2PT0A 2R7VA 4FF2A 2PDAA 4QWEA 3O44A 4C98A 1RWPB 3BGUA 2XLIA 4DN0A 1YIJS 2WB4A 4EBEA 3V4IA 3N5BA 1QE1A 3J7A1 2VFVA 4Q7AA 4F3MA 2DNPA 3KLIA 3RAMA 5A8KB 4UOHA 3I5CA 5H9FK 4ED1A 3B8HA 2HZAA 1UFWA 2EK6A 3O3LA 2HHXA 5JXSA 3HHNB 2XI3A 1RT5B 3W5XA 1S1XA 3C6TB 1TU0B 4ZCKA 2YNGB 3ZZPA 3KK1A 2BM0A 1RUSA 4UY85 4B3MJ 4NEYA 4DR1J 3MXHP 4IFYB 5DDPC 1B99A 1XMBA 2ZD1A 4LF6F 2ZH2A 3QBCA 2RE1A 3TAMB 3CMAS 1M1HA 1B7YB 2XY6A 3ITHA 3CCLS 4X65F 1XJWB 2D9OA 3UNGC 3UO0A 3HFZB 2HHSA 1V3SA 3DLJA 2QL9B 4NLYA 1GXUA 4Y65A 4LBHA 3AODA 1NK7A 5IC4B 5EGYA 4L75A 3M8SA 2DHXA 4DL0C 4ZVUB 3UCUP 2IDEA 2ZJRQ 4BLGA 4P2MA 1RAOA 3HVTB 1P1LA 4LREA 2K1RA 1BE4A 1U4BA 5E3RA 4FVCA 1UJ5A 2MKHA 4DR2J 1JMTA 3ZXWA 4DSJA 2AJQA 2J6SA 1XR6A 4HTIA 2OP5A 1WD6A 2OEKA 5D0HA 1JXLA 3OSPA 1GEHA 1X0PA 4MKBA 2H9ZA 4M5DA 3M6UA 3KFWX 4RWXA 9ATCB 5D4OA 2Q1LA 4X4SA 2AD9A 1VRTA 1UKUA 2KTQA 2CADA 3HFVA 2LEBA 2DVIA 1C4CA 3BF4A 2BM1A 2LDIA 1LXNA 5KFEA 3QRRA 1RBOB 1MMDA 3FBBA 3DLGB 3LO3A 4J5OA 2AYGA 5CYMA 1EB0A 3MECB 4Z7CA 3TA1A 3EICA 4DMZA 1YKWA 2XSJA 2F3JA 4USIA 4B08A 2V8PA 1VQLS 3HLUA 2UXDJ 4QIEA 2J7KA 1GXTA 1RLDA 2CQGA 3FBEA 2ZWPA 3EZ5A 3QSYB 4XDDA 2DH9A 1SBRA 2OEJA 4Y0FA 3HJFA 1DQ9A 1F2GA 3DOLB 1IQZA 1KFSA 4RLEA 4BCAA 4YR0A 1LKZA 1Q0NA 3NGTA 1HHQA 1WEYA 3EVWA 3ILIA 2ZZNA 4CLSA 2ZBRA 4CO4A 1XEZA 1RWNB 5L39A 4O3PA 4EYIB 3FJ2A 5J1EA 3OTDA 4DX5A 3IO1A 4OZLA 4I2PA 1HNVB 4FYXB 5FIIA 4F0MA 2W2NP 3OW2R 1KVJA 2Z30B 3HVRA 5HMYA 3LW5C 4WTOB 1WC0A 5KFUA 1RAEB 3KDNA 4LBIA 3GFZA 4ZVPB 2ZM6J 2OPQA 4XPEA 4USMA 2X1GA 1JLFA 3W64A 3T3FA 3H7HB 4RNOA 1DTQB 4B9UA 4OHYA 2XTJP 2LEAA 5B0EA 4NEZA 3RRKA 3IM9A 5CQGA 4USWA 5SUHA 3IG1B 2A10A 3JTNA 4I2QA 1FKOA 1LW2B 1RB0A 3CDAA 4JV2A 1FRXA 1XNRF 5E0OA 4O3SA 1U2FA 1CJVB 2ACYA 4QPTA 5EUHA 2WHOA 3TVZA 1G4CA 2UVWA 4O4GB 3PVXA 1NK0A 1DZ5A 1RGVA 1ZM3A 1HBNA 5C24B 1VMBA 1QTMA 1TL4A 3IC1A 4QWDA 3Q8UA 3ZTRA 1CC8A 3EGZA 2DO4A 3HDSA 1BY9A 1X7VA 5KAKA 3TAQA 1JB0C 1X4HA 3KYLA 2DXFA 1TKXA 2FC9A 3M32B 3DM2A 1EQMA 3ZTSA 2R3VA 2KHDA 1UFKA 4Q43A 5F8MA 2B43A 2IM0A 3HZEA 2DH8A 2GO8A 2W9AA 2QRRA 2DR7A 1S1TA 4S0MA 1RT7A 3GIJA 2ZHOA 2WW4A 2RU9A 3P6YC 3MPVA 1RYSA 4AL5A 2ACMA 1LW0A 3BN4A 4ED2A 2AV5A 4DUZJ 2RRBA 4A8MP 2R8JA 1DBDA 4NRUA 4YDXA 3SSQA 2GCFA 1NM2A 1RTJB 1WOSA 5F3ZA 3MCOA 2N7CA 4OIXA 4KV8A 3MPYA 4DV1F 4OHWA 4N41A 4TKTA 1S0NA 4WKRA 3TUZC 2R7SA 1VQOS 4NLXA 3VV2B 4ICLB 4CLKA 1HMVB 2ZKUA 1F9HA 1S72S 1WSRA 2WB1D 4J90A 4OLOA 4CZCA 1R8PA 3K59A 2DNRA 1JLAB 3V6DB 2E1MC 3A8IA 5F8JA 4FNIA 4DS4A 4DV3J 3CGIA 1RAFB 4EYHB 4OZ1A 1HWUA 3AA9A 3I87A 5E3PA 1UA0A 1S97A 1U1LA 1LOUA 3CCSS 3OTOJ 4TU9A 5E33A 2VC1A 3NGDA 2P2CB 1H3DA 1VGYA 4URSA 2V63A 5KFBA 2LXUA 3IRXB 1EX8A 1HBMA 2I5JA 2PA3A 4RKUC 1DQ8A 3G71S 4AD6A 5GAHI 2FJAB 4QYRA 3R5AA 2GMLA 1VCTA 3LGHA 3KLGB 1FE4A 3EGWB 3HULA 3E01B 2ZOFA 1VR6A 3UFCX 4QU6A 2CPJA 2XG8A 3KOAA 3MM6A 4DV0J 4AQYJ 3AXKA 2GVZA 2VBZA 2MY7A 2RRNA 1HHTP 3BDEA 1YGYA 2W24A 3W8PA 3W66A 1FO1A 3H40A 2MQPA 5HVGA 2JZ5A 1SH0A 2FIUA 1NDLA 4ZJOA 4DR5J 2MGZB 1KRPA 3CD0A 1N5TA 4RW4B 1X9WA 1Y3JA 3NEKA 1NB7A 4QYZK 2C42A 1VQ6S 1KP6A 2W2MP 3NXZA 4J9PA 1NO8A 2HNDA 5C25B 2QN6B 1ICEB 3HF5A 2BQUA 3J7AN 1SH3A 2VFUA 2Y1RI 2RKIA 4DR4J 3V2UC 3H5YA 3LUYA 4YR3A 5L1JA 5KFPA 1TKTA 5J2MB 3W5ZA 3TOQA 3HP6A 1LQ9A 5L46A 1F0XA 1F3FA 2NPIA 2JOQA 3TX0A 2BUNA 1KLMB 4TQRA 4CLWA 4C97A 1HBUB 2KHCA 4LT6A 3OUYB 4ZLLA 1FRMA 5IM0B 3ENQA 2BOAA 2MDAA 3TAPA 2B6AA 1C1CA 3MEGA 3UDLA 2HNZA 4RUBA 1LXJA 1RWUA 3A3OB 5DGAA 2WOMB 2YX7A 4TN2A 4MMOA 3MMAB 1F2HA 4ED5A 2DRBA 2DIUA 3OJUA 2WVDA 1FJ7A 4OJ1A 4RU2A 4Y2KA 3IAM9 4WKYA 5HROA 1X5TA 4BDPA 4CLZA 4L73A 5JVGQ 3EGVA 2IC3A 4OI4A 1VJQA 3QO9A 1WEXA 4QU7A 2OI2A 2KO1A 5LXRA 2AQ4A 2HRYA 2RH3A 1MN7A 3W63A 1N6QB 2LQ5A 1RDRA 2E9RX 3HK2A 3T5JA 2PI4A 4I68A 3PKMA 1GNKA 1TV6A 1F60B 5KFLA 3S6EA 2BV3A 4ZCMA 3W9IA 3RGIA 3GQCA 2IJNA 3K5PA 2IRYA 3S01A 1MROB 3BN7A 3W7BA 1VBYA 5J1PA 2SXLA 2F63A 1K0VA 4RW9A 4OX6A 3BGOP 1KQSR 3MM5A 5LJ5Y 3CCTA 3HZGA 5HMZA 2AWZA 1RHMB 2CPFA 2UVRA 3R5CA 5L8RC 3Q8PB 5KFTA 5KT6A 1VQ8S 1JKHA 2NREA 3ILOA 3HVWA 2NYIA 4P2XA 4KFBB 3N6LA 2ZJQQ 3D6HB 5LSRA 5KFSA 3HHLA 3MUMP 4AUKA 2DO0A 1RWVB 1S10A 2LLZA 2CQBA 4FXDA 1FNXH 3DYAB 1QAJA 4G1QA 3OLBA 1TQLA 2BKPA 4TQSA 3QQCD 1L3UA 2FVSA 4WWSA 1C0UA 3GMGA 3FBCA 1QAXA 2DNQA 2QEXS 2IMWP 2DEJA 1RTDB 3R7SB 1WNEA 2CJAA 2OGUA 4ZVFA 4PUOB 2DCUB 2J76E 2YKPA 3C66A 3CDUA 1RT5A 1ZA2B 3RBEA 1S6QA 4DV4F 3W61A 2BZ2A 1S48A 2ILZA 2B7BB 3VAKA 4TY8A 5C42B 5ETNA 4DOZA 3PG9A 3U1NA 1S9FA 3PFOA 5KFNA 1SVDA 2CDQA 1HARA 4QQBA 4JI7J 3EGNA 4MK9A 3P5TL 3JYTB 1KLNA 3D1HA 2ZHBA 3H0PA 1VBXA 3CJKA 4E98A 2YWEA 3MMBB 4HHUA 4F0KA 3TAMA 4U8VA 4Z37A 4J9RA 1I5OB 3FCHA 3M30A 3NBPA 3MDFA 1PC5A 5KFOA 4LF1A 2Q6BA 1R8AA 4IQMA 2G1HA 3ENAA 4WIQA 5E3AA 1HHSA 1MU2A 1VQSA 2VODA 2R8HA 3LP0A 4DPUA 9RUBA 4U9RA 4KH1B 4DLGA 4ZVQB 2QTWA 2MTLA 3AJDA 2NUHA 2WW8A 4KB7A 5AT1B 4I56A 4X62F 1QSSA 1S9EA 2VONA 2GFFA 3HVTA 2BVZA 3T1YJ 3KLEB 4RO0A 4FYVB 5KFKA 2AW0A 3K89A 2LQJA 1WEZA 1RHKB 2ZBPA 4F2SA 3JSBA 4OYOA 3R2DJ 1VC0A 2CJ9A 4LFAF 1B0PA 2DBBA 4QWCA 4ECUA 3TNVA 2DY1A 5E3CA 4YY3J 2DGTA 1ZAVA 4MKYA 2HLTA 5HP1B 3HT3A 4ED7A 1VBZA 3L7UA 4LRCA 4ZVOB 4UQTA 5KFVA 1L5UA 3V81B 3H8YA 2M88A 3MECA 2Y1LB 3WBZA 2QYCA 3H5UA 2QA4S 2M8DB 3PW0A 3EVMA 1D0EA 2ZC4A 3QT7A 5HI7A 5D15A 1DJ0A 2FHJD 4DF4A 1CG2A 3I9ZA 4EZ9A 2GQCA 3F44A 4LR9A 3Q8SB 3BV8A 1JLCB 3UE2A 1TFWA 2CJYB 5G0RB 2N3OA 2PN6A 5HBMB 1TKDA 5D3GA 4N7TA 3QWPA 2GQ2A 5A8RB 2K2PA 1WORA 4KGVB 3PHEA 1HQEA 3R1HA 4ED3A 2YPZA 4LQ3A 2V4QA 2GVDB 4G3IA 3NNHA 4DV2J 1JK9B 1MN9A 4F04B 1QAYA 4GVLA 1ELOA 2XMKA 2PSZA 3PO5A 1SQGA 3VGVA 2A2CA 1YX2A 1YJ9S 4HI1A 2AJ0A 1O8BA 2VJUA 5CAAA 2I38A 2MZTA 3HM9A 3ZZTA 3QWUA 3VGUA 1FXDA 2Y8YA 2UP1A 4C2MA 1NMEB 3IMQJ 1B64A 2IRUA 2HNYA 2KI2A 1DTQA 4EK2A 2POKA 5KT5A 3GYNA 2ZUAA 2J7UA 1S1UA 1OIAA 2F7VA 4ZPTR 5KFAA 2KL8A 2G13A 2J9DA 2OSRA 2BW2A 2FZKB 2LKZA 3BB5A 3H59A 4AYBD 4NYZA 5EX0A 4IRCA 1RJJA 4PEOA 2A1BA 5CABA 3RB4A 2FZCB 3K2YA 1KN6A 2VPXB 2VDHA 4LSNA 4PXCA 4K4ZA 1YZ6A 2BJ1A 2FLPA 1IM4A 4CQ1A 1RT3A 3TQEA 4R5PB 3B78A 4X4RA 2ZC3A 2YKQA 3CCRS 2DRAA 2XGPA 2BRKA 1VDHA 2PO4A 1IKWB 2HQFA 1HBOB 3NGSA 1GH8A 1TTHB 3EPIA 2MZ1A 5JVHQ 2C3MA 3E2EA 4ZPDA 1T3OA 3OTBA 1GT8A 4O44A 4JV5F 3HMJG 4LF5J 1G1XA 3M32A 3FK4A 1LWFB 2XY7A 4DV4J 3UN5A 3DDNA 3DCAA 3CIMA 1TL7A 5HSPA 2HMIB 3MFIA 4JI5F 4K4SA 1S99A 4MFBB 2KYZA 4PG7A 1H2TZ 4ZPWR 1M1KT 5LOQA 2UUCF 1SQFA 4FXWA 3MEDB 3BYPA 5B7WA 4ZS6A 3JQMA 2FYXA 3R7NB 3GYGA 3M05A 1L3SA 1AYEA 1Y9OA 1RP5A 1W2BR 1HD0A 5F9LA 4UZCA 1NKBA 5J2PB 1R0BG 1RTJA 4OI0A 4GKJJ 2XM3A 1R6YA 3D0HE 2CNNB 1E6VB 4Y2CA 3VGTA 2E1PA 3DI6A 1NSAA 4NA3A 4PR6A 2UXCF 2MKCA 1N34J 2FY1A 3BGRB 4ICLA 3TJ8A 2OPSB 2FLNA 3FEXB 1C4AA 1WKLA 4FDFA 4X62J 3MM7A 2HGNA 3DFEA 1TKZA 4JI3J 1A9NB 4B3SF 4M5JA 4F4XA 3M6XA 2B4PA 2E5JA 1TK8A 2XMMA 2NSBA 3CNQP 4PYAA 2MQOA 1JLAA 2B8PA 4C0HA 1YBUA 3LWMA 2KXHA 2AF6A 2VH7A 3QZ7A 2GJIA 2VG5A 4P7TA 5ETQA 3DMJB 1QSYA 5I3UB 5EWEA 2LVWA 2XWXA 4LFAJ 3OL9A 2UUBJ 1FRJA 4B3RJ 3SCJE 3UN2A 2APOA 3LAMA 4WFXA 1N48A 1RA7A 4RW6A 4IOBA 2VA2A 3D67A 2R2TA 2E7XA 3I56S 1KTQA 4N5SA 2IAJB 3KUHA 4J91A 3IRXA 3KMQA 4U67Q 2GGPB 1YDLA 2BBEA 5LJ3Y 4CO1A 6FDRA 1U49A 1PYSB 3Q0AA 4BC7A 3BPDA 3FGVA 4MIWA 4YQWA 2L9WA 5ADZA 4F4KA 5FDLB 1UJ4A 3JQKA 2HAIA 2CPDA 5KOXA 1X8DA 3OFHA 1UEKA 4BWJA 1VRUA 3DHXA 2N4CA 4PXEA 1NH7A 4A47A 2BW7A 3DLBA 5HANA 4ECQA 4CP5A 4UQGA 2YX1A 3M8WA 2Q43A 4U8YA 1WDTA 1NK6A 4USJC 2WVFA 4RW7A 4DN9A 3OVAA 1QLNA 3Q2TC 3M2UB 3GB0A 4HHJA 1FX4A 2GIQA 2LA4A 4ECZA 3LH2S 3NAIA 3D28A 4OYAA 1ROFA 2EK1A 3KK2A 1UJ6A 3T1HF 4A8SA 2KRBA 3DOKB 5AE1A 3MCNA 2BE9B 5KG5A 1VQ4S 1PBAA 4JI4F 5HQLA 1K1SA 2NUUG 2YBVA 2LU1A 4FNHA 3HJVA 4P71A 3QGGA 5B0GA 3KJVA 3N6NA 4IDKB 2R7QA 2ZH4A 5D77A 4QBUA 1PJ6A 5CCLA 4NASA 3BGLA 4TU7A 1ZPVA 1WKKA 1JXEA 1TR0A 3IS9A 3D3BJ 4HLBA 2Q66A 1CVJA 3CMQA 3IGNA 1HBUA 2DNZA 1JQGA 3HVAA 3I96A 2HHHF 2IVMA 1RK8A 2MLYA 3TARA 4GC7A 5CA5A 2QA2A 2BJ8A 5IM0A 2EPIA 4L6V3 4X4VA 2C2EA 3JTPA 2GNKA 4NXNJ 3KKFA 1XK8A 3QGPA 5G4DA 3NCRA 3O1LA 3G6YA 1T11A 2KG0A 4WPAA 3GIMA 2VQFF 2QMUB 4L3NA 2YWWA 2ZFHA 1YTYA 1GX5A 2QA4G 4BWMA 3RW6A 2G1DA 4K7QA 3P49B 4L72B 4ED0A 1TMMA 5L9NA 2P6SA 2UUWA 1ZTTA 1M0SA 5BYSA 2O1PA 4M5HA 2QX0A 4H4OB 2YNHA 4U6PA 1TUGB 4ECSA 1JJHA 4QWBA 2VOPA 5L1IA 1U0SA 2FY8A 4ZHRB 4HR2A 1H74A 1MROA 2FD2A 3SQGB 2MQNA 4RNMA 3PNIA 4TYBA 4ZCIA 4PQUA 2GJ2A 4C4WA 2HQDA 1FX2A 2D7SA 2X7IA 3TJ9A 2LU2A 1IQTA 4X4QA 2HBYB 4CH7A 4OYXA 5F8GA 3BGFA 1R43A 3GV7B 1FXLA 1SIWB 4AFFA 1KVIA 1B70B 3AJ1A 3QATA 1IBKF 2VPYB 3KTQA 3WZ0A 4NCGB 4I0WA 2YQ3A 4J9UE 1IBMJ 5AXLA 4LMZA 1CLFA 4F8RA 4B3SJ 4DR7F 2FZGB 3QZ8A 3SIPB 5F0WA 3MHYA 4IG0B 4DFMA 3W62A 3TZZA 2AX1A 1X9SA 2B4VA 2VKZG 2DR8A 2UVUA 3SI8A 2Y0SD 2DHGA 2MHEA 1RTDA 4M5GA 3G96A 4PUOA 4X64F 3EUNA 1RTHA 3MMCB 2WZ1A 3IGVA 1I6JA 3D2WA 2MZJA 1WTFA 3EMTA 2YKMB 3V6JA 4ECWA 3OT9A 4LRDA 4ILRA 4M94A 1BQXA 1K9MT 5C42A 1QTNB 3QT8A 1S12A 1KKHA 5AJ3J 5ETOA 3G8SA 1WDDA 4OI3A 3JSRA 3SQOP 2ZBIA 2J0XA 5GVQA 2E7VA 4WBFA 3CXCR 4R25A 3QJPA 4DUYJ 2Y1JA 5I4MA 3I0SA 4H4MB 1GTEA 3DRYA 4DU8A 3GG1A 1G3OA 2WONB 4CLUA 1VK3A 2ALZA 2HFZA 5GAGI 1FTCA 4P6QA 5LMNF 1WHWA 4W92B 1HNZF 3V5RA 3JTOA 5HO4A 4OI2A 4ZVRB 1JLQA 3UDCA 1LWCA 2MPUA 4IKAA 4CH1A 3KK3B 1YK9A 3L7OA 2Q79A 2EFNA 4P75A 1ACMB 4BBYA 4J9VA 3SDEA 2CPEA 3KLEA 1B0VA 3MFHA 2B8QA 1DTTA 4PABA 3JXOA 3ZTOA 3QLHB 3VAIA 3K5LA 3RRHA 4RNHA 2DGVA 3ZZOA 1WC6A 3KLVA 1YQHA 2Q6CA 3ADAC 1FNMA 1NCLA 4KQZA 1OY9A 2XZDB 4YHHJ 1UVIA 1REVB 2MKSA 2VHGA 4C3LA 2JEJA 2B5JA 2BQ3A 2CXEA 2HHHJ 4MYUA 2CNLB 1RBLA 3NL0A 1KQKA 2BANB 4X66F 3HKZD 1TL3A 2YY3A 2IMOA 3AQOA 1XMOF 4ATNA 4LJMA 2YQ1A 1CQNA 2HFNA 4DV5F 2BJ7A 5D0GA 3ICLA 1TVRB 3PYDA 2VQFJ 5HBMA 5HMXA 4NLQA 4PG6A 3U1MA 5A8RA 4A8FA 1BWVA 3KMSA 3SSSA 3CEDA 4M5IA 4C8KA 4FS2A 1V9OA 3P4UB 4QIGA 2V34A 1U02A 1IJFB 2GVDA 3OTEA 4C0OC 4X4OA 3AD7C 3UPFA 1YHQS 5J2QB 5ETRA 7FD1A 3NCQA 3I0RB 2QGFB 4ZDNA 2IM1A 2DH7A 4ZA1A 5IOLA 4O23A 1AT1B 3B82A 2O67A 2HPUA 2RF2B 3THTA 3PDNA 4B3TF 4ELUA 5JUMA 3FFIA 1Y5NB 2F8EX 1RABB 2ROPA 2N4DA 3PKYA 2MZQA 3HSDA 5I42A 1N32J 1I3OB 1F1BB 1JLGA 1I94F 3M8RA 1UVMA 2XB2D 2YWHA 4RW8B 1FRIA 1JLEA 4DBQA 1TP7A 1G7CB 1SL2A 2PA8D 2D3ZA 2IM3A 4R5PA 3M2RB 1FKPB 1IKWA 1WJ9A 1YJTA 2H5IB 2F4FA 5CYJA 1NK9A 2JWNA 2CYYA 4QOTA 3KNAA 1URNA 4PWDB 3BO3A 3DLEB 3M6WA 3KHRA 3KUEA 6AT1B 2BABA 3ET6B 2CQ3A 5DQHA 2B7CB 3DLLQ 2VOOA 1FKAF 4UY8T 2HMIA 4DSKA 2CQ2A 3PW4A 3ENVA 3T6BA 4ZIWA 4MFBA 2YNIA 2P6TA 1IBLJ 2CZ4A 4MTPA 2RS8A 1EIYB 2RQMA 3MEDA 1NH8A 2J7WA 1AFIA 4PWWA 2XO7A 4G6VB 1WG1A 2R7OA 3VAMA 1Y0HA 4CNYA 5LMNJ 2L48A 1ITPA 1RTZA 3N9UC 1WSVA 1SL0A 1SKSA 5IT9U 2QIFA 2HG4A 2OPSA 5K5MA 3D0IE 1TFYA 1R8CA 1NK5A 1T95A 1HI1A 3MTJA 2MMYA 1JX4A 2IHR1 3W2VA 3QAUA 1HYSB 2ASYA 2CQPA 3BDPA 3M9MB 1HIYA 1YRUA 2JVRA 1HPZA 4NI2B 1CS4B 2AT1B 3L95X 3BYRA 5A8WA 3H25A 2OAUA 1R89A 4W90B 3C14B 4F7VA 2D74B 4D3HA 4ZN1A 2CWKA 4JI8F 1RTIA 1MSWD 2J8AA 3FRYA 2BJ9A 3P8BB 1DHMA 3DLKB 5IFMA 1J5OB 1LFWA 1YSJA 4ES3A 3OVBA 2VG7B 4DUTA 1TAQA 4OHZA 3GTYX 3OFGA 4JV0A 4N47A 3QGIA 2E5HA 2FJEB 2ZH6A 5DM6Q 4Y28C 1N5VA 5KFYA 3PRBA 1RBAA 5MLCV 3OR2A 2NXUA 2JC0A 3SZ2A 4OX7A 2BKNA 3CCZA 4X66J 1S6PA 4TLQA 2D3O1 2AKWB 3T9ZA 1S59A 1ZM9A 2YPYA 2KDOA 3RW7A 3HI9A 4OMFG 2LFVA 1BQNB 2YVSA 3HSZA 4WF9Q 3QJJA 1Y00A 4DCJB 2VPZB 4MT1A 5A76A 4KBIA 3S8SA 5H1SV 3A8JA 1PAEX 3SXLA 5A0YB 2QL5B 5KG4A 2IA0A 4Y00A 2JVOA 4IR9A 4OZ5A 5LXYA 4F26A 3P3DA 1HI0P 5AXNA 3FZ2A 5T41A 1Q5YA 1OS5A 1RQ0A 3MM8A 1S1VB 2XYPB 3PCOB 2QMWA 2FLOA 2MKIA 2KJVA 2HFOA 5D4PA 1RAAB 3DRPB 1IVZA 2L3MA 4KHRA 3PYGA 4IDKA 3UDVA 5BR8J 3ZZZA 3UD3P 3SMZA 3W2WA 4DFJA 1S9GA 3LGMA 3BREA 3FEZA 2ATLA 1QD1A 1BWEA 1PILA 2XHCA 2W8LA 4J9QA 1HQUA 1N88A 4K59A 1MWZA 2UZAA 3HSJA 4DSFA 2PI5A 2MXYA 4WU3A 4KR0B 1X60A 2DB1A 5DG9A 1TL1A 3D4JA 1F3VA 4CT8A 4O3RA 2CRLA 5J1NA 4KO0B 4WP9A 2XMJA 2VU5A 4JOUA 4B3MF 1IKVB 4V19X 3W60A 4YB6A 4DR1F 2ZH7A 1KFDA 3IA0A 3ILJA 1WG5A 4EEYA 3OL7A 5DGBA 3FSYA 3U1LA 4CLFA 4IH5A 2LQ9A 3E8OA 2AHOB 2L9DA 3C16B 1F6TA 4FZVA 3DKDA 1NAQA 4DCOB 3MPWA 1PAUB 3KXDA 2HVHA 4X4PA 2DGSA 2C3PA 1RT4B 3PYFA 1GMVA 2HIYA 2DKOB 1N5YB 2XEXA 1UMJA 3VQTA 2W7PA 2HVZA 1B4SA 1Q5VA 3GYXB 4DZDA 5HATA 5EHHA 2ZEJA 2ZZMA 4DR2F 1AA1B 3C8YA 1VQ5S 5KFXA 2A6OA 3ELHA 2CA9A 3Q24A 1JNRB 3NGRA 4NCGA 1VISA 3O2IA 3I4PA 4UZBA 1YJWS 1IKXB 2H4WB 2V8DA 5GAEI 2FB0A 4DX8H 1UCNA 3TW0A 1W2IA 3KJNB 4Q8EA 1AFJA 2DJWA 5D4NA 4KGZB 1BQMA 2HQGA 3HX9A 4JV1A 1FJCA 4OI6A 2RVJA 2XLJA 5A2QU 4JI2F 2QFIA 1GXLA 2QT7A 3G6XA 2YWFA 3GFXA 3H2UB 3GJQB 4NZ6A 5DRKA 2GZOA 3TX8A 4W98A 4HVZA 3J7YI 1SJQA 2AJ4A 2HS4A 1WHYA 2YKMA 4OQJA 1T03B 1K47A 4JI0J 2UXDF 3IXQA 4CTAB 2EEYA 4F25A 1X4AA 1BXNA 2LA6A 1RAHB 3C46A 1RT1A 3N4WA 4O3OA 4C8OA 4ZVGA 3DRSB 3GPAA 3GE9A 1C1BA 2L41A 5K8NA 1N0UA 2JJ4D 1G2EA 3L7PA 3LP2A 2VBWA 3PW5A 5HJXA 2GX8A 2E1RA 2M3DA 3WDOA 1C0TA 3GONA 4DXLA 4WFNQ 1XN9A 2GA7A 4ILMA 1U6BA 1FD2A 2A2DA 4OJ3A 5F8LA 4OHXA 5LSOA 4DQIA 3FVYA 3T19A 4MIAA 2K8GA 4ANDA 5L38A 1UP1A 2R7UA 3AHPA 4KAIA 3TP2A 1FJEB 1NKEA 1VS3A 1D9FA 1NZAA 3AB4B 2YKNA 1DLOB 2ZJPQ 2DRDA 1JLBB 2ZM6F 1FFGB 4LF8J 1H98A 3ISZA 1NKCA 2FVPA 4ZPAA 4E0DA 4QWAA 2O66A 2NSCA 4V1Ak 2PE8A 1YRTA 3CIZA 2R2UA 1FJGJ 3H98A 1CJUB 2W7AA 4DG1B 4M95A 4K4TA 1RAJA 2ZH5A 2HBQB 2LYVA 4WZQA 1AZSB 5FJ4A 5ETPA 1UWBA 1REVA 2CJXB 2ZE2B 3NRBA 1R0AB 3SV3A 2WBMA 2FHMA 1K8AT 3H4BA 4FBUA 2E5GA 4YP3A 4LF4J 2X1FA 3VCDA 1XTZA 5GAGU 4FXVA 3I5AA 2BANA 1IJEB 3Q22A 1S0OA 1HNIA 3FKBA 1WF0A 1YJUA 3NGKA 3HO1A 4LSLB 3AFGA 4FF1A 1SKWA 2EW9A 2HGMA 3ZO7A 4L74A 2KT3A 1A0OB 2E44A 1FHTA 1SI9A 1T9XA 2GAHC 4WCEQ 5L1KA 2ZBCA 2EXUA 1H7WA 4Q2LA 3QRPA 2H48B 2V94A 3PEHA 1RT6A 2EFGA 1Q7LB 3UN3A 4BC9A 3FZBA 3PIPQ 4DPTA 2KM8C 1SJ4P 3BSNA 3MAAB 1FWPA 4DPXA 2DEIA 3FQKA 1WUUA 2HVEA 2X1AA 4CYUB 4DUZF 1U2CA 2B9EA 1AB8A 3GIRA 4N8NA 2V4JB 1UVKA 2K06A 3BR9A 4IG3A 4Y2AA 1OO0B 5FD1A 2FJWA 4I7FB 1XWLA 5IC6B 1T8EA 2YNFA 3QGHA 2AYMA 1VI7A 4AT1B 1Q4RA 4NA2A 4GO5X 4C11A 4EUVA 4A4JA 4Q0BA 4YFUA 4ERDA 3IR6B 4P9SA 6FD1A 1IWGA 2VG6B 3BO4A 2PGCA 2XHWA 2KN4A 2U1AA 1IM6A 3LPYA 1U1QA 4R0EA 4EBDA 2AJFE 2DY9A 4DV3F 4NXMJ 3PTWA 4OV6A 2DNNA 3RU0A 1GMUA 5DZ6A 3FCVA 2H65B 3OTCA 2RS2A 1QDUB 3DDIA 3M2RA 4LF9J 1FKPA 3OTOF 2AGPA 3OSNA 1KDNA 2OPPA 4JI2J 1RLCL 3V6KA 3DGPB 2HVIA 5KFHA 4QR2A 5KG2A 1T05A 3A8KA 2EVZA 1WG4A 3DLEA 2AMCB 2H1YA 4DX6A 3HXMA 1NU4A 5CHCB 4DR3F 4DR6J 2XYGB 1PC4A 3BKUA 4MH8A 3OD2A 3E51A 3BSCA 3DLHA 5KOWA 2HS0A 4LF7J 3QFWA 3VAHA 2LXIA 3RBDA 3BEGB 3HHKA 4HL9A 4JYAF 2R7XA 4K4UA 1HFEL 3D3CJ 1P27B 4QPXA 4PPDA 5FLXU 4DV0F 2UUAJ 2MZSA 4AQYF 3CC2S 1OSDA 1U45A 4C3MA 3HD1A 3I9V9 3KLIB 3T1AA 3IAS9 4UTGA 3TWZA 1IBCB 1HNXF 4DR5F 1RSCA 3CO0P 3HHDA 1S1XB 1RWXB 4QIWD 1ZOTA 3PJXA 3OBIA 3KK1B 2BX6A 3POTB 4KHPJ 2ZITA 2EKYA 1MWQA 1TL5A 1YJ7A 3AJ2A 2VPWB 3RBZA 4WK3A 1Y5IB 5E3QA 2FQQB 5GADU 3ONQA 2DHSA 1WI8A 1DY3A 2FLLA 4J9LA 5CD4H 1HYSA 3TVKA 2ZD1B 1EAYC 4DR4F 4B9NA 2Z2ZA 1FK9A 4YS2A 4WFYA 2M52A 3QFHA 2A6MA 3S1TA 2M9KA 2QYGA 1WC5A 3F0NA 2CKWA 8ATCB 1UZDA 1IKYA 4RL1A 4F50A 1CJKA 3NS7B 3CSKA 1EP4A 2LQBA 2MQLA 1WOPA 2CVIA 4BHQA 5IT9Y 1YI2S 4AXIA 2QLJB 2BOPA 3JSMB 4MAKA 4JB8B 5D0RA 2C2ZB 1RCOB 2K1RB 2B3TB 4A46A 3CJ4A 5IWAJ 3M7VA 2HVDA 4N56A 2I9SA 2OTJS 1ZM4A 1X4FA 3EJMA 2FVCA 1D1UA 5E7OB 1RAGB 1FEHA 5K8MA 2YH1A 4M5DB 2W2QP 5D78A 3TUPA 3ZC4A 3D66A 5C7PA 4FF4A 4K2JA 2AEJA 4NRTA 4ER8A 1X4CA 2ATCB 2ROGA 4C8YA 1V6HA 1CJTA 4YEAA 2A18A 1P1TA 2C3UA 1XBWA 3NAHA 5CYMB 5A0YA 2KH9A 2LP4A 2GAGC 2C28A 3PY8A 2J0SD 2W9BB 3J7ZT 1XIQA 1SC1B 3AY0A 3A3NB 5KFFA 1RAIB 1HW8A 3QRQA 3JAMU 4ECXA 4EBCA 4ZP7A 4XK8C 2XMTA 3M8QA 2VJVA 3NS6A 1YJRA 4ZN3A 2P9GA 2D9PA 1NPRA 3SCLE 1WHXA 4WTYA 1D8YA 4DWIA 2WVBA 2VFTA 4URQU 3ULHA 4OLPA 5J1EB 3KLHA 2ZNYA 3PX4A 3CTRA 3WX4A 2OMLA 1O0PA 1A7GE 2D3OR 3PX6A 4Q2MA 1JJ4A 2RQCA 3CMES 1J27A 5KFCA 2CG4A 3IM8A 1SC6A 2HQCA 1JLFB 4K5RA 1R6VA 3I32A 1N0VC 4RUAA 1QUPA 1RT2B 3T9NA 3QIPA 4R8UA 1ZZNA 4KO0A 1XR5A 2JLEA 3DC2A 4JI7F 3FC9A 3L9ZA 1S4FA 2FGOA 2F8MA 3CJRA 1DRZA 4I2QB 1FKOB 2ADCA 4DR3J 1FT8A 2NXCA 3LQVA 1P8GA 2W9CA 3DDKA 4ID5A 4KTQA 5CD4A 2DNYA 4KT0C 4LR8A 4HKQA 2BR0A 3C16A 5B0CA 2VQEJ 2RUGA 2L9NA 4IO9Q 3QT5A 1RHRB 2R8IA 4JYAJ 2MKKA 2DIVA 2G2YA 1HBNB 4OZ0A 4FN5A 3N6MA 3T41A 2V2VA 5KG3A 1VQMS 3DOMA 5DO2A 3CO9A 4U96A 3FSXA 1YBTA 2DNMA 4GC6A 3OPKA 4NLTA 2P9EA 3OVSA 3NNCA 2UUTA 3MZIA 1Q8KA 5J2NA 1HNXJ 3UCZP 4B17A 5HQ8A 1TKXB 2D41A 2IY5B 2N7YA 2DNHA 3T1YF 2XY5A 2CFXA 2V5HG 3M2VB 4PYDA 1GTHA 2A0FB 3QIDA 2FHJA 2W7OA 2P5VA 2ZOMA 3D54A 1FCAA 1S1TB 1REGX 3WHIA 2UVVA 3PIOQ 1H73A 1RT7B 4A8QA 2RNEA 4O0IA 4NZ7A 4YY3F 1HR0J 5HAOA 1QY7A 3EYZA 3R5DA 5GMKa 2ZOGA 1LW0B 1EQ0A 1XNQJ 3EXYA 3SSRA 4IOAQ 3PHTA 4O3QA 4ECTA 2VIHA 1ZETA 1FI4A 3O5TB 3KLFA 4B9TA 4P2FA 5AXKA 1S1WA 4CO0A 1M5KC 4LQ9A 4EMDA 1UVLA 4YN3B 3UDEA 3MGJA 4OZ2A 3NP5A 5M2RA 1T9YA 1Q8IA 1NUEA 4DDFA 1J5EF 4OX9F 1CSJA 4WU2A 3U7JA 1KC8T 2QA1A 1CQMA 1UW9A 1KQFB 3I31A 1U1OA 3CC4S 2GV1A 3LOUA 1U7LA 3K5OA 1IWAA 5A2QY 3KJQB 3F41A 1VQKS 2R4FA 4KIAA 2KT5A 3L3CA 4KKOA 5GAEU 1SC4B 2QSFA 3VHQA 3Q89A 2HBZB 4YDDB 4DV2F 5F3TA 1SQEA 2HHWA 1NRKA 4PG5A 1S49A 3R5JB 2IFXA 1HBMB 2I5JB 4J9NA 2OPRA 1SC3B 3D6MB 1FWKA 2L08A 2BDPA 1U47A 4M5MA 5DG8A 1R7IA 1HWLA 1X5OA 4NMLA 1NPPA 3CCJS 5HMWA 1X5SA 2BE2A 2M0GB 3FBFA 4UUWA 2JEGA 1AUSL 5DZ7A 4DFKA 3IWNC 1CJUA 3M9NB 5HL7Q 4ZVHA 3MM6B 4WFAQ 1JXVA 4K4YA 4B9VA 4OZNA 4QIFA 4XO0A 1SJRA 3MM9A 4CO3A 3QJLA 4XIUA 1NDKA 3G82B 4QR1A 1T0TV 1EARA 4O4RA 2XMAA 3VGSA 3NMAA 4WYWA 1PO6A 1FVQA 3G8QA 8RUCA 1G6BA 4GVBB 3C3LA 5HLFB 3Q8YA 4LFBJ 2EFQA 2JFKA 1Q7YT 5A8KA 4J7CA 2HNDB 1MMNA 4A8WA 4TYAA 2PIIA 1E6YB 3VVUA 1H72C 3QMQA 4DFPA 3R6LB 5KFDA 4LF5F 4NOHA 4IH6A 1Q8LA 3DRXA 3NMRA 3C6TA 2RKIB 2H5JB 2DITA 1RXOB 2YWKA 3UI3A 4USUA 2YNGA 3OHBA 2DYAA 1VBKA 1N8RT 4PXDA 3MR3A 1TKTB 4OYIA 1WC1A 1T9VA 3DGVA 1H0HB 1KEKA 4DV7J 3BSOA 1MWYA 5LMUJ 1JIHA 4IFYA 1CPZA 1V3ZA 1L3VA 4F36A 1EETB 3CD6S 5KFQA 3AA8A 4CYUA 2C2MB 4F02A 2B6AB 3EE3A 2HNZB 2IYGA 1ZAXA 1RWMB 4GKJF 1UEVA 3VZHA 4I7FA 1QJHA 5IQQA 1TK5A 2EG1A 1N34F 2EBEA 4K0KF 4M63A 4U7UD 2IVFB 5HROB 2BKOA 3W3SA 4OI1A 2HWIA 3RB3A 4JI3F 2XBPA 4ZOSA 2VG6A 1YBAA 2W2PP 2VC0A 4UW2A 2X3DA 4HT5A 5KFZA 5H9EJ 1FESA 3GCXP 1HNWF 2B9WA 3LALA 3WIVA 4CLYA 3Q8VA 2UUBF 4B3RF 3I5BA 1NHVA 3GSIA 5C5JA 4RW9B 4XDCA 1ZBTA 4ILLA 2GHWA 3DLGA 5KFGA 1KONA 2IJFA 2DNKA 2UU9J 2FC8A 1UZHA 4PKDB 5IT0A 3PYEA 4DEZA 3TZYA 1JKHB 4I69A 2G4BA 2AJ1A 1RADB 4YOEA 1RA6A 1J5EJ 4OX9J 3PJ9A 4CLPA 1HWKA 2NXEA 3HHLB 1NK4A 2K7JA 2V9WA 4NWBA 3G8TA 3DOLA 4G1QB 2ADBA 1F5BA 3ZZ0A 1PJ7A 2R8KA 3GFYA 3NGUA 5KG7A 4OJHA 1C0UB 2PEBA 4IO1A 3HHLC 1S6UA 2RHSB 3GJTB 2KU7A 4FPRA 3GZ7A 1P6TA 2VASA 4U7UK 4USHA 1TUVA 3PX0A 1S6QB 4AXJA 2ASDA 2G2ZA 4DQPA 1HNVA 1X0FA 4NYPA 1HQ2A 4TY8B 3EDQB 3OV7A 3POTA 1XC9A 2ZVIA 2HW3A 4QR0A 3UD5A 3SFUA 2V2QA 1GMWD 2XWYA 4LR7A 4DV6J 1ZAWA 5FLXY 2W8KA 3CJKB 1Q79A 4NCBA 3R27A 5A6WA 3M30B 3NBPB 2HZVA 2CPYA 2XO6A 5DQGA 4NLGA 1MU2B 3IG1A 3ETMA 1S7HA 4EU0A 4X4TA 3LP0B 1LW2A 3WQPA 3M1VB 2D69A 2V8VA 2Z0GA 1U09A 4ANEA 3VAJA 1CJVA 4MYTA 3X3UA 4NXNF 2NCKL 4O4GA 4TU8A 4ED8A 1S9EB 3JSMA 2BRLA 3W9JA 3T5KA 5C24A 2F65A 5ETMA 3GSDA 5GMDA 4Q5VA 7AT1B 4PAAA 3FCWA 3GIKA 1Q78A 2EFOA 2R7TA 4FYDA 3FMBA 5F9NA 2KFYA 3KHGA 1WI6A 4HHHA 4CO2A 5LT5A 3OJSA 1KWMA 1FEEA 4ZCLA 5DS7A 1JNZB 1IN0A 2VB6A 2CQHA 2WRMA 1IR2A 1YVFA 4P2SA 4YB1P 5A6PA 3UD4P 5CZXA 3VAGA 3GV5B 1JWWA 1U48A 1ZPWX 1F9EB 1U6ZA 3ZNJ1 1VIXA 4JI1J 5F0UA 4ES1A 2PC6A 3H4DA 2CJKA 1U1PA 3T6JA 2W9BA 4YB7A 3QYYA 2AGOA 2C2KB 5DDQC 3FDSA 1RWWB 4HH0A 3MR5A 2R42A 4BS2A 4HDGA 3O8WA 1SJ1A 2VL1A 2MKYA 3H5XA 1QUVA 2J9CA 7FDRA 4OYWA 2BJ3A 3OXGA 1WTBA 2O3DA 3RUBL 5B0BA 4GKKJ 5D3GB 3CJTA 5EN1A 4K0KJ 3U02A 3LANA 1IBMF 1HMVA 2OD6A 3KHLA 1HQEB 5DDRC 4DF8A 4ECYA 1WF1A 4QIVA 1CC7A 2I8EA 3ZTPA 1N33J 3S7RA 3HFKA 1WKJA 1VRQC 2M5YA 3V6DA 3CUNA 3WX8A 4DCPB 5ETLA 1BMQB 1S4EA 3G87A 2AZ1A 3I6PA 1HNWJ 1BLUA 1B3TA 3JAMY 2Z8QA 2M70A 3H90A 4ETZA 4GO7X 4DL5A 1K44A 2OD4A 1DQAA 5HVFA 2ZBQA 4J9KA 2HNYB 1RT2A 5C2CA 2OIHA 1GK8A 2XS5A 1S1UB 2COLA 4B9MA 5AJ3F 4DSLA 2EC0A 4K50A 5CCMA 2C3YA 2XNQA 1M1GA 2HAFA 3X1LB 1N36F 2LECA 4RZRA 2KXFA 1M5VC 1GQEA 4NX9A 4I4BA 4C3KA 1Q53A 3NS5A 5HJYA 2M2BA 1OYEA 4ZLJA 4DUYF 4LSNB 3KLGA 2YX4A 2KJWA 3E01A 1UFLA 3NOGA 4PG8A 2JC1A 2HHVA 2JH3A 4CRJA 1U25A 2XGQA 2FTRA 3QSIA 1RT3B 2GHVC 3N79A 5HVHA 2F4VF 3TA2A 3IR7B 4ZVTB 3NWGA 4WXOA 3Q23A 3SEOA 2ZH9A 5ETSA 2FJXA 4CLTA 1VIOA 3GV8B 3J80U 4O44B 2MGZA 1MW7A 5I3PA 2CPHA 4RW4A 2ASJA 2HGLA 3H2LA 2JX2A 1PYTA 2KRRA 3M2VA 2V6AA 2XMVA 1TK0A 3PEJA 1Q16B 3DU5A 1TL7B 1M5PC 3K5NA 5D4LA 5C25A 2DR5A 1OY8A 2MYFA 2J5AA 1IR0A 3P5BP 2QJ3A 2F1FA 1HWJA 3TUJC 1VOMA 1MNEA 4LRBA 4YHHF 4LF6J 3C2PA 1EJ7L 3BQ1A 3AAWB 2R2RA 1NNDA 5GAHU 2I0XA 5J2MA 3QAEA 5AXMA 5ETKA 4X65J 3PW7A 4G1PA 4LIWA 1FDDA 1KLMA 4HDHA 4F4ZA 3PV8A 1NJIT 4LIRA 3T5HA 3DNCA 4KGMA 1GX6A 1M5OC 2W4PA 3OUYA 4H54A 3DI6B 5KFIA 3RBXA 3LP1B 1N4LA 5EDWA 4LRFA 4EZ6A 2F40A 1FTRA 4OFZA 3RRGA 3CDWA 2XS7A 2BYCA 3MM7B 1TKZB 4P72A 2WOMA 1QVFR 3LF0A 3MMAA 1UETA 3THVA 1Z2LA 4ZJLA 4P10A 4ZJQA 4CT9A 1OPZA 2Y3YA 1SKRA 2GJFA 2AJ2A 1D9AA 2VG5B 4OYMA 2K3IA 1IXKA 3BQ2A 4WFBQ 2B0GA 4DS5A 3H42A 2J9DE 4WE1B 3A8EA 3FSIA 1N6QA 4RW6B 1VLOA 4F3OA 1EKSA 2R9LA 2ABYA 1PYOB 4ZLPA 3VR1A 1KNZA 2GO9A 1FVSA 1U8WA 2W2OP 1N5QA 4CM2A 2W4DA 2YH0A 5HN0A 4A48A 1ZM2A 5D0EA 2VUGA 4WIIA 2KZMA 2KFZA 1RI7A 3UW1A 1VRUB 1XMQF 2EFPA 1VFJA 3SBMA 4W4MA 1N32F 2W01A 3LPEA 3CCQS 1TUWA 4ZVEA 3W5YA 2CZ9A 3CDEA 3GWCA 2CIMA 4RW7B 2YKAA 3G82A 3A1YG 4KFBA 4ZKAA 4EFAC 5IXUA 1KHVA 1S7IA 5EWGA 3DYAA 4G1IA 3IBFB 4GVBA 4ZLNA 3QNWB 4B3OB 3A4TA 5HLFA 3KK2B 2HHTA 1LWEB 1FDAA 2QE5A 5BYQA 5KG1A 1VQ9S 2H54B 4USTA 1E6YA 3BH7B 1ZTWA 4TLRA 4RUCA 3BR8A 3KJVB 3MR6A 1Y5LB 2KG1A 1P9YA 1SB6A 2B4OA 2W1BA 3IS9B 1HKAA 3M6VA 4B9SA 3ISNC 3JYTA 4O0NA 1IBLF 2VF3A 3HD2A 1N36J 3UR3C 3MMBA 2BACA 1EETA 1XNRJ 4X4UA 2XZTB 5CYQB 4ZITA 2FUG9 3TEGA 4JP8A 3NKYA 5IQ6A 2G2OA 2C2OB 2RDDA 3MUTP 2DHAA 3MCSA 3L09A 1UEUA 2F4VJ 1YG0A 2RQKA 4EI2A 3CJSA 4C7QA 4FF3A 2B51A 2XMWA 2G9OA 4KHMA 4F0HA 2DGWA 3RJMB 2DR9A 3BPSP 3O6QA 2E66A 4IOCQ 3MCMA 4D3GA 2YNHB 1YLXA 2PMWA 3PJWA 2GIFA 3C6UB 2JEIA 1YJNS 4Z2XA 4LF2A 1K1QA 2YXLA 2BQRA 4YUDA 1F5CA 2ZVSA 3BH6B 1WWHA 1NPKA 4OYZA 1N56A 5HP1A 3R7BB 4PQUB 1U1NA 2K7KA 4LSZB 2EG2A 1KOHA 1R3NA 2CQ4A 3V81A 1YWXA 3MD1A 1WELA 3OHAA 3RAXA 5KT7A 4DV1J 2OSQA 4WXWA 5IT4A 3MAQA 1TMJA 4URGA 2CNOB 1ZYQA 3CB4A 1N52B 1BC6A 4RWWA 3PRDA 1T7PA 2OO4A 1SIZA 1JLCA 2BMBA 5K8OA 5KFJA 2QC3A 3NWRA 2HZCA 4JUZA 5G0RA 4WYLA 4RBTA 4L3KA 2H3EB 2FJVA 4X4NA 4Y6IA 1FRLA 1RISA 2J0QD 1APSA 1U1RA 4OX8A 1RHJB 1RTHB 2UV8A 4NA1A 1LWXA 1BD6A 2GW8A 1X5PA 1V3RA 1VJWA 2YKOA 3M8PB 4CCHA 3TVYA 2E5IA 4Q8FA 2Z58B 3OQ2A 2HLUA 2I6WA 2RJZA 3A3PB 2CQ0A 3AOAA 3BBCA 4G65A 5ETTA 2RT3A 3CDBA 3Q83A 1EHWA 1W25A 3NY0A 3UNYA 5L1LA 3PO4A 5BR8F 3K8VA 4U95A 3I0SB 2VV5A 5ITHA 4KSEB 3DRRB 5T7LB 3SFGA 3GLJA 4JBCA 4RR5A 1XMQJ 1KR4A 3DN9A 1I1GA 1JLQB 2MKJA 3M1VA 4Z7YA 1Z4UA 3US5A 1LWCB 2VFSA 1QVGR 4LVNP 3TRGA 3RTVA 2EWHA 5DG7A 1PG5B 3KG0A 1NJWA 3SDEB 4TXSA 5IZHA 4ELTA 2DGXA 1HBOA 3TANA 1DTTB 5K14B 2ZKTA 3V6HA 4HTJA 1K73T 2F8HA 1LEOA 4LVOP 4MKAA 3BJYA 5B08A 4Q44A 2CPIA 4ZVSB 4FS1A 2CJBA 2BJEA 4WP8A 3I4HX 5F8NA 4Y2IA 1LWFA 4RX6A 4PPZA 4K4WA 4MJKA 2AIRB 1QM9A 1D8ZA 2B5JB 4FKYA 2FVQA 3FRZA 1GAOA 2ZZTA 3V4MA 2QO3A 3MD3A 4DL4A 2NS1B 2PEHA 1HW9A 3AD8C 2VFRA 4GMKA 1TL3B 1RE1B 2VBXA 1VQPS 2IYIA 2V4RA 2Z2LA 2NZCA 2DPJA 2OKQA 1Q82T 5J2PA 1FRKA 3HKWA 3CC7S 2CPZA 1E6VA 4ZP9A 4OV1A 3MR7A 3AB2B 2AX0A 3BGRA 1WC3A 2EC2A 4KPYA 2X3GA 4NYOA 1OWXA 4M5NA 3CE8A 1RYRA 3CD7A 4XTTA 1U8SA 2QZ8A 5CZVA 5DM7Q 2Q3PA 5KG0A 1BUXA 2J9EA 5IV3A 1OJ4A 2R2SA 5CH7B 3VWSA 3J7Z5 4FBTA 2HS3A 3IP0A 4N76A 2ZDOA 2CQDA 3DMJA 1SPBP 3AOBA 5I3UA 4DLEA 1S5ZA 1S57A 1SH2A 1K0TA 3H5SA 3NCPA 2I2YA 4ZIVA 3GG0A 2NPFA 1CULB 1LV5A 4JI0F 2CQ1A 4A8KA 4NZ0A 2RAQA 2IAJA 3FFIB 3HT0A 2C22A 2GGPA 5E2QA 5BYRA 5KFMA 5D8HB 2OHDA 3BKTA 4IRKA 3GILA 2KT2A 4UOCA 4UOFA 5I42B 1U1MA 1JLGB 4PCQA 4ZMMA 1C2PA 3OLAA 4DZ6A 5FDLA 1JLEB 1X4GA 4ECRA 3M9OB 3FQLA 3DXBA 2W4CA 3LAKA 5D6GA 3D7SB 3J81j 3MEEB 4ZPBA 3E3XA 3HSGA 2CJQA 2BA9A 4C8NA 2V69A 2DTJA 2GHPA 2QV6A 3M2UA 4LF8F 3Q2SC 3H2VE 3N01A 2NYHA 1Y7PA 3PR5B 1UW4A 4DHVA 1OQ6A 1U2RA 5B0DA 1H2UX 3J81U 3D6FB 1FXRA 1HD1A 1N5SA 3GCWP 3KWMA 1FJGF 3DOKA 5MAOA 3Q86A 3NG8A 4PWUA 3G6ES 1TELA 1HA1A 1KD1T 4ECVA 2HYIB 2YNIB 1S0VA 3F73A 3N5FA 1M90T 2BJDA 3HHLD 3IWLA 2B9XA 3PW2A 4F67A 1NZ8A 2OUGA 2CQCA 4F4AA 4M5KA 1KSPA 3J80Y 2LDYA 3A13A 3ZFVA 1NBEB 2RU3A 5H9FJ 1VHIA 4LF4F 2MJNA 3RR7A 2ZH1A 5U47A 2E1AA 1LNQA 1M5SA 4OL8A 4IH7A 3R3TA 3LP1A 1SCJB 2YWGA 1CBKA 1Q8BA 1VK8A 2IBOA 2H51B 4HACB 2Z57B 5ETVA 3W2VB 1F9FA 4TVAB 3TI0A 1HL6A 2HQ3A 2JFDA 2OTLS 2F9DA 4DL7A 2CAJA 1HPZB 2ZWOA 1WOOA 1RWOB 1HLWA 2W25A 1JJCB 5A8WB 1NB2A 2QLWA 4ZK7M 2V0NA 2XSFA 1U0HB 2RQ4A 5DQIA 3CT9A 4ZPVR 4IR1A 3K0JA 4Y2MA 1RTIB 2VICA 5F8HA 4N77A 2OEMA 4C0BA 4RBUA 4CI0B 5H9EK 1UVNA 4WE1A 1XQIA 2MZRA 4H4OA 2MLXA 2E5LF 2N3LA 2NR0A 1R27B 2PD1A 3GJRB 5CXTA 4K4XA 2VZ9A 4RJVA 4ZHRA 2AGQA 3OR2B 3SQGA 2DPIA 1Z1ZA 2YTCA 3U27A 1S6PB 2E29A 4UT4A 4J9SA 2DCLA 2JNJA 1OQ3A 2DD8S 1T9TA 1RHUB 2QG9B 5K9FA 4PRFA 4U7CA 1RKIA 2ZH8A 4DPWA 1Y3KA 2C1EB 1GFWB 4NXMF 2C2NA 2KYXA 3CPWR 1KOOA 4DQSA 3FMWA 3B4DA 4LF9F 1V5IB 4IG0A 3CJ3A 3MMJA 3MOJB 4B3OA 3UVJB 4EO8A 1UWAA 4MKVA 1QSLA 5DDOC 2J6TA 3GU0A 1LWEA 2FJBB 3BSAA 2RIJA 1VQNS 4DL2A 3MM8B 1NDCA 4EWTA 3BKFA 1ULRA 4X2BA 2J0WA 1KVKA 3TQ1A 5B09A 1WACA 4YR2A 3MMCA 4DR6F 2VKRA 2ALYB 4MIBA 2XC9A 2V2ZA 3ZZRA 1OPIA 4LF7F 3W2WB 2GMHA 4ITSA 3TUIC 1S9GB 1LFPA 4XPCA 2QLBB 3K8WA 1KQGB 2HKEA 2G0IA 2H5EA 3D0GE 3FUYA 2UUAF 2Z4PA 4I6AA 3ZZYA 3LTOA 3SV4A 1VYAA 1MMLA 2Z2YB 2AU0A 1HQUB 1O6XA 2PMZD 4IRDA 1D9DA 4H4MA 5CYQA 2MEWA 3BQ0A 1BHNA 1URRA 1JJ2R 2WONA 3R2CJ 3W9HA 2KXNB 4H4KA 1XERA 4OHVA 3GP9A 3ILLA 2C2RA 1TL1B 5KFRA 4ENOA 2EKNA 3B54A 4KHPF 2YQ0A 1MLAA 3CD5A 3THPA 3ZTQA 3KK3A 2IPOB 2IM2A 3MAHA 1EZZB 4EGLA 4JV5J 1HI8A 3HCXA 4NLOA 5HK4A 3TEHB 3OL8A 1LK7A 2QLFB 4M5LA 1Z2ZA 3QLHA 5SZTA 2WVCA 3N0VA 4CIOA 3C6UA 3N28A 4JI5J 3OFFA 2LEPA 2OMOA 3MEKA 2R7WA 3P96A 2UUCJ 2GS8A 3AD9C 5IS2A 3PR4A 2HFSA 2V8GA 1WHVA 3G9CA 3OFEA 1YRXA 4Y3CA 2QL7B 2IA6A 1TZ0A 4X84A 3RB0A 2AP6A 4WFZA 4NLPA 2XNRA 4A8OA 4EO6A 1FWLA 4LRAA 5IWAF 2GC8A 2OFHX 2CG8A 2MQMA 3R97A 2BEFA 1FERA 2UXCJ 1PBUA 4QW8A 2WTFA 4C8LA 1RU1A 4NE9C 1F5AA 4ZPCA 1SV5B 1O51A 2RB7A 2XYHB 1IUJA 3P45B 1KBRA 4HI2A 2AZ3A 3LA0A 2KM8B 3H20A 1BQMB 4R0JA 1TVRA 3PRVA 3PACA 4AL6A 4OZ3A 5IV4A 2HRUA 1UA1A 3KJFB 1W26A 1U1KA 3FEYB 4DJBA 2XMUA 4NLSA 1FDNA 3K57A 1NK8A 2P9CA 3MI7X 5J2QA 3CJ0A 3GJSB 3C15B 4E8UA 4A8XA 2E5LJ 3I0RA 2MY8A 2GMJA 3M8PA 2FHKA 2ASLA 2PFFB 4K4VA 1RT1B 3CCWA 2FGCA 4RPFA 5F41A 4KH0B 1X9MA 1R8BA 1SUQB 1C1BB 2E1CA 5KT3A 2HK3A 3EVOA 2KVQE 3LP2B 1FDBA 4B9LA 1NEEA 2HURA 1UPMB 2RF2A 4OYBA 1L3KA 2ZDPA 3G86A 4TY9A 3GR1A 3VTIA 3OR1B 1C0TB 1OY6A 1ZS6A 2OLWA 3DRRA 4IFVB 5T7LA 3TZXA 1H7XA 1RWKB 2PMHA 2MQQA 2EFVA 2A3JA 5L9XA 4F2RA 2C3OA 5KG6A 3B4MA 1DAXA 3AT1B 3MF5A 4K5SA 2R8GA 3PM9A 4NMXA 4RW8A 2YKNB 2JL9A 2LMIA 4F4WA 4RBVA 2WSEC 4H4KC 1FE0A 3KG1A 4NLWA 3Q8RB 4DQQA 2DXDA 3VALA 3UQSA 2KVIA 4CM0A 1Y10A 5C2GA 1UPPA 3HPOA 5THWA 3MOZA 4LUBA 4AE5A 5K14A 4CDIA 3ETOA 2D1CA 3RYLA 3T1HJ 3OXLA 4Q45A 2NXNA 3DU6A 1T94A 2PFDA 2IBKA 2WSCC 4JI4J 4LFCF 1FD8A 2HIQA 3CVKA 4CWBA 4PWDA 3VQSA 3LGNA 2IJRA 2Y0BB 2KZZA 1S76D 1J2VA 3ET6A 3EWGA 3IBCB 1UWBB 2GIRA 3CWJA 5M2UA 3RG6A 4IQXA 2KKHA 2DR6A 1VQ7S 2VQEF 3BM7A 3MPUB 2JEFA 4NLDA 3ENWA 3BBBA 2CDRB 2V67A 3QPIA 1X4EA 3NLCA 3VF0B 1NLKL 1OYDA 3V4IB 1QE1B 2WK4A 3TR5A 1H38A 2LXFA 3M8YA 1HNIB 3CJQA 4KY3A 3IR5B 4MK7A 2E9TA 2MSTA 4QYZJ 3W1YC 3JSYA 1QAIA 4P74A 2WVEA 2RRAA 3B6BA 3BO2A 2B9YA 2B4UA 1NJXA 3AH6A 1KTVA 3M4XA 3ISND 4FKXA 3AOCA 4KJIA 4TNOA 5I3QA 3RB6A 5M2PA 2DK2A 3EX7B 4RNFA 5DETA 1RT6B 2JLFA 1T9WA 4N8OA 3CW2C 4USVA 2G0JA 1UL3A 1HR0F 3D1QA 4Y34A 3K58A 2RDIA 1Q86T 4RNNA 2IDLA 4NI2A 5LM7E 1CS4A 1XNQF 4P7VA 3ITHB 4PXBA 5B0FA 2FVRA 3C14A 1OMSA 4IG3B 3EXCX 1R8HA 5E41A 5KT4A 2V2KA 2FJDB 4QZVB 2E9ZA 3DLKA 1CULA 1NHKL 1J5OA 3MWBA 2YNFB 2VG7A 2ROEA 3JQJA 3NNAA 4C11B 2JDJA 1SL1A 1FFSB 4B02A 4Q0BB 5KT2A 5JJBA 1Y4ZB 4NLUA 2NZ4A 8AT1B 2RDJA 2O01C 3RR8A 4DPOA 1PGZA 3IFEA 1IBKJ 2CQIA 2EI5A 4HH1A 2BE7D 2MQ8A 3UCGA 4I6YA 1FFWB 4FP9A 4J37A 4O3NA 1RZMA 2M8HA 1LK5A 4OZJA 5DLFA 1Q95G 4DR7J 1VRTB 1U24A 2Y9HA 2V68A 2V9KA 3MEEA 1BQNA 3EM1A 2DNGA 4NLRA 4WK1A 2IVYA 3TO8A 4ZP6A 1UTAA 1X4DA 2OPPB 2AYEA 4IYQA 2XULA 4HT7A 5GADI 4KE5A 2ZH3A 1T05B 3G4SS 2QLXA 1NSQA 1RU2A 5K8PA 2CZVC 4X64J 3G6VA 3T5LA 2DGOA 1S6OA 2XSJB 3JB9k 4NCAA 3AXMA 4ELVA 4F3QA 1AUDA 1OSCA 4GRSA 1AW0A 1PKUA 2O5DA 1D09B 5DJBA 3G2XA 2DGQA 4KRWA 2LQ8A 5DLGA 4FPIA 3R6GB 1S1VA 1VLYA 2MJUA 4C8MA 3C19A 4LBPA 2VA3A 2OH2A 4DQRA 3DRPA 4ID8A 2M4MA 2AEFA 1NJZA 2KFNA 2C2DA 4WZMA 2DNLA 2JHEA 3SYZA 1N54B 3SCIE 2MB0B 1FRHA 2JRSA 4KYZA 2ZNZA 2HSEB 4PZVA 2K3KA 2WAQD 1HNZJ 2OJ3A 3J81Y 4I2PB 2RMLA 3L4BC 4LFBF 2VBYA 5AE2A 4C6AA 4ED6A 2KB2A 1PIEA 1XR7A 2DNOA 3CCES 3KDOA 2IIHA 4HACA 2OPQB 2NQPA 2VDIA 1X31C 4MK8A 2CNKB 4P52A 2XQCA 5HQMA 3Q8QB 2HRTA 1A6LA 1FK9B 3KNGA 4KGXB 2AEMA 1RACB 1U0HA 3HHEA 3W8GA 1IKVA 4DV7F 4LFCJ 2GQQA 4UF4A 1T3NA 4USKA 4KC5A 5LMUF 1IKYB 1RHQB 1PSDA 1TAUA 1ZA1B 1CJKB 3CCVS 2I1RA 4DI6A 3BZQA 2OELA 1EP4B 2MSSA 4OYPA 4C9DA 4ED4A 4I64A 2IRXA 2UXBF 5RUBA 3DXSX 1U6FA 3F56A 2FHOB 4QCLA 4OJGA 1DURA 2HHQA 1B0TA 4E2FB 5KFWA 1RT4A 4M1KA 4CO5A 1NSKL 3RAQA 2DT9A 2ZHAA 1N5YA 3PXGa 3RZAA 5KTQA 5K20B 2UV8G 1XMOJ 3BS9A 2LCWA 2M7SA 3DM2B 4DL6A 2J6UA 3GFHA 1B7FA 4DV5J 4ES2A 4YMEA 2RUSA 2G0CA 1CJTB 1NDPA 3IBWA 2QFJA 2NLWA 3W65A 1U26A 3R9LA 1IKXA 2DXEA 2X51A 3OL6A 4ETXA 1PJ5A 3KUGA 3TJAA 1HWIA 4JI6F 2CPXA 3R1LA 4AL7A 5T14A 3UVJA 3MTKA 4K8RA 4V19J 3VAFA 3EZUA 3K5MA 2HQIA 4I67A 4K2XA 1VHFA 1V5VA 3MPDA 4KPCA 4DL3A 2CUYA 1UVJA 5BXIA 2UU9F 4KV8B 3M8QB 1NJYA 4C48A 1T03A 1FA0A 2WCXA 1R0CB 2E7WA 4PQAA 4CTAA 3NOCA 4B3TJ 3IRWP 2NXJA 1GMWA 3CJ5A 3D5MA 4FYYB 3MURP 1WC4A 2DISA 1YZ7A 3TA0A 2P8IA 1SJFA 3GIIA 3MR2A 5GMEA 3DRSA 3KLHB 2XS2A 1NSPA 4I6WA 3D68A 3CF5Q 4UOGA 2ERRA 3D1OA 2HWTA 2HEKA 1I94J 2HK2A 1T9UA 2CVEA 2ILYA 3D6TB 4XAKA 3WIUA 3CCUS 2F5GA 3A12A 4DPYA 1S0MA 2JLGA 3MUVP 4P73A 1VC5A 2CWXA 1Y11A 3R5BA 4DSIA 4CNZA 3QIPB 2ZUGA 5AE3A 3LWLA 4R8UB 1DFDA 1DLOA 3EDRB 2XCAA 2HWHA 2V8HA 4NL5A 1YJVA 1JLBA 2XCPA 2XI2A 2HFUA 2J8SA 4DV6F 4WP3A 4QJVA 5LL6d 3J7YU 2OFGX 2W9CB 4ID5B 2XLKA 4ZP8A 2HHPA 3VVTA 3IN5A 3SCKE 1D3WA 2WSFC 1W7WA 3PFEA 2FPHX 4DG1A 1BGXT 1RCXB 1T02A 1RKJA 2VD3A 5E5NA 3UWTA 1AZSA 3DOMB 3UR0A 2GVZB 2ZE2A 2WBRA 2JSXA 2EBGA 1L3TA 2DHHA 1R0AA 5J2NB 1ZH5A 5LSLA 3D9BA 2RILA 2QMXA 3ZZUA 3EZOA 2N82B 2QSWA 4RU9A 2RHQB 4A8YA 4J9OA 5EX3A 3GR0A 2B56A 3IWXA 2FDNA 4C8ZA 4KGKA 3M8ZA 1SXLA 1H2VZ 1DARA 4LSLA 1Q81T 1NHUA 1SV5A 2MHNA 4I1TA 2Z2MA 1KHWA 3K17A 1H6KX 2RD5C 1PCAA 5F8IA 4NPOA 2RSQA 4WJBA 4HYKA 4DX7A
chains in the Genus database with same CATH topology
3OVAA 2K1RB 2B3TB 1QLNA 1X4BA 3Q2TC 3M2UB 2RT3A 3CDBA 4A46A 1W25A 3PO4A 3GB0A 5L1LA 4UUXA 1ZZFA 5BR8F 4HHJA 1S77D 4NLVA 2GIQA 2LA4A 3CJ4A 3K8VA 1O5JA 4ECZA 3I0SB 4PG4A 2VV5A 5ITHA 3LH2S 4N56A 3FNNA 3NAIA 3KLFB 4KSEB 2AYBA 3D28A 2I9SA 3DRRB 1ROFA 4JI1F 5T7LB 2OTJS 1ZM4A 4M8LA 1S1WB 1X4FA 2EK1A 3SFGA 4RUHA 2DGUA 2FVCA 1D1UA 1FF2A 3KK2A 1UJ6A 4JBCA 3KHHA 3EPGA 3KG4A 5E7OB 3T1HF 1YITS 1KR4A 4A8SA 2KRBA 3DOKB 1FEHA 3DN9A 4F4YA 5K8MA 5AE1A 5KG5A 2YH1A 1VQ4S 4IUFA 4JI4F 4M5DB 2D3UA 5D78A 4CH0S 1I1GA 3ZC4A 1JLQB 2MKJA 3M1VA 4FF4A 2HHUA 1FNOA 1K1SA 1C1CB 2NUUG 1Z4UA 3US5A 1LWCB 4NRTA 1VC6A 1X4CA 2LU1A 3MEGB 4FNHA 2VFSA 1QVGR 2V4JA 1WF2A 3QGGA 5B0GA 5B0AA 3KJVA 2ROGA 4C8YA 1V6HA 3N6NA 3OXFA 4LVNP 2X1BA 3K7RA 3TRGA 4IDKB 4YEAA 2R7QA 2Y1IA 2A18A 2ZH4A 5D77A 4J9MA 4QBUA 1P1TA 1SUQA 3RTVA 2C3UA 2EWHA 2U2FA 5DG7A 5CCLA 3CCMS 3BGLA 3KG0A 1NJWA 1VQYA 4TU7A 1XBWA 1ZPVA 3NAHA 3SDEB 4GKKF 4TXSA 3I55S 1KS2A 1JXEA 3DHWC 5CYMB 5IZHA 1TR0A 5A0YA 3IS9A 4ELTA 2DGXA 4HLBA 5EWFA 2Q66A 1CVJA 2KH9A 1HBOA 4YB5A 3TANA 3IGNA 1DTTB 2XZWA 1HBUA 1M5HA 2DNZA 2C28A 5K14B 1SJ3P 2ZKTA 3PZPA 3PY8A 3V6HA 2J0SD 3OR1A 1P9QC 2W9BB 3HVAA 4HTJA 3I96A 4IFVA 2HHHF 2IVMA 1K73T 1RK8A 2F8HA 3J7ZT 3WC2A 2IC3B 1CEZA 3QO9B 3TARA 4GC7A 4KKOB 5CA5A 4LVOP 4MKAA 3CJ2A 4ALZA 2QA2A 3BJYA 3AY0A 1Q1KA 1AXQA 5IM0A 1N33F 5B08A 5KFFA 2EPIA 4Q44A 4L6V3 3I82A 4X4VA 2C2EA 4HEA9 1HW8A 2CPIA 3JTPA 4FS1A 2CJBA 4DSEA 2BJEA 2GNKA 4ECXA 1UAWA 3I4HX 4FVMA 5F8NA 4Y2IA 1R31A 1LWFA 3KKFA 4EBCA 1XK8A 1X9MA 1TV6B 4ZP7A 4XK8C 3QGPA 4RX6A 5G4DA 3WC0A 2XMTA 4PPZA 3VZIA 4K4WA 3M8QA 4MJKA 3NS6A 3NCRA 1QM9A 1YJRA 3CULA 3O1LA 1D8ZA 2P9GA 2OPRB 2B5JB 2FVQA 3FRZA 3G6YA 1GAOA 2D9PA 2R7RA 3SCLE 3V4MA 2KG0A 1WHXA 4WTYA 3GIMA 2VQFF 1D8YA 4L3NA 4QW9A 4DWIA 2QO3A 2VFTA 2F9JA 4URQU 2ZFHA 3ULHA 3MD3A 4DL4A 2NS1B 2BE2B 4OLPA 1YTYA 1GX5A 2QA4G 2PEHA 1HW9A 4BWMA 3RW6A 2G1DA 2VFRA 4GMKA 5J1EB 3KLHA 3P49B 4L72B 1TL3B 2VBXA 2ZNYA 4ED0A 3PX4A 1AROP 5L9NA 3MM5B 3DGPA 1VQPS 2P6SA 3CTRA 3WX4A 2IYIA 2UUWA 1ZTTA 1S79A 1M0SA 5BYSA 2OMLA 5BJRA 2V4RA 1O0PA 1A7GE 2O1PA 2Z2LA 3AQPA 2DPJA 2OKQA 2D3OR 4H4OB 1Q82T 3PX6A 2YNHA 4Q2MA 1FRKA 5J2PA 1JJ4A 3TYTA 2RQCA 3CMES 4U6PA 3HKWA 5KFCA 2CG4A 3MM9B 4ECSA 2BXJA 2PT0A 3CC7S 2CPZA 1E6VA 1JJHA 4ZP9A 4OV1A 4QWBA 1SC6A 2VOPA 2R7VA 1JLFB 5L1IA 4FF2A 2PDAA 4QWEA 3O44A 4K5RA 3I32A 4ZHRB 1N0VC 4C98A 4RUAA 3AB2B 2AX0A 3BGRA 1MROA 1QUPA 1RT2B 3T9NA 3BGUA 3QIPA 2FD2A 3SQGB 4KPYA 2XLIA 4R8UA 4DN0A 2X3GA 2MQNA 4NYOA 1YIJS 1OWXA 2WB4A 4EBEA 4KO0A 3V4IA 1ZZNA 3CE8A 4RNMA 3N5BA 1QE1A 1RYRA 3PNIA 4TYBA 4ZCIA 3J7A1 2VFVA 4PQUA 2GJ2A 4Q7AA 1XR5A 2JLEA 3CD7A 4C4WA 3DC2A 4JI7F 4F3MA 1S4FA 2DNPA 2D7SA 3KLIA 2FGOA 3RAMA 1U8SA 2QZ8A 5A8KB 2F8MA 5CZVA 3I5CA 5DM7Q 1DRZA 2Q3PA 4I2QB 2J9EA 1FKOB 5KG0A 4ED1A 2LU2A 2R2SA 2ADCA 5CH7B 1IQTA 1FT8A 3B8HA 4X4QA 3LQVA 3VWSA 4CH7A 1UFWA 1P8GA 2EK6A 3J7Z5 3DDKA 4ID5A 5F8GA 2W9CA 4FBTA 3BGFA 4KTQA 2HS3A 1R43A 2DNYA 3O3LA 3GV7B 4KT0C 1FXLA 2HHXA 4N76A 2ZDOA 2CQDA 3DMJA 1SIWB 2BR0A 4HKQA 5JXSA 3HHNB 5I3UA 4DLEA 2XI3A 4AFFA 1RT5B 1S1XA 5B0CA 1SH2A 1K0TA 1KVIA 3C6TB 2RUGA 3AJ1A 3H5SA 3NCPA 2L9NA 1IBKF 4IO9Q 2VPYB 3KTQA 3WZ0A 4NCGB 4I0WA 4ZCKA 2YQ3A 2I2YA 2YNGB 2R8IA 2MKKA 2DIVA 3GG0A 2NPFA 1HBNB 4OZ0A 5AXLA 3ZZPA 3KK1A 4LMZA 2BM0A 3N6MA 4FN5A 1LV5A 1CLFA 4JI0F 2CQ1A 4A8KA 4UY85 5KG3A 4F8RA 1VQMS 4NZ0A 3DOMA 5DO2A 4DR7F 3QZ8A 2IAJA 3CO9A 5F0WA 3MHYA 3MXHP 3FFIB 4IG0B 4IFYB 3FSXA 2C22A 2GGPA 2DNMA 4GC6A 4DFMA 5E2QA 3OPKA 5BYRA 5KFMA 5DDPC 1XMBA 2ZD1A 4NLTA 4LF6F 2P9EA 5D8HB 3OVSA 2AX1A 2ZH2A 3NNCA 1X9SA 2UUTA 3MZIA 2RE1A 5J2NA 2B4VA 3TAMB 3UCZP 4B17A 2VKZG 3GILA 2DR8A 4IRKA 2UVUA 2KT2A 4UOCA 5HQ8A 5I42B 1U1MA 3SI8A 1TKXB 2D41A 2N7YA 3CMAS 1JLGB 4PCQA 4ZMMA 2DNHA 1C2PA 3T1YF 2Y0SD 3OLAA 2XY6A 3ITHA 3CCLS 2DHGA 2MHEA 4X65F 2XY5A 1RTDA 2CFXA 2V5HG 3G96A 4PUOA 5FDLA 3EUNA 4X64F 3M2VB 1JLEB 1X4GA 1RTHA 4ECRA 3MMCB 3IGVA 3M9OB 1GTHA 1I6JA 2D9OA 3QIDA 2MZJA 3FQLA 3UNGC 3D2WA 2FHJA 1WTFA 2W7OA 1QSSA 3DXBA 1V3SA 2W4CA 2YKMB 3DLJA 2HHSA 2P5VA 3V6JA 4NLYA 3LAKA 4ECWA 2ZOMA 3D54A 1GXUA 5D6GA 4ILRA 4M94A 1BQXA 1FCAA 4Y65A 1NK7A 1S1TB 5EGYA 1K9MT 5C42A 3MEEB 3M8SA 2UVVA 2DHXA 3PIOQ 1RT7B 4A8QA 2RNEA 4ZPBA 4DL0C 4O0IA 3E3XA 4NZ7A 4YY3F 2CJQA 3UCUP 3G8SA 2ZJRQ 1QY7A 2BA9A 4C8NA 4OI3A 2DTJA 3EYZA 3JSRA 3R5DA 5GMKa 2ZOGA 2ZBIA 2J0XA 3HVTB 1LW0B 1P1LA 2K1RA 5GVQA 2GHPA 3EXYA 3SSRA 2QV6A 3M2UA 4IOAQ 1U4BA 3CXCR 4O3QA 4LF8F 5E3RA 4R25A 4FVCA 4ECTA 3QJPA 1UJ5A 2MKHA 3Q2SC 3H2VE 1JMTA 2Y1JA 1ZETA 5I4MA 3I0SA 3N01A 4H4MB 1Y7PA 1GTEA 1UW4A 3DRYA 3PR5B 4DSJA 4DHVA 2AJQA 2J6SA 3O5TB 3KLFA 1XR6A 4B9TA 3GG1A 1OQ6A 1G3OA 1U2RA 2WONB 2OP5A 1H2UX 4HTIA 5B0DA 1VK3A 2ALZA 1WD6A 5AXKA 1S1WA 4CO0A 1M5KC 2HFZA 4LQ9A 1UVLA 1FXRA 1HD1A 1N5SA 3KWMA 5GAGI 1FJGF 1FTCA 4P6QA 5LMNF 1JXLA 3MGJA 1WHWA 3DOKA 3OSPA 4W92B 5MAOA 1HNZF 3NP5A 3V5RA 1X0PA 3NG8A 4PWUA 3JTOA 4MKBA 4OI2A 1Q8IA 5M2RA 5HO4A 3G6ES 2H9ZA 4M5DA 3M6UA 3KFWX 4DDFA 1JLQA 1HA1A 1KD1T 4RWXA 1J5EF 4ECVA 4OX9F 2YNIB 2Q1LA 5D4OA 3F73A 1CSJA 3N5FA 4WU2A 4X4SA 1VRTA 1UKUA 3U7JA 3UDCA 2AD9A 2QA1A 1KC8T 1M90T 2KTQA 1LWCA 2MPUA 1CQMA 2BJDA 3HHLD 3IWLA 2B9XA 1KQFB 4IKAA 3PW2A 4CH1A 2LEBA 2DVIA 3KK3B 3L7OA 2Q79A 4F67A 2EFNA 1C4CA 3I31A 3BF4A 2BM1A 2LDIA 1U1OA 1LXNA 5KFEA 2CQCA 4BBYA 3CC4S 2GV1A 3SDEA 1MMDA 3LOUA 1U7LA 3DLGB 1KSPA 2CPEA 3LO3A 4J5OA 2AYGA 3KLEA 1B0VA 5CYMA 3K5OA 3MECB 3MFHA 3TA1A 3J80Y 2LDYA 4DMZA 5A2QY 3ZFVA 1DTTA 2XSJA 2F3JA 3F41A 4USIA 2RU3A 5H9FJ 3VAIA 2MJNA 3QLHB 3K5LA 3RR7A 1VQKS 2R4FA 4LF4F 3RRHA 2ZH1A 5U47A 2E1AA 4KIAA 4RNHA 4B08A 2DGVA 3ZZOA 2KT5A 1VQLS 3HLUA 3KLVA 3L3CA 1M5SA 4QIEA 4KKOA 4OL8A 2J7KA 1GXTA 4IH7A 5GAEU 3R3TA 2CQGA 2QSFA 3LP1A 4YDDB 1YQHA 4DV2F 2Q6CA 1FNMA 3EZ5A 5F3TA 4KQZA 2YWGA 4XDDA 2DH9A 1SBRA 1SQEA 2HHWA 1Q8BA 1NRKA 2IBOA 1VK8A 4Y0FA 3HJFA 4PG5A 1S49A 1DQ9A 1UVIA 1F2GA 1REVB 3DOLB 1IQZA 1KFSA 4RLEA 4BCAA 2MKSA 2IFXA 3W2VB 4YR0A 1F9FA 1LKZA 4C3LA 2JEJA 1HBMB 3TI0A 2I5JB 4J9NA 2OPRA 2B5JA 1HL6A 2BQ3A 2HQ3A 2JFDA 2OTLS 2F9DA 2L08A 1WEYA 4DL7A 2BDPA 1HPZB 1U47A 5DG8A 1R7IA 1HWLA 2W25A 1X5OA 4NMLA 2ZZNA 5A8WB 2QLWA 4CO4A 1XEZA 4ZK7M 3CCJS 2V0NA 5HMWA 2XSFA 1X5SA 2BE2A 2RQ4A 2M0GB 5L39A 4MYUA 5DQIA 4O3PA 3CT9A 3NL0A 4UUWA 4ZPVR 2JEGA 1KQKA 4IR1A 4EYIB 3FJ2A 3K0JA 2BANB 5J1EA 4X66F 4Y2MA 3HKZD 3OTDA 1TL3A 3IO1A 4DFKA 4OZLA 1RTIB 3IWNC 3M9NB 2YY3A 5F8HA 2IMOA 4I2PA 3AQOA 4N77A 1XMOF 1HNVB 4C0BA 4ATNA 4RBUA 5FIIA 5HL7Q 4CI0B 4LJMA 4ZVHA 3MM6B 4WFAQ 1UVNA 4WE1A 3OW2R 2MZRA 4K4YA 1KVJA 3HVRA 4B9VA 4H4OA 3LW5C 5HMYA 4OZNA 4QIFA 4XO0A 1SJRA 1CQNA 2E5LF 5KFUA 2N3LA 3GFZA 2OPQA 2HFNA 2NR0A 3MM9A 1R27B 4CO3A 4DV5F 4XIUA 2PD1A 3QJLA 5CXTA 3ICLA 4XPEA 4K4XA 2HYIB 2VZ9A 1TVRB 2X1GA 1JLFA 3T3FA 5HBMA 4QR1A 5HMXA 4NLQA 4PG6A 4RNOA 3U1MA 4ZHRA 4O4RA 3NMAA 5A8RA 1DTQB 2AGQA 4WYWA 4A8FA 3OR2B 1PO6A 1FVQA 3G8QA 3KMSA 3SSSA 3CEDA 3SQGA 2DPIA 4B9UA 1G6BA 1Z1ZA 4C8KA 4FS2A 2YTCA 1V9OA 3U27A 4QIGA 4OHYA 1S6PB 2LEAA 2E29A 3C3LA 4J9SA 5HLFB 5B0EA 1IJFB 3OTEA 4X4OA 4C0OC 3UPFA 2DCLA 2EFQA