1L3YA

Integrin egf-like module 3 from the beta-2 subunit
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
41
structure length
41
Chain Sequence
b'ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-2:CYSTEINE-RICH MODULE 3
publication title Cysteine-rich module structure reveals a fulcrum for integrin rearrangement upon activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 2
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2002-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1l3yA00
1YUGA 4BXWA 4AQTA 3RR3A 5FDQA 1MQ6L 4O1ZA 3FFGL 2BQ6A 3SW2A 4BXSA 4Z0LA 5JB8E 2DDUA 2VWOL 1PTHA 1XKBA 4C16A 2P3FN 3GISX 3FCSB 3ZYJB 2XBWL 1YGCL 2K2SB 4XBMA 1MQ5L 1TPGA 4JYUL 4A7IA 4Y76B 2KV4A 1HT8A 4FM5A 2H9EL 2F9BL 1YUFA 2P28B 2XBXL 3KCGL 1WU1B 4LORA 2J38B 2BOKL 1G2LB 4YT7L 4ZXXL 4TGFA 3KQDL 1WHEA 1EMNA 2J2UB 5F19A 3V65B 3K9XA 4OTJA 2J4IB 3QMOA 5JBBE 1KLIL 1F7EA 3H5CB 1W7XL 1U67A 3POYA 3HS7A 1TLEA 4JZDL 1ADXA 4G1MB 5F1AA 3LTGD 3N8YB 1HX2A 4Y71B 1FF7A 1KIGL 4M10A 3HO5A 1NFUB 1PGEA 3SOQA 1J9CL 1UZQA 3U7UG 3LAQA 4ISIL 4PH9A 1Z6EL 2M74A 2VVVL 2K2TA 2W86A 1HAEA 3Q3KB 1EBVA 1EZQB 1UZJA 3NTGA 1IQKL 3V64C 1BF9A 3OLTA 2WPME 3P5BL 5KN5C 1F0RB 5L2YL 1EQGA 3R05A 5JBAE 2WPKE 1G1TA 5JVYA 1IQJL 5IKTA 4BDXA 2Y82B 2FLGA 3NT1A 4D0FA 2BO2A 2I9AA 5JB9E 1CQEA 3LN1A 1LMJA 1EPHA 1JV2B 1EPIA 3NTBA 3ENSA 3KQEL 1V3XB 1IQGL 1P0SL 1APQA 2BQWA 1LQDA 3U73A 1LPKA 3PGHA 3TH3L 4M11A 1GK5A 1WHFA 2XBYL 1FAKL 1QFKL 1FFMA 4ZH8B 2Y80B 1DVAL 3LN0A 2BZ6L 3TK5B 1JBUL 4RRXA 1ZAQA 2B7DL 2W3KB 2YGOA 3TGFA 1N1IA 4XL1A 1RFNB 1CVWL 4X8TL 3CA7A 2WPIE 3ELAL 4X8VL 3IITB 5IKVA 3LTFB 1XKAL 3KL6B 5IKQA 3OLUA 2CJIB 3TZIA 2J34B 2WPHE 1IQHL 3MQEA 1UZKA 2VWMK 4Z6AL 2WFTA 2RNLA 2PR3B 2MHPA 1IOXA 1A3PA 3SOVA 4RRZA 4NGAL 2P3TA 2PHBB 2W26B 1MOXC 3QH0A 1COUA 3BPSE 1IVOC 2XC5L 5L30L 4JZEL 2YGPA 3TBDA 1DQBA 2W2PE 5K0HB 2NPRA 2Y5GL 5CKQA 1G2MB 2P16L 2JKHL 1CVUA 2AYLA 1XDTR 1UZPA 2OYUP 2W2QE 2Q1JB 3IJEB 3N8XA 2Y5HL 4Y7BB 2VH0B 3ZYIB 1G1RA 2RHPA 1X7AL 2VWNL 2Y81B 1YO8A 4BTIA 4RRYA 2BOHA 4RS0A 1NQLB 2VWLL 1N7DA 3N8ZA 1K37A 1KLJL 4Y6DB 2WYJB 1NFXB 1M1XB 1HCGB 2FZZL 2P95L 1NT0A 1IQEL 1XFEA 3ASIA 1G1SA 4ISHL 1IQIL 1TOZA 2MGPA 2FD6A 2PUQL 3LC5B 1HRFA 1IQFL 4Y79B 1CCVA 4JZFL 1LPGA 2P93L 1JL9A 4Z0KB 4BTUA 1IP0A 1HZ8A 4CUDA 2J94B 1NFYB 5CKMA 1C5MF 4NG9L 1FSBA 4NA9L 2EI8B 2FLRL 2G00L 6COXA 4XLWA 1EMOA 3HPTA 2BOUA 3KRKA 1EPJA 4E1GA 2J95B 2W2NE 3N8WB 1EQHA 1PRHA 4YZUB 2KL7A 4BDWA 1SZBA 5JVZA 3N8VA 2WFXB 1IQML 3KK6A 1ATDA 4RRWA 2TGFA 2XC0L 1Q4GA 1NPEB 2VH6B 1FAXL 1FJSL 1OB1C 1APOA 1I0UA 4YT6L 1IGZA 3DEMA 3LIWB 1ATEA 1IOEL 2GD4A 2UWOB 1ATBA 3F1SB 3HO3A 5CISA 1DX5I 1AUTL 2WPLE 2WG4B 3GCWE 1DIYA 1PXXA 4MMZB 2UWPB 2Y7XB 3Q7DA 1CCFA 3C9AC 3LC3B 2D1JB 3GCXE 1W8BL 1IGXA 1KLOA 3CS7L 1HJ7A 2XBVL 4MMXB 1P9JA 2ADXA 1F7MA 2RA0L 3N8YA 4O02B 1PFXL 1EPGA 4RUTA 1K36A 3HO4A 1HREA 1CEJA 3BT2A 4JYVL 5CKNA 3ZYGA 1EAIC 1NZIA 2P3UA 3HS6A 5JBCE 2P94L 2EI6B 3KQCL 5EGMB 4COXA 2WYGB 3FBYA 3QCWA 5L2ZL 2FLBL 1IJQA 4OTYA 1DDXA 2MGRA 4CSYA 1L5GB 1IQLL 3EGFA 1G1QA 3BT1A 2W2ME 1FE2A 2W3IB 4ZXYL 4ZAEB 1LPZA 2VJ3A 1HT5A 1F0SB 4X8UL 1O5DL 3MDLA 5IKRA 1EGFA 4Y7AB 3CENL 3KQBL 3F6UL 3CFWA 4X8SL 2P3FL 1U8CB 1B9WA 2VVCK 2XC4L 2Y7ZB 1KSNB 3M36L 2Y5FL 4D0EA 3SOBB 2BMGA 1CX2A 1L3YA 3TK6B 1NFWB 2BQ7A 2P26A 2W2OE 5I46L 3N8WA 2UWLB 1IQNL 4CUFA 5COXA 2WG3C 2EI7B 2OYEP 5E8DA 4CUEA 1ATAA 1HAFA 4D90A 1Z6CA 5JW1A 2WPJE 1URKA 3NJPC 4MMYB 2BOXA 1YUKB 4BTTA 3HS5A 4LMFA 2VVUL 5KIRA 2KB9A 3M37L 2Y38A 2I9BA 4ZHAB
chains in the Genus database with same CATH superfamily
1YUGA 4BXWA 2JJLA 4AQTA 3RR3A 5FDQA 1MQ6L 4O1ZA 3FFGL 2BQ6A 3SW2A 4BXSA 2HOXA 4Z0LA 5JB8E 2DDUA 2VWOL 1PTHA 1XKBA 4C16A 2P3FN 3GISX 2YGQA 3FCSB 2XBWL 3ZYJB 1YGCL 2K2SB 4XBMA 1MQ5L 1TPGA 4JYUL 4A7IA 4Y76B 2KV4A 1HT8A 4FM5A 2H9EL 2F9BL 1YUFA 2P28B 2XBXL 2KNIA 3KCGL 1WU1B 4LORA 2J38B 2BOKL 1G2LB 4YT7L 2HORA 4ZXXL 4TGFA 3KQDL 1WHEA 1EMNA 2J2UB 5F19A 3V65B 3K9XA 4OTJA 2J4IB 3QMOA 5JBBE 1KLIL 1F7EA 3H5CB 1W7XL 1U67A 3POYA 3HS7A 1TLEA 2WZPP 4JZDL 1ADXA 4G1MB 5F1AA 3LTGD 3N8YB 1HX2A 4Y71B 1FF7A 1KIGL 4M10A 3HO5A 1NFUB 1PGEA 3SOQA 1J9CL 1UZQA 3U7UG 3LAQA 4ISIL 4PH9A 1Z6EL 2M74A 2VVVL 2K2TA 2W86A 1HAEA 3Q3KB 1EBVA 1EZQB 1UZJA 3NTGA 1IQKL 3V64C 1BF9A 3OLTA 2WPME 3P5BL 5KN5C 1F0RB 5L2YL 1EQGA 3R05A 1LMMA 5JBAE 2WPKE 1G1TA 5JVYA 1IQJL 5IKTA 4BDXA 2Y82B 2FLGA 3NT1A 4D0FA 2BO2A 2I9AA 5JB9E 1CQEA 3LN1A 1LMJA 1EPHA 1JV2B 1EPIA 3NTBA 3ENSA 3KQEL 1V1HA 1V3XB 1IQGL 1P0SL 1APQA 2BQWA 1LQDA 3U73A 1LPKA 3PGHA 3TH3L 4M11A 1GK5A 1WHFA 2XBYL 1FAKL 1QFKL 1FFMA 4ZH8B 2Y80B 1DVAL 3LN0A 2BZ6L 3TK5B 2VRSA 1JBUL 4RRXA 1ZAQA 2B7DL 2W3KB 2YGOA 3TGFA 1N1IA 4XL1A 1RFNB 1CVWL 4X8TL 3CA7A 2WPIE 3ELAL 4X8VL 3IITB 5IKVA 3LTFB 3S6XA 1XKAL 3KL6B 5IKQA 3OLUA 2CJIB 3TZIA 1KKEA 2J34B 2WPHE 1IQHL 3MQEA 1UZKA 2VWMK 4Z6AL 2WFTA 2RNLA 2PR3B 2MHPA 1IOXA 1A3PA 4GU4A 3SOVA 4RRZA 4NGAL 2P3TA 2PHBB 2W26B 1MOXC 3QH0A 1COUA 3BPSE 1IVOC 2XC5L 5L30L 4JZEL 2YGPA 3TBDA 1DQBA 2W2PE 5K0HB 2NPRA 2Y5GL 5CKQA 1G2MB 2P16L 2JKHL 1CVUA 2AYLA 1XDTR 1UZPA 2OYUP 2W2QE 2Q1JB 3IJEB 3N8XA 2Y5HL 4Y7BB 2VH0B 3ZYIB 1G1RA 2RHPA 1X7AL 2VWNL 2Y81B 1YO8A 4BTIA 4RRYA 2BOHA 4RS0A 1NQLB 2VWLL 1N7DA 3N8ZA 1K37A 1KLJL 4Y6DB 2WYJB 1NFXB 1M1XB 1HCGB 2FZZL 2P95L 1NT0A 1IQEL 1XFEA 3ASIA 1G1SA 4ISHL 1IQIL 1TOZA 2MGPA 2FD6A 2PUQL 3LC5B 1HRFA 1IQFL 4Y79B 1CCVA 4JZFL 1LPGA 2P93L 2H9EC 1JL9A 4Z0KB 4BTUA 1V1IA 1IP0A 1HZ8A 4CUDA 4GU3A 2J94B 1NFYB 5CKMA 1C5MF 4NG9L 1FSBA 4NA9L 2EI8B 2FLRL 2G00L 6COXA 4XLWA 1EMOA 3HPTA 2BOUA 3KRKA 1EPJA 4E1GA 2J95B 2W2NE 3N8WB 1EQHA 1PRHA 4YZUB 2KL7A 4BDWA 1SZBA 5JVZA 3N8VA 2WFXB 1IQML 3KK6A 1ATDA 4RRWA 2TGFA 2XC0L 1Q4GA 1NPEB 2VH6B 1FAXL 1FJSL 1OB1C 1APOA 1I0UA 4YT6L 1IGZA 3DEMA 3LIWB 1ATEA 1IOEL 2GD4A 2UWOB 1ATBA 2BSFA 1QIUA 3F1SB 3HO3A 5CISA 1DX5I 1AUTL 2WPLE 2WG4B 3GCWE 1DIYA 1PXXA 4MMZB 2UWPB 2Y7XB 3Q7DA 1CCFA 3C9AC 3LC3B 2D1JB 2BT8A 3GCXE 1W8BL 1IGXA 1KLOA 3CS7L 1HJ7A 2XBVL 4MMXB 1P9JA 2ADXA 1F7MA 2RA0L 3N8YA 4O02B 1PFXL 1LK9A 1EPGA 4RUTA 1K36A 3HO4A 1HREA 1CEJA 3BT2A 4JYVL 5CKNA 3ZYGA 1EAIC 1NZIA 2P3UA 3HS6A 5JBCE 4A94C 2P94L 2EI6B 3KQCL 5EGMB 4COXA 2WYGB 3FBYA 3QCWA 5L2ZL 2FLBL 1IJQA 4OTYA 1DDXA 2MGRA 4CSYA 1L5GB 1IQLL 3EGFA 2BT7A 1G1QA 3BT1A 2W2ME 1FE2A 2W3IB 4ZXYL 4ZAEB 1LPZA 2VJ3A 1HT5A 1F0SB 4X8UL 1O5DL 3MDLA 5IKRA 1EGFA 4Y7AB 3CENL 3KQBL 3F6UL 3CFWA 4X8SL 2P3FL 1U8CB 1B9WA 2VVCK 2XC4L 2Y7ZB 1KSNB 3M36L 2Y5FL 4D0EA 3SOBB 2BMGA 1CX2A 1L3YA 3TK6B 1NFWB 2BQ7A 2P26A 2W2OE 5I46L 3N8WA 2UWLB 1IQNL 4CUFA 5COXA 2WG3C 2EI7B 2OYEP 5E8DA 4CUEA 1ATAA 1HAFA 4D90A 1Z6CA 5JW1A 2WPJE 1URKA 3NJPC 4MMYB 2BOXA 1YUKB 4BTTA 3HS5A 4LMFA 2VVUL 5KIRA 2KB9A 3M37L 2Y38A 2I9BA 4ZHAB
chains in the Genus database with same CATH topology
1YUGA 4BXWA 4AQTA 3RR3A 5FDQA 1MQ6L 4O1ZA 3FFGL 2BQ6A 3SW2A 4BXSA 4Z0LA 5JB8E 2DDUA 2VWOL 1PTHA 1XKBA 4C16A 2P3FN 3GISX 2YGQA 3FCSB 2XBWL 3ZYJB 1YGCL 2K2SB 4XBMA 1MQ5L 1TPGA 4JYUL 4A7IA 4Y76B 2KV4A 1HT8A 4FM5A 2H9EL 2F9BL 1YUFA 2P28B 2XBXL 2KNIA 3KCGL 1WU1B 4LORA 2J38B 2BOKL 1G2LB 4YT7L 4ZXXL 4TGFA 3KQDL 1WHEA 1EMNA 2J2UB 5F19A 3V65B 3K9XA 4OTJA 2J4IB 3QMOA 5JBBE 1KLIL 1F7EA 3H5CB 1W7XL 1U67A 3POYA 3HS7A 1TLEA 2WZPP 4JZDL 1ADXA 4G1MB 5F1AA 3LTGD 3N8YB 1HX2A 4Y71B 1FF7A 1KIGL 4M10A 3HO5A 1NFUB 1PGEA 3SOQA 1J9CL 1UZQA 3U7UG 3LAQA 4ISIL 4PH9A 1Z6EL 2M74A 2VVVL 2K2TA 2W86A 1HAEA 3Q3KB 1EBVA 1EZQB 1UZJA 3NTGA 1IQKL 3V64C 1BF9A 3OLTA 2WPME 3P5BL 5KN5C 1F0RB 5L2YL 1EQGA 3R05A 1LMMA 5JBAE 2WPKE 1G1TA 5JVYA 1IQJL 5IKTA 4BDXA 2Y82B 2FLGA 3NT1A 4D0FA 2BO2A 2I9AA 5JB9E 1CQEA 3LN1A 1LMJA 1EPHA 1JV2B 1EPIA 3NTBA 3ENSA 3KQEL 1V3XB 1IQGL 1P0SL 1APQA 2BQWA 1LQDA 3U73A 1LPKA 3PGHA 3TH3L 4M11A 1GK5A 1WHFA 2XBYL 1FAKL 1QFKL 1FFMA 4ZH8B 2Y80B 1DVAL 3LN0A 2BZ6L 3TK5B 1JBUL 4RRXA 1ZAQA 2B7DL 2W3KB 2YGOA 3TGFA 1N1IA 4XL1A 1RFNB 1CVWL 4X8TL 3CA7A 2WPIE 3ELAL 4X8VL 3IITB 5IKVA 3LTFB 3S6XA 1XKAL 3KL6B 5IKQA 3OLUA 2CJIB 3TZIA 2J34B 2WPHE 1IQHL 3MQEA 1UZKA 2VWMK 4Z6AL 2WFTA 2RNLA 2PR3B 2MHPA 1IOXA 1A3PA 3SOVA 4RRZA 4NGAL 2P3TA 2PHBB 2W26B 1MOXC 3QH0A 1COUA 3BPSE 1IVOC 2XC5L 5L30L 4JZEL 2YGPA 3TBDA 1DQBA 2W2PE 5K0HB 2NPRA 2Y5GL 5CKQA 1G2MB 2P16L 2JKHL 1CVUA 2AYLA 1XDTR 1UZPA 2OYUP 2W2QE 2Q1JB 3IJEB 3N8XA 2Y5HL 4Y7BB 2VH0B 3ZYIB 1G1RA 2RHPA 1X7AL 2VWNL 2Y81B 1YO8A 4BTIA 4RRYA 2BOHA 4RS0A 1NQLB 2VWLL 1N7DA 3N8ZA 1K37A 1KLJL 4Y6DB 2WYJB 1NFXB 1M1XB 1HCGB 2FZZL 2P95L 1NT0A 1IQEL 1XFEA 3ASIA 1G1SA 4ISHL 1IQIL 1TOZA 2MGPA 2FD6A 2PUQL 3LC5B 1HRFA 1IQFL 4Y79B 1CCVA 4JZFL 1LPGA 2P93L 2H9EC 1JL9A 4Z0KB 4BTUA 1IP0A 1HZ8A 4CUDA 2J94B 1NFYB 5CKMA 1C5MF 4NG9L 1FSBA 4NA9L 2EI8B 2FLRL 2G00L 6COXA 4XLWA 1EMOA 3HPTA 2BOUA 3KRKA 1EPJA 4E1GA 2J95B 2W2NE 3N8WB 1EQHA 1PRHA 4YZUB 2KL7A 4BDWA 1SZBA 5JVZA 3N8VA 2WFXB 1IQML 3KK6A 1ATDA 4RRWA 2TGFA 2XC0L 1Q4GA 1NPEB 2VH6B 1FAXL 1FJSL 1OB1C 1APOA 1I0UA 4YT6L 1IGZA 3DEMA 3LIWB 1ATEA 1IOEL 2GD4A 2UWOB 1ATBA 3F1SB 3HO3A 5CISA 1DX5I 1AUTL 2WPLE 2WG4B 3GCWE 1DIYA 1PXXA 4MMZB 2UWPB 2Y7XB 3Q7DA 1CCFA 3C9AC 3LC3B 2D1JB 3GCXE 1W8BL 1IGXA 1KLOA 3CS7L 1HJ7A 2XBVL 4MMXB 1P9JA 2ADXA 1F7MA 2RA0L 3N8YA 4O02B 1PFXL 1EPGA 4RUTA 1K36A 3HO4A 1HREA 1CEJA 3BT2A 4JYVL 5CKNA 3ZYGA 1EAIC 1NZIA 2P3UA 3HS6A 5JBCE 4A94C 2P94L 2EI6B 3KQCL 5EGMB 4COXA 2WYGB 3FBYA 3QCWA 5L2ZL 2FLBL 1IJQA 4OTYA 1DDXA 2MGRA 4CSYA 1L5GB 1IQLL 3EGFA 1G1QA 3BT1A 2W2ME 1FE2A 2W3IB 4ZXYL 4ZAEB 1LPZA 2VJ3A 1HT5A 1F0SB 4X8UL 1O5DL 3MDLA 5IKRA 1EGFA 4Y7AB 3CENL 3KQBL 3F6UL 3CFWA 4X8SL 2P3FL 1U8CB 1B9WA 2VVCK 2XC4L 2Y7ZB 1KSNB 3M36L 2Y5FL 4D0EA 3SOBB 2BMGA 1CX2A 1L3YA 3TK6B 1NFWB 2BQ7A 2P26A 2W2OE 5I46L 3N8WA 2UWLB 1IQNL 4CUFA 5COXA 2WG3C 2EI7B 2OYEP 5E8DA 4CUEA 1ATAA 1HAFA 4D90A 1Z6CA 5JW1A 2WPJE 1URKA 3NJPC 4MMYB 2BOXA 1YUKB 4BTTA 3HS5A 4LMFA 2VVUL 5KIRA 2KB9A 3M37L 2Y38A 2I9BA 4ZHAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUG A;  4BXW A;  4AQT A;  3RR3 A;  5FDQ A;  1MQ6 L;  4O1Z A;  3FFG L;  2BQ6 A;  3SW2 A;  4BXS A;  4Z0L A;  5JB8 E;  2DDU A;  2VWO L;  1PTH A;  1XKB A;  4C16 A;  2P3F N;  3GIS X;  3FCS B;  3ZYJ B;  2XBW L;  1YGC L;  2K2S B;  4XBM A;  1MQ5 L;  1TPG A;  4JYU L;  4A7I A;  4Y76 B;  2KV4 A;  1HT8 A;  4FM5 A;  2H9E L;  2F9B L;  1YUF A;  2P28 B;  2XBX L;  3KCG L;  1WU1 B;  4LOR A;  2J38 B;  2BOK L;  1G2L B;  4YT7 L;  4ZXX L;  4TGF A;  3KQD L;  1WHE A;  1EMN A;  2J2U B;  5F19 A;  3V65 B;  3K9X A;  4OTJ A;  2J4I B;  3QMO A;  5JBB E;  1KLI L;  1F7E A;  3H5C B;  1W7X L;  1U67 A;  3POY A;  3HS7 A;  1TLE A;  4JZD L;  1ADX A;  4G1M B;  5F1A A;  3LTG D;  3N8Y B;  1HX2 A;  4Y71 B;  1FF7 A;  1KIG L;  4M10 A;  3HO5 A;  1NFU B;  1PGE A;  3SOQ A;  1J9C L;  1UZQ A;  3U7U G;  3LAQ A;  4ISI L;  4PH9 A;  1Z6E L;  2M74 A;  2VVV L;  2K2T A;  2W86 A;  1HAE A;  3Q3K B;  1EBV A;  1EZQ B;  1UZJ A;  3NTG A;  1IQK L;  3V64 C;  1BF9 A;  3OLT A;  2WPM E;  3P5B L;  5KN5 C;  1F0R B;  5L2Y L;  1EQG A;  3R05 A;  5JBA E;  2WPK E;  1G1T A;  5JVY A;  1IQJ L;  5IKT A;  4BDX A;  2Y82 B;  2FLG A;  3NT1 A;  4D0F A;  2BO2 A;  2I9A A;  5JB9 E;  1CQE A;  3LN1 A;  1LMJ A;  1EPH A;  1JV2 B;  1EPI A;  3NTB A;  3ENS A;  3KQE L;  1V3X B;  1IQG L;  1P0S L;  1APQ A;  2BQW A;  1LQD A;  3U73 A;  1LPK A;  3PGH A;  3TH3 L;  4M11 A;  1GK5 A;  1WHF A;  2XBY L;  1FAK L;  1QFK L;  1FFM A;  4ZH8 B;  2Y80 B;  1DVA L;  3LN0 A;  2BZ6 L;  3TK5 B;  1JBU L;  4RRX A;  1ZAQ A;  2B7D L;  2W3K B;  2YGO A;  3TGF A;  1N1I A;  4XL1 A;  1RFN B;  1CVW L;  4X8T L;  3CA7 A;  2WPI E;  3ELA L;  4X8V L;  3IIT B;  5IKV A;  3LTF B;  1XKA L;  3KL6 B;  5IKQ A;  3OLU A;  2CJI B;  3TZI A;  2J34 B;  2WPH E;  1IQH L;  3MQE A;  1UZK A;  2VWM K;  4Z6A L;  2WFT A;  2RNL A;  2PR3 B;  2MHP A;  1IOX A;  1A3P A;  3SOV A;  4RRZ A;  4NGA L;  2P3T A;  2PHB B;  2W26 B;  1MOX C;  3QH0 A;  1COU A;  3BPS E;  1IVO C;  2XC5 L;  5L30 L;  4JZE L;  2YGP A;  3TBD A;  1DQB A;  2W2P E;  5K0H B;  2NPR A;  2Y5G L;  5CKQ A;  1G2M B;  2P16 L;  2JKH L;  1CVU A;  2AYL A;  1XDT R;  1UZP A;  2OYU P;  2W2Q E;  2Q1J B;  3IJE B;  3N8X A;  2Y5H L;  4Y7B B;  2VH0 B;  3ZYI B;  1G1R A;  2RHP A;  1X7A L;  2VWN L;  2Y81 B;  1YO8 A;  4BTI A;  4RRY A;  2BOH A;  4RS0 A;  1NQL B;  2VWL L;  1N7D A;  3N8Z A;  1K37 A;  1KLJ L;  4Y6D B;  2WYJ B;  1NFX B;  1M1X B;  1HCG B;  2FZZ L;  2P95 L;  1NT0 A;  1IQE L;  1XFE A;  3ASI A;  1G1S A;  4ISH L;  1IQI L;  1TOZ A;  2MGP A;  2FD6 A;  2PUQ L;  3LC5 B;  1HRF A;  1IQF L;  4Y79 B;  1CCV A;  4JZF L;  1LPG A;  2P93 L;  1JL9 A;  4Z0K B;  4BTU A;  1IP0 A;  1HZ8 A;  4CUD A;  2J94 B;  1NFY B;  5CKM A;  1C5M F;  4NG9 L;  1FSB A;  4NA9 L;  2EI8 B;  2FLR L;  2G00 L;  6COX A;  4XLW A;  1EMO A;  3HPT A;  2BOU A;  3KRK A;  1EPJ A;  4E1G A;  2J95 B;  2W2N E;  3N8W B;  1EQH A;  1PRH A;  4YZU B;  2KL7 A;  4BDW A;  1SZB A;  5JVZ A;  3N8V A;  2WFX B;  1IQM L;  3KK6 A;  1ATD A;  4RRW A;  2TGF A;  2XC0 L;  1Q4G A;  1NPE B;  2VH6 B;  1FAX L;  1FJS L;  1OB1 C;  1APO A;  1I0U A;  4YT6 L;  1IGZ A;  3DEM A;  3LIW B;  1ATE A;  1IOE L;  2GD4 A;  2UWO B;  1ATB A;  3F1S B;  3HO3 A;  5CIS A;  1DX5 I;  1AUT L;  2WPL E;  2WG4 B;  3GCW E;  1DIY A;  1PXX A;  4MMZ B;  2UWP B;  2Y7X B;  3Q7D A;  1CCF A;  3C9A C;  3LC3 B;  2D1J B;  3GCX E;  1W8B L;  1IGX A;  1KLO A;  3CS7 L;  1HJ7 A;  2XBV L;  4MMX B;  1P9J A;  2ADX A;  1F7M A;  2RA0 L;  3N8Y A;  4O02 B;  1PFX L;  1EPG A;  4RUT A;  1K36 A;  3HO4 A;  1HRE A;  1CEJ A;  3BT2 A;  4JYV L;  5CKN A;  3ZYG A;  1EAI C;  1NZI A;  2P3U A;  3HS6 A;  5JBC E;  2P94 L;  2EI6 B;  3KQC L;  5EGM B;  4COX A;  2WYG B;  3FBY A;  3QCW A;  5L2Z L;  2FLB L;  1IJQ A;  4OTY A;  1DDX A;  2MGR A;  4CSY A;  1L5G B;  1IQL L;  3EGF A;  1G1Q A;  3BT1 A;  2W2M E;  1FE2 A;  2W3I B;  4ZXY L;  4ZAE B;  1LPZ A;  2VJ3 A;  1HT5 A;  1F0S B;  4X8U L;  1O5D L;  3MDL A;  5IKR A;  1EGF A;  4Y7A B;  3CEN L;  3KQB L;  3F6U L;  3CFW A;  4X8S L;  2P3F L;  1U8C B;  1B9W A;  2VVC K;  2XC4 L;  2Y7Z B;  1KSN B;  3M36 L;  2Y5F L;  4D0E A;  3SOB B;  2BMG A;  1CX2 A;  1L3Y A;  3TK6 B;  1NFW B;  2BQ7 A;  2P26 A;  2W2O E;  5I46 L;  3N8W A;  2UWL B;  1IQN L;  4CUF A;  5COX A;  2WG3 C;  2EI7 B;  2OYE P;  5E8D A;  4CUE A;  1ATA A;  1HAF A;  4D90 A;  1Z6C A;  5JW1 A;  2WPJ E;  1URK A;  3NJP C;  4MMY B;  2BOX A;  1YUK B;  4BTT A;  3HS5 A;  4LMF A;  2VVU L;  5KIR A;  2KB9 A;  3M37 L;  2Y38 A;  2I9B A;  4ZHA B; 
#chains in the Genus database with same CATH topology
 1YUG A;  4BXW A;  2JJL A;  4AQT A;  3RR3 A;  5FDQ A;  1MQ6 L;  4O1Z A;  3FFG L;  2BQ6 A;  3SW2 A;  4BXS A;  2HOX A;  4Z0L A;  5JB8 E;  2DDU A;  2VWO L;  1PTH A;  1XKB A;  4C16 A;  2P3F N;  3GIS X;  2YGQ A;  3FCS B;  2XBW L;  3ZYJ B;  1YGC L;  2K2S B;  4XBM A;  1MQ5 L;  1TPG A;  4JYU L;  4A7I A;  4Y76 B;  2KV4 A;  1HT8 A;  4FM5 A;  2H9E L;  2F9B L;  1YUF A;  2P28 B;  2XBX L;  2KNI A;  3KCG L;  1WU1 B;  4LOR A;  2J38 B;  2BOK L;  1G2L B;  4YT7 L;  2HOR A;  4ZXX L;  4TGF A;  3KQD L;  1WHE A;  1EMN A;  2J2U B;  5F19 A;  3V65 B;  3K9X A;  4OTJ A;  2J4I B;  3QMO A;  5JBB E;  1KLI L;  1F7E A;  3H5C B;  1W7X L;  1U67 A;  3POY A;  3HS7 A;  1TLE A;  2WZP P;  4JZD L;  1ADX A;  4G1M B;  5F1A A;  3LTG D;  3N8Y B;  1HX2 A;  4Y71 B;  1FF7 A;  1KIG L;  4M10 A;  3HO5 A;  1NFU B;  1PGE A;  3SOQ A;  1J9C L;  1UZQ A;  3U7U G;  3LAQ A;  4ISI L;  4PH9 A;  1Z6E L;  2M74 A;  2VVV L;  2K2T A;  2W86 A;  1HAE A;  3Q3K B;  1EBV A;  1EZQ B;  1UZJ A;  3NTG A;  1IQK L;  3V64 C;  1BF9 A;  3OLT A;  2WPM E;  3P5B L;  5KN5 C;  1F0R B;  5L2Y L;  1EQG A;  3R05 A;  1LMM A;  5JBA E;  2WPK E;  1G1T A;  5JVY A;  1IQJ L;  5IKT A;  4BDX A;  2Y82 B;  2FLG A;  3NT1 A;  4D0F A;  2BO2 A;  2I9A A;  5JB9 E;  1CQE A;  3LN1 A;  1LMJ A;  1EPH A;  1JV2 B;  1EPI A;  3NTB A;  3ENS A;  3KQE L;  1V1H A;  1V3X B;  1IQG L;  1P0S L;  1APQ A;  2BQW A;  1LQD A;  3U73 A;  1LPK A;  3PGH A;  3TH3 L;  4M11 A;  1GK5 A;  1WHF A;  2XBY L;  1FAK L;  1QFK L;  1FFM A;  4ZH8 B;  2Y80 B;  1DVA L;  3LN0 A;  2BZ6 L;  3TK5 B;  2VRS A;  1JBU L;  4RRX A;  1ZAQ A;  2B7D L;  2W3K B;  2YGO A;  3TGF A;  1N1I A;  4XL1 A;  1RFN B;  1CVW L;  4X8T L;  3CA7 A;  2WPI E;  3ELA L;  4X8V L;  3IIT B;  5IKV A;  3LTF B;  3S6X A;  1XKA L;  3KL6 B;  5IKQ A;  3OLU A;  2CJI B;  3TZI A;  1KKE A;  2J34 B;  2WPH E;  1IQH L;  3MQE A;  1UZK A;  2VWM K;  4Z6A L;  2WFT A;  2RNL A;  2PR3 B;  2MHP A;  1IOX A;  1A3P A;  4GU4 A;  3SOV A;  4RRZ A;  4NGA L;  2P3T A;  2PHB B;  2W26 B;  1MOX C;  3QH0 A;  1COU A;  3BPS E;  1IVO C;  2XC5 L;  5L30 L;  4JZE L;  2YGP A;  3TBD A;  1DQB A;  2W2P E;  5K0H B;  2NPR A;  2Y5G L;  5CKQ A;  1G2M B;  2P16 L;  2JKH L;  1CVU A;  2AYL A;  1XDT R;  1UZP A;  2OYU P;  2W2Q E;  2Q1J B;  3IJE B;  3N8X A;  2Y5H L;  4Y7B B;  2VH0 B;  3ZYI B;  1G1R A;  2RHP A;  1X7A L;  2VWN L;  2Y81 B;  1YO8 A;  4BTI A;  4RRY A;  2BOH A;  4RS0 A;  1NQL B;  2VWL L;  1N7D A;  3N8Z A;  1K37 A;  1KLJ L;  4Y6D B;  2WYJ B;  1NFX B;  1M1X B;  1HCG B;  2FZZ L;  2P95 L;  1NT0 A;  1IQE L;  1XFE A;  3ASI A;  1G1S A;  4ISH L;  1IQI L;  1TOZ A;  2MGP A;  2FD6 A;  2PUQ L;  3LC5 B;  1HRF A;  1IQF L;  4Y79 B;  1CCV A;  4JZF L;  1LPG A;  2P93 L;  2H9E C;  1JL9 A;  4Z0K B;  4BTU A;  1V1I A;  1IP0 A;  1HZ8 A;  4CUD A;  4GU3 A;  2J94 B;  1NFY B;  5CKM A;  1C5M F;  4NG9 L;  1FSB A;  4NA9 L;  2EI8 B;  2FLR L;  2G00 L;  6COX A;  4XLW A;  1EMO A;  3HPT A;  2BOU A;  3KRK A;  1EPJ A;  4E1G A;  2J95 B;  2W2N E;  3N8W B;  1EQH A;  1PRH A;  4YZU B;  2KL7 A;  4BDW A;  1SZB A;  5JVZ A;  3N8V A;  2WFX B;  1IQM L;  3KK6 A;  1ATD A;  4RRW A;  2TGF A;  2XC0 L;  1Q4G A;  1NPE B;  2VH6 B;  1FAX L;  1FJS L;  1OB1 C;  1APO A;  1I0U A;  4YT6 L;  1IGZ A;  3DEM A;  3LIW B;  1ATE A;  1IOE L;  2GD4 A;  2UWO B;  1ATB A;  2BSF A;  1QIU A;  3F1S B;  3HO3 A;  5CIS A;  1DX5 I;  1AUT L;  2WPL E;  2WG4 B;  3GCW E;  1DIY A;  1PXX A;  4MMZ B;  2UWP B;  2Y7X B;  3Q7D A;  1CCF A;  3C9A C;  3LC3 B;  2D1J B;  2BT8 A;  3GCX E;  1W8B L;  1IGX A;  1KLO A;  3CS7 L;  1HJ7 A;  2XBV L;  4MMX B;  1P9J A;  2ADX A;  1F7M A;  2RA0 L;  3N8Y A;  4O02 B;  1PFX L;  1LK9 A;  1EPG A;  4RUT A;  1K36 A;  3HO4 A;  1HRE A;  1CEJ A;  3BT2 A;  4JYV L;  5CKN A;  3ZYG A;  1EAI C;  1NZI A;  2P3U A;  3HS6 A;  5JBC E;  4A94 C;  2P94 L;  2EI6 B;  3KQC L;  5EGM B;  4COX A;  2WYG B;  3FBY A;  3QCW A;  5L2Z L;  2FLB L;  1IJQ A;  4OTY A;  1DDX A;  2MGR A;  4CSY A;  1L5G B;  1IQL L;  3EGF A;  2BT7 A;  1G1Q A;  3BT1 A;  2W2M E;  1FE2 A;  2W3I B;  4ZXY L;  4ZAE B;  1LPZ A;  2VJ3 A;  1HT5 A;  1F0S B;  4X8U L;  1O5D L;  3MDL A;  5IKR A;  1EGF A;  4Y7A B;  3CEN L;  3KQB L;  3F6U L;  3CFW A;  4X8S L;  2P3F L;  1U8C B;  1B9W A;  2VVC K;  2XC4 L;  2Y7Z B;  1KSN B;  3M36 L;  2Y5F L;  4D0E A;  3SOB B;  2BMG A;  1CX2 A;  1L3Y A;  3TK6 B;  1NFW B;  2BQ7 A;  2P26 A;  2W2O E;  5I46 L;  3N8W A;  2UWL B;  1IQN L;  4CUF A;  5COX A;  2WG3 C;  2EI7 B;  2OYE P;  5E8D A;  4CUE A;  1ATA A;  1HAF A;  4D90 A;  1Z6C A;  5JW1 A;  2WPJ E;  1URK A;  3NJP C;  4MMY B;  2BOX A;  1YUK B;  4BTT A;  3HS5 A;  4LMF A;  2VVU L;  5KIR A;  2KB9 A;  3M37 L;  2Y38 A;  2I9B A;  4ZHA B; 
#chains in the Genus database with same CATH homology
 1YUG A;  4BXW A;  4AQT A;  3RR3 A;  5FDQ A;  1MQ6 L;  4O1Z A;  3FFG L;  2BQ6 A;  3SW2 A;  4BXS A;  4Z0L A;  5JB8 E;  2DDU A;  2VWO L;  1PTH A;  1XKB A;  4C16 A;  2P3F N;  3GIS X;  2YGQ A;  3FCS B;  2XBW L;  3ZYJ B;  1YGC L;  2K2S B;  4XBM A;  1MQ5 L;  1TPG A;  4JYU L;  4A7I A;  4Y76 B;  2KV4 A;  1HT8 A;  4FM5 A;  2H9E L;  2F9B L;  1YUF A;  2P28 B;  2XBX L;  2KNI A;  3KCG L;  1WU1 B;  4LOR A;  2J38 B;  2BOK L;  1G2L B;  4YT7 L;  4ZXX L;  4TGF A;  3KQD L;  1WHE A;  1EMN A;  2J2U B;  5F19 A;  3V65 B;  3K9X A;  4OTJ A;  2J4I B;  3QMO A;  5JBB E;  1KLI L;  1F7E A;  3H5C B;  1W7X L;  1U67 A;  3POY A;  3HS7 A;  1TLE A;  2WZP P;  4JZD L;  1ADX A;  4G1M B;  5F1A A;  3LTG D;  3N8Y B;  1HX2 A;  4Y71 B;  1FF7 A;  1KIG L;  4M10 A;  3HO5 A;  1NFU B;  1PGE A;  3SOQ A;  1J9C L;  1UZQ A;  3U7U G;  3LAQ A;  4ISI L;  4PH9 A;  1Z6E L;  2M74 A;  2VVV L;  2K2T A;  2W86 A;  1HAE A;  3Q3K B;  1EBV A;  1EZQ B;  1UZJ A;  3NTG A;  1IQK L;  3V64 C;  1BF9 A;  3OLT A;  2WPM E;  3P5B L;  5KN5 C;  1F0R B;  5L2Y L;  1EQG A;  3R05 A;  1LMM A;  5JBA E;  2WPK E;  1G1T A;  5JVY A;  1IQJ L;  5IKT A;  4BDX A;  2Y82 B;  2FLG A;  3NT1 A;  4D0F A;  2BO2 A;  2I9A A;  5JB9 E;  1CQE A;  3LN1 A;  1LMJ A;  1EPH A;  1JV2 B;  1EPI A;  3NTB A;  3ENS A;  3KQE L;  1V3X B;  1IQG L;  1P0S L;  1APQ A;  2BQW A;  1LQD A;  3U73 A;  1LPK A;  3PGH A;  3TH3 L;  4M11 A;  1GK5 A;  1WHF A;  2XBY L;  1FAK L;  1QFK L;  1FFM A;  4ZH8 B;  2Y80 B;  1DVA L;  3LN0 A;  2BZ6 L;  3TK5 B;  1JBU L;  4RRX A;  1ZAQ A;  2B7D L;  2W3K B;  2YGO A;  3TGF A;  1N1I A;  4XL1 A;  1RFN B;  1CVW L;  4X8T L;  3CA7 A;  2WPI E;  3ELA L;  4X8V L;  3IIT B;  5IKV A;  3LTF B;  3S6X A;  1XKA L;  3KL6 B;  5IKQ A;  3OLU A;  2CJI B;  3TZI A;  2J34 B;  2WPH E;  1IQH L;  3MQE A;  1UZK A;  2VWM K;  4Z6A L;  2WFT A;  2RNL A;  2PR3 B;  2MHP A;  1IOX A;  1A3P A;  3SOV A;  4RRZ A;  4NGA L;  2P3T A;  2PHB B;  2W26 B;  1MOX C;  3QH0 A;  1COU A;  3BPS E;  1IVO C;  2XC5 L;  5L30 L;  4JZE L;  2YGP A;  3TBD A;  1DQB A;  2W2P E;  5K0H B;  2NPR A;  2Y5G L;  5CKQ A;  1G2M B;  2P16 L;  2JKH L;  1CVU A;  2AYL A;  1XDT R;  1UZP A;  2OYU P;  2W2Q E;  2Q1J B;  3IJE B;  3N8X A;  2Y5H L;  4Y7B B;  2VH0 B;  3ZYI B;  1G1R A;  2RHP A;  1X7A L;  2VWN L;  2Y81 B;  1YO8 A;  4BTI A;  4RRY A;  2BOH A;  4RS0 A;  1NQL B;  2VWL L;  1N7D A;  3N8Z A;  1K37 A;  1KLJ L;  4Y6D B;  2WYJ B;  1NFX B;  1M1X B;  1HCG B;  2FZZ L;  2P95 L;  1NT0 A;  1IQE L;  1XFE A;  3ASI A;  1G1S A;  4ISH L;  1IQI L;  1TOZ A;  2MGP A;  2FD6 A;  2PUQ L;  3LC5 B;  1HRF A;  1IQF L;  4Y79 B;  1CCV A;  4JZF L;  1LPG A;  2P93 L;  2H9E C;  1JL9 A;  4Z0K B;  4BTU A;  1IP0 A;  1HZ8 A;  4CUD A;  2J94 B;  1NFY B;  5CKM A;  1C5M F;  4NG9 L;  1FSB A;  4NA9 L;  2EI8 B;  2FLR L;  2G00 L;  6COX A;  4XLW A;  1EMO A;  3HPT A;  2BOU A;  3KRK A;  1EPJ A;  4E1G A;  2J95 B;  2W2N E;  3N8W B;  1EQH A;  1PRH A;  4YZU B;  2KL7 A;  4BDW A;  1SZB A;  5JVZ A;  3N8V A;  2WFX B;  1IQM L;  3KK6 A;  1ATD A;  4RRW A;  2TGF A;  2XC0 L;  1Q4G A;  1NPE B;  2VH6 B;  1FAX L;  1FJS L;  1OB1 C;  1APO A;  1I0U A;  4YT6 L;  1IGZ A;  3DEM A;  3LIW B;  1ATE A;  1IOE L;  2GD4 A;  2UWO B;  1ATB A;  3F1S B;  3HO3 A;  5CIS A;  1DX5 I;  1AUT L;  2WPL E;  2WG4 B;  3GCW E;  1DIY A;  1PXX A;  4MMZ B;  2UWP B;  2Y7X B;  3Q7D A;  1CCF A;  3C9A C;  3LC3 B;  2D1J B;  3GCX E;  1W8B L;  1IGX A;  1KLO A;  3CS7 L;  1HJ7 A;  2XBV L;  4MMX B;  1P9J A;  2ADX A;  1F7M A;  2RA0 L;  3N8Y A;  4O02 B;  1PFX L;  1EPG A;  4RUT A;  1K36 A;  3HO4 A;  1HRE A;  1CEJ A;  3BT2 A;  4JYV L;  5CKN A;  3ZYG A;  1EAI C;  1NZI A;  2P3U A;  3HS6 A;  5JBC E;  4A94 C;  2P94 L;  2EI6 B;  3KQC L;  5EGM B;  4COX A;  2WYG B;  3FBY A;  3QCW A;  5L2Z L;  2FLB L;  1IJQ A;  4OTY A;  1DDX A;  2MGR A;  4CSY A;  1L5G B;  1IQL L;  3EGF A;  1G1Q A;  3BT1 A;  2W2M E;  1FE2 A;  2W3I B;  4ZXY L;  4ZAE B;  1LPZ A;  2VJ3 A;  1HT5 A;  1F0S B;  4X8U L;  1O5D L;  3MDL A;  5IKR A;  1EGF A;  4Y7A B;  3CEN L;  3KQB L;  3F6U L;  3CFW A;  4X8S L;  2P3F L;  1U8C B;  1B9W A;  2VVC K;  2XC4 L;  2Y7Z B;  1KSN B;  3M36 L;  2Y5F L;  4D0E A;  3SOB B;  2BMG A;  1CX2 A;  1L3Y A;  3TK6 B;  1NFW B;  2BQ7 A;  2P26 A;  2W2O E;  5I46 L;  3N8W A;  2UWL B;  1IQN L;  4CUF A;  5COX A;  2WG3 C;  2EI7 B;  2OYE P;  5E8D A;  4CUE A;  1ATA A;  1HAF A;  4D90 A;  1Z6C A;  5JW1 A;  2WPJ E;  1URK A;  3NJP C;  4MMY B;  2BOX A;  1YUK B;  4BTT A;  3HS5 A;  4LMF A;  2VVU L;  5KIR A;  2KB9 A;  3M37 L;  2Y38 A;  2I9B A;  4ZHA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...