1LF6A

Crystal structure of bacterial glucoamylase
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
674
structure length
674
Chain Sequence
b'SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glucoamylase
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
total genus 242
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf6A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf6A01
1IA6A 2WW3A 3QWTA 3WIRA 3ECQA 4CJ1A 3VD3A 2DRRA 1GLMA 3QT3A 5A1AA 1RWFA 1L7JA 1IA7A 1XWTA 3TF4A 3MUY1 2E24A 3ACSA 1MMXA 1GAHA 1F9DA 3A24A 3QT9A 1V7WA 3RX5A 1JYWA 3RX7A 4DUWA 1FBWA 4WVAA 3RRSA 1AGMA 3I3EA 1JZ2A 3K11A 3T33A 1LF6A 1X1JA 2JG0A 1MMZA 1KSCA 2FV1A 2CQTA 3T09A 1V5DA 1OJMA 3T0AA 3T2PA 1HCUA 1YQ2A 1OJOA 1YGAA 4TTGA 2CIRA 1JZ6A 3QDEA 2WVXB 1X1IA 3T08A 4WVCA 2XHNA 2AHFA 4ZH5A 1AYXA 2GZ6A 3VDCA 4L0GA 1NXCA 1GA2A 2WVYA 4AYRA 2ZQ0A 1H14A 1JOVA 2JJBA 1OJPA 3W5NA 2OKXA 2JF4A 3AFJA 3QRYA 3RENA 4DOEA 3QG0A 3IAPA 2WW2A 1G9GA 2FBAA 3E6UA 1HN0A 1MN0A 4KTRA 3NREA 1LF9A 3CZJA 5CZLA 2WVXA 1NS2A 5MEHA 2WZSA 1LOHA 3WKFA 3ACTA 3VDBA 2RGKA 5DGRA 1HMWA 1NS7A 1FAEA 3DYMA 1F4AA 4TXTA 1FO2A 1CEMA 3SEPA 3QXQA 1F1SA 3NJVA 2WVZA 1V5CA 5M7IA 1RWGA 3DYPA 1RQ5A 2BRWA 1SO0A 3QPFA 3QFYA 5M7YA 1HM2A 3K25A 4Q2BA 1CLCA 2YIKA 5KKBA 2RI9A 3T2OA 3D3IA 2Z07A 2JKPA 4BZFA 3GLYA 1WZZA 1G6IA 5CD2A 2D8LA 3WIQA 1FCEA 1NSZA 2X03A 1LURA 1MMUA 4JJJA 3W7WA 1OJNA 2AHGA 2VN7A 3MV11 1KKTA 3WKIA 2CQSA 3IAQA 1G9JA 3S4DA 4Z4JA 1JZ3A 3PMMA 1N7RA 3W7UA 4RNLA 1UG9A 3WUXA 3E73A 3DYOA 2DRSA 1JYXA 4EL8A 3ANJA 3W7SA 1KREA 1LXKA 1WU4A 1NKGA 1MMYA 1K72A 2ZZRA 3ON6A 1RWAA 4CE7A 1L7KA 2DROA 1X9DA 1JZ8A 3S4AA 4AYQA 3VD5A 3QFZA 2FV0A 4Z4LA 4L6XA 3I3DA 3H2WA 2GH4A 2F6DA 2RI8A 2P0VA 3VD7A 1N7NA 1L1YA 3OBAA 1KS8A 2XFGA 1NS8A 2EAEA 3ANKA 1VD5A 3WIWA 1LXMA 1NSMA 1NS4A 2WW1A 3EQAA 3MV01 3MWXA 1FO3A 1N7QA 2BRVX 2CISA 3CIHA 1NSVA 3MUZ1 1WU6A 2CIQA 2E22A 1DP0A 1FMIA 2XSGA 3VD4A 2QNOA 2D73A 1EGUA 1UT9A 3E1F1 1F9OA 1JS4A 3A3VA 4Q88A 2D5JA 3NJXA 2AFAA 3T0BA 3VD9A 3DECA 2WCOA 2VN4A 2ZXQA 1NS0A 1GAIA 3QSPA 1NSUA 1TF4A 1JZ7A 3EZ8A 1RWCA 1DL2A 4DODA 4AQ0A 1K1XA 2JKAA 3RX8A 1V7XA 3Q1NA 1JYVA 2HTAA 4ZG8A 1CB8A 4AYPA 2WW0A 3BGAA 4WVBA 3P2CA 4XUVA 3X17A 4TF4A 3J7HA 2WDAA 2HTBA 4KTPA 3QXFA 3W7XA 3WKHA 2ZBLA 3T0DA 3WKGA 3VDAA 1ULVA 1F9GA 1XWQA 3H3KA 1PX4A 2DRQA 1N7OA 1JZ4A 1SNZA 1KFGA 1L2AA 1NSSA 3I3BA 1NC5A 1HN1A 1KSDA 1XW2A 4BZGA 1NSRA 2FUZA 4DUVA 3OS7A 1RWHA 5CA3A 1H12A 1K1WA 3DCDA 1FP3A 2BRPA 1G87A 1IS9A 3T2QA 5DGQA 1PX3A 4DUXA 2B4FA 1Z45A 5E1QA 2EACA 1NSXA 1JYNA 1JZ5A 4WU0A 1HMUA 1I8QA 4FUSA 2EABA 4BZEA 3S4CA 1TXKA 2EADA 2WYNA 1W3YA 1KWFA 1V7VA 1N7PA 3W7TA 1H54A 3IMHA 3VW5A 4BZHA 1HM3A 3GT5A 3OB8A 3VXDA 1FBOA 4J5TA 3ANIA 1DOGA 5GW7A 1J0NA 3WC3A 3W5MA 2NVPA 1J0MA 1K1YA 1X1HA 1F4HA 1RW9A 1KRFA 3S4BA 3GZKA 1H13A 2Q1FA 4CJ0A 5GY3A 3WFAA 1C82A 5E2JA 2A8ZA 4AYOA 2JKEA 3RSYA 1WU5A 3H7LA
chains in the Genus database with same CATH superfamily
1LD7B 1IA6A 3DX0A 2WW3A 2V8JA 3QWTA 5DHIA 3WIRA 2G02A 3RJ3A 3DX4A 3ECQA 4CJ1A 3VD3A 2DRRA 4BTWA 1GLMA 3QT3A 5A1AA 5IK9A 1H3CA 1RWFA 1X81B 2XQWA 1L7JA 1IA7A 1XWTA 3TF4A 2C10A 1TNZB 3MUY1 2E24A 3M00A 3ACSA 1MMXA 1GAHA 2A73B 1F9DA 3CZNA 1TQSA 3QT9A 2OOVC 3A24A 1QWNA 5IK6A 4EV5A 1V7WA 4V1SA 3RX5A 4KFDA 3EU8A 1JYWA 5FOBB 2E2UA 3D4ZA 3RX7A 3X3XA 1W2ZA 1W6JA 4EHMB 4DUWA 4L9PB 1FBWA 2OOVA 1O6QA 4WVAA 3RRSA 2ZL8A 4MMIA 1GSZA 1TN7B 3G4FA 2WOFA 1AGMA 3X40A 3I3EA 1JZ2A 3E32B 1AV4A 3K11A 4BOJA 3EJRA 3BVUA 1QWUA 3T33A 3E34B 1LF6A 2H6HB 1D6UA 1X1JA 2JG0A 1MMZA 1KSCA 2FV1A 2CWUA 4KKIA 4LIXA 3E30B 2CQTA 1C3DA 1EKMA 4ZRPA 1W5ZA 3T09A 4ZH1A 1HZFA 1V5DA 3N0GA 1OJMA 1W4NA 3T0AA 1IVWA 1QX1A 1HXCA 3T2PA 1HCUA 1N20A 1YQ2A 1OJOA 1YGAA 3Q7AB 5EASA 4TTGA 1N1BA 2CIRA 3KQ4A 1JZ6A 1S64B 3QDEA 2WVXB 1X1IA 3KSQB 3M73A 4FNRA 3T08A 4WVCA 3BUBA 5IKAA 2XHNA 2AHFA 4FNVA 4ZH5A 1QAKA 1TN8B 1AYXA 1DCEB 2GZ6A 3VDCA 4L0GA 5IL3A 1NXCA 1IU7A 1GA2A 5ILYA 2WVYA 4FNTA 4AYRA 3DRAB 2ZQ0A 1H14A 1JOVA 2XWBB 2JJBA 1O79A 3PZ4B 5IM1A 1QALA 1OJPA 3HIIA 1N21A 3W5NA 2OKXA 2JF4A 3AFJA 3QRYA 3RENA 4DOEA 3QG0A 3IAPA 1HTYA 2WW2A 1G9GA 2FBAA 2PMVA 2WY8A 1O7DD 4FXGB 3DSWB 1HN0A 3E6UA 4QT9A 3HXEB 1MN0A 3DSVB 4KTRA 3NREA 1LF9A 1W6KA 5ILKA 4EV2A 3CZJA 2W0QA 5CZLA 2E2VA 1TNOB 1JCSB 2J5CA 4GL3A 2V3PA 2WVXA 1NS2A 1R34A 4KFFA 5EATA 5MEHA 2WZSA 1TQVA 1LOHA 3WKFA 1FT2B 3ACTA 3VDBA 2RGKA 4UFCA 5DGRA 4DI5A 1HMWA 1N24A 1NS7A 4MMHA 3M72A 1FAEA 1JCQB 1WMNA 3DYMA 1F4AA 2WINB 1FO2A 4TXTA 1CEMA 3M02A 1H39A 3QXQA 3SEPA 4GTOB 3X3ZA 1F1SA 3LOYA 1HXAA 1QAZA 4YDOB 3NJVA 4D4AA 2WVZA 1V5CA 5M7IA 1KZPB 1RWGA 3N0FA 4E1YA 2CG1A 1N4RB 1LD8B 3DYPA 1RQ5A 3M77A 3PYBA 2BRWA 1SO0A 3CV5A 3QPFA 3QFYA 2YFOA 1RKYA 3Q78B 5M7YA 1HM2A 4FXKB 2OW6A 3K25A 4Q2BA 3M71A 1CLCA 2YIKA 2G0DA 4LNGB 5KKBA 2IEJB 1LVNA 1OACA 3HXDB 3D50A 2RI9A 1N9EA 3WA2X 3T2OA 2Y73A 4OJZA 3LVTA 3D3IA 2Z07A 3M74A 3SFYB 1FPPB 2JKPA 3C72B 4BZFA 1PS3A 3MI6A 3GLYA 2XN2A 2V8IA 1G6IA 1WZZA 5CD2A 2D8LA 2CG0A 3WIQA 2CWTA 3CZSA 1TNYB 1WMOA 1FCEA 1TNUB 1NSZA 2X03A 1LURA 1MMUA 4JJJA 3W7WA 1SIIA 3M76A 1OJNA 2AHGA 2VN7A 1W7CA 4GTRB 2RDYA 2FUTA 1QBQB 3VSNA 3EUVB 4ZRQA 4GTSB 3MV11 1KKTA 3WKIA 4OZVA 2CQSA 3Q75B 3EJQA 4GTPB 3IAQA 1G9JA 1RJOA 2PNCA 1QQFA 3S4DA 4YCRA 3PZ1B 4FJQA 4Z4JA 1JZ3A 3SDRA 1NL4B 3VSMA 4GAXA 3PMMA 3X41A 4OK2A 1N7RA 3W7UA 3DX2A 4RNLA 1UG9A 3SAEA 2BBCA 3WUXA 3E73A 4C1SA 3SFXB 3DYOA 2DRSA 1JYXA 4GTQB 4EL8A 1GXNA 3ANJA 3DSUB 1N94B 1JRQA 3W7SA 1KREA 1LXKA 1WU4A 3HXCB 3KN4A 3PGBA 5JPNB 1NKGA 1MMYA 1K72A 2ZZRA 4D4CA 4GTTB 3ON6A 1RWAA 2CFLA 4CE7A 1L7KA 5FO9B 5DHKA 2BB5A 1US1A 1H3BA 2F7QA 2DROA 1X9DA 3NBBA 1JZ8A 4YDEB 1GXOA 3D4YA 2ZISB 3S4AA 4AYQA 3G4DA 1FT1B 1HV6A 3QFZA 3VD5A 1UI7A 5IK0A 1N95B 5IKHA 2FV0A 1R76A 2ONGA 1N4QB 3NFVA 2F7RA 2XN1A 3D5RA 4V1RA 4Z4LA 4L6XA 2CFDA 2FYVA 3AFLA 1NI1B 4F13A 3SDTA 3I3DA 3H2WA 3P5PA 4GTVB 1KZOB 3EU5B 2GH4A 2F6DA 2RI8A 2YFNA 2P0VA 3VD7A 1N7NA 1S63B 1IVUA 1L1YA 3BUIA 3OBAA 4D4DA 1KS8A 3MPHA 1HWWA 5EAUA 3BUDA 3BUPA 2XFGA 5GZKA 1NS8A 3S9VA 2WYHA 2EAEA 3ANKA 1GXMA 1VD5A 3DSXB 1D8DB 3PZ2B 1H35A 5AGDA 3G6JB 1LXMA 3DSSB 3WIWA 2F0YB 1NSMA 2OW7A 2WGQA 1NS4A 2F18A 4KFEA 2SQCA 3DPYB 3EQAA 4OZWA 2WW1A 2YX9A 3MV01 1GHQA 3MWXA 1FO3A 1N7QA 2BRVX 4GTMB 3D51A 2CISA 3ALAA 1IVVA 1O5MB 3CIHA 2WOHA 1NSVA 3MUZ1 1WU6A 1HX9A 2CIQA 2E22A 4LNBB 3OXUA 4LNVA 3BUQA 2PN5A 1O6HA 1DP0A 1FMIA 2XSGA 1N4SB 3VD4A 2ALWA 3KLSA 2QNOA 1MZCB 2D73A 1EGUA 5FO7B 1AVKA 1O1SB 1UT9A 3BLBA 3E1F1 1F9OA 1JS4A 3A3VA 3SDUA 1TQTA 4Q88A 2OQEC 3WVFA 2D5JA 2H6GB 1PU4A 2WY7A 3NJXA 2XN0A 3M7LA 2AFAA 1UMPA 3T0BA 2FUQA 4K3AA 3VD9A 3DECA 2WCOA 2VN4A 2OQEA 2ZXQA 1NS0A 2C11A 1GAIA 1SIHA 3QSPA 1W6CA 1JCRB 1NSUA 1TF4A 1AVLA 2F7OA 1JZ7A 3EZ8A 1RWCA 1R33A 1DL2A 3CU7A 4DODA 4AQ0A 1K1XA 2JKAA 3EJPA 3OEDA 3RX8A 3Q73B 1V7XA 1TU5A 3BVXA 3Q1NA 1JYVA 3E33B 4FNQA 2F1AA 2E2TA 3T0UA 2HTAA 4ZG8A 1CB8A 3D52A 2ZIRB 3LZ9A 4AYPA 1QAFA 1WMPA 2CWVA 2WW0A 3BGAA 1IVXA 1HXGA 4WVBA 3P2CA 4XUVA 3X17A 4TF4A 3J7HA 1KSIA 2WDAA 4FNPA 2HTBA 4KTPA 3D5SA 3QXFA 3W7XA 2F1BA 3WKHA 5ILZA 2ZBLA 1TN6B 3HXBB 3T0DA 3WKGA 3BLCA 3VDAA 1ULVA 1F9GA 4OK4A 1IQXA 1O1TB 1XWQA 3H3KA 2CFWA 3NBJA 1PX4A 2DRQA 2XWJB 3AMOB 3BS6A 1N7OA 1JZ4A 1SNZA 1KFGA 2D1WA 1N1ZA 1L2AA 1NSSA 3I3BA 1NC5A 3TY1A 1HN1A 1KSDA 1XW2A 2V8KA 5ILJA 4BZGA 1W6GA 2Y74A 4BTYA 1SA4B 3BVTA 2BEDB 3HIGA 2BT3A 1H36A 1O1RB 1NSRA 4M76A 2FUZA 1SA5B 4DUVA 3OS7A 1RWHA 5IL8A 3DDFA 2CFGA 5CA3A 1H12A 1K1WA 3DCDA 3SXXA 1FP3A 2BRPA 1TQUA 1G87A 1O6RA 1IS9A 3T2QA 3SDVA 2GOXA 5DGQA 3X3YA 1PX3A 3X42A 4DUXA 2B4FA 2V3NA 3DSTB 2I07B 1Z45A 3HXFB 5E1QA 2EACA 4BTXA 5ILHA 1NSXA 3BVWA 1JYNA 3Q79B 1JZ5A 4WU0A 4MU9A 3K5TA 1HMUA 4ONTA 3KIIA 1SQCA 4F10A 3E37B 4NEIA 3AMOA 1I8QA 4KKJA 3SX1A 4FUSA 4D94A 2H6IB 2EABA 1DYUA 4BZEA 1N9AB 2H6FB 4BOKA 3S4CA 1TXKA 2EADA 1TQWA 1W3YA 2WYNA 2WYIA 3M7BA 3DX1A 1KWFA 1V7VA 4FNSA 1N7PA 3W7TA 5C05A 1H54A 3IMHA 3HI7A 3N9HA 1LTXB 1HXKA 3EJUA 3VW5A 1D6ZA 2WO0A 4BZHA 1HM3A 5JMDA 3PYAA 3GT5A 3SDQA 2F7PA 1IQYA 3OB8A 3KSLB 3VXDA 1FBOA 5ILIA 4J5TA 3A0OA 3ANIA 1DOGA 1A2VA 5GW7A 1J0NA 2R2LB 3WC3A 1N23A 4MBGB 3PZ3B 1D8EB 3W5MA 4D4BA 2NVPA 1J0MA 1TNBB 3E7JA 5JPMB 1K1YA 1X1HA 2CFKA 1F4HA 3BVVA 1RW9A 2WIIB 1H3AA 5KBPA 1SPUA 4K35A 2ONHA 3DDGA 1KRFA 3NNBA 1UI8A 3S4BA 3GZKA 3SQCA 3M75A 1H13A 2Q1FA 4CJ0A 1N22A 5FO8B 2NOJA 5ILDA 3K7XA 3M7EA 5GY3A 1D6YA 3DX3A 3WFAA 1QSJA 3P5RA 1N4PB 5JMFA 1C82A 5E2JA 3WA3A 2BB6A 3E80A 2A8ZA 3M01A 4AYOA 2JKEA 4RNQA 3RSYA 2B39A 3EJTA 3M78A 3Q7FB 3EJSA 4FNUA 3M7CA 1WU5A 1H37A 3H7LA
chains in the Genus database with same CATH topology
1LD7B 1IA6A 2WW3A 2V8JA 3QWTA 3WIRA 2G02A 3RJ3A 3ECQA 4CJ1A 3VD3A 2DRRA 1GLMA 3QT3A 5A1AA 1H3CA 2XQWA 1X81B 1RWFA 1L7JA 1IA7A 1XWTA 3TF4A 3MUY1 1TNZB 2E24A 3ACSA 1MMXA 1GAHA 2A73B 1F9DA 3A24A 3QT9A 1V7WA 4V1SA 3RX5A 3EU8A 1JYWA 5FOBB 3RX7A 1W6JA 4EHMB 4DUWA 4L9PB 1FBWA 1O6QA 4WVAA 3RRSA 4MMIA 1GSZA 1TN7B 1AGMA 3I3EA 1JZ2A 3E32B 3K11A 4BOJA 3T33A 3E34B 1LF6A 2H6HB 1X1JA 2JG0A 1MMZA 1KSCA 2FV1A 4KKIA 4LIXA 3E30B 2CQTA 1C3DA 4ZRPA 3T09A 4ZH1A 1HZFA 1V5DA 1OJMA 3T0AA 3T2PA 1HCUA 1YQ2A 1OJOA 1YGAA 3Q7AB 4TTGA 2CIRA 3KQ4A 1JZ6A 1S64B 3QDEA 2WVXB 3KSQB 3M73A 1X1IA 3T08A 4WVCA 2XHNA 2AHFA 4FNVA 4ZH5A 1TN8B 1AYXA 1DCEB 2GZ6A 3VDCA 4L0GA 1NXCA 1GA2A 2WVYA 4AYRA 3DRAB 2ZQ0A 1H14A 1JOVA 2XWBB 2JJBA 1O79A 3PZ4B 1OJPA 3W5NA 2OKXA 2JF4A 3AFJA 3QRYA 3RENA 4DOEA 3QG0A 3IAPA 2WW2A 1G9GA 2FBAA 2PMVA 2WY8A 4FXGB 3DSWB 3E6UA 1HN0A 4QT9A 3HXEB 1MN0A 3DSVB 4KTRA 3NREA 1LF9A 1W6KA 3CZJA 5CZLA 1TNOB 1JCSB 4GL3A 2V3PA 2WVXA 1NS2A 5MEHA 2WZSA 1LOHA 3WKFA 1FT2B 3ACTA 3VDBA 2RGKA 5DGRA 1HMWA 1NS7A 4MMHA 3M72A 1FAEA 1JCQB 3DYMA 1F4AA 2WINB 1FO2A 4TXTA 1CEMA 1H39A 3QXQA 3SEPA 4GTOB 1F1SA 4YDOB 3NJVA 4D4AA 2WVZA 1V5CA 5M7IA 1KZPB 1RWGA 1N4RB 1LD8B 3DYPA 1RQ5A 3M77A 3PYBA 2BRWA 1SO0A 3QPFA 3QFYA 3Q78B 5M7YA 4FXKB 1HM2A 3K25A 4Q2BA 3M71A 1CLCA 2YIKA 2G0DA 4LNGB 5KKBA 2IEJB 3HXDB 2RI9A 3T2OA 4OJZA 3D3IA 2Z07A 3M74A 3SFYB 1FPPB 2JKPA 3C72B 4BZFA 3GLYA 2V8IA 1G6IA 1WZZA 5CD2A 2D8LA 3WIQA 1TNYB 1FCEA 1TNUB 1NSZA 2X03A 1LURA 1MMUA 4JJJA 3W7WA 3M76A 1OJNA 2AHGA 2VN7A 4GTRB 2FUTA 1QBQB 3VSNA 3EUVB 4ZRQA 4GTSB 3MV11 1KKTA 3WKIA 2CQSA 3Q75B 4GTPB 3IAQA 1G9JA 1QQFA 3S4DA 4YCRA 3PZ1B 4Z4JA 1JZ3A 3SDRA 1NL4B 3VSMA 3PMMA 4OK2A 1N7RA 3W7UA 4RNLA 1UG9A 3SAEA 2BBCA 3WUXA 3E73A 4C1SA 3SFXB 3DYOA 2DRSA 1JYXA 4GTQB 4EL8A 1GXNA 3ANJA 3DSUB 1N94B 3W7SA 1KREA 1LXKA 1WU4A 3HXCB 5JPNB 1NKGA 1MMYA 1K72A 2ZZRA 4D4CA 4GTTB 3ON6A 1RWAA 4CE7A 1L7KA 5FO9B 2BB5A 1H3BA 2DROA 1X9DA 1JZ8A 4YDEB 1GXOA 2ZISB 3S4AA 4AYQA 3VD5A 1FT1B 3QFZA 1N95B 2FV0A 1R76A 1N4QB 3D5RA 4V1RA 4Z4LA 4L6XA 3AFLA 1NI1B 3SDTA 3I3DA 3H2WA 3P5PA 4GTVB 1KZOB 3EU5B 2GH4A 2F6DA 2RI8A 2P0VA 3VD7A 1N7NA 1S63B 1L1YA 3OBAA 4D4DA 1KS8A 2XFGA 5GZKA 1NS8A 3S9VA 2EAEA 3ANKA 1GXMA 1VD5A 3DSXB 1D8DB 3PZ2B 1H35A 5AGDA 3G6JB 3DSSB 3WIWA 1LXMA 2F0YB 1NSMA 1NS4A 2SQCA 3DPYB 3EQAA 2WW1A 3MV01 1GHQA 3MWXA 1FO3A 4GTMB 1N7QA 2BRVX 2CISA 1O5MB 3CIHA 1NSVA 3MUZ1 1WU6A 2CIQA 2E22A 4LNBB 3OXUA 4LNVA 2PN5A 1O6HA 1DP0A 1FMIA 2XSGA 1N4SB 3VD4A 3KLSA 2QNOA 1MZCB 2D73A 1EGUA 5FO7B 1O1SB 1UT9A 3E1F1 1F9OA 1JS4A 3A3VA 3SDUA 4Q88A 3WVFA 2D5JA 2H6GB 2WY7A 3NJXA 3M7LA 2AFAA 1UMPA 3T0BA 2FUQA 3VD9A 3DECA 2WCOA 2VN4A 2ZXQA 1NS0A 1GAIA 3QSPA 1JCRB 1NSUA 1TF4A 1JZ7A 3EZ8A 1RWCA 1DL2A 3CU7A 4DODA 4AQ0A 1K1XA 2JKAA 3OEDA 3RX8A 3Q73B 1V7XA 3Q1NA 1JYVA 3E33B 2HTAA 4ZG8A 1CB8A 2ZIRB 4AYPA 2WW0A 3BGAA 4WVBA 3P2CA 4XUVA 3X17A 4TF4A 3J7HA 2WDAA 2HTBA 4KTPA 3D5SA 3QXFA 3W7XA 3WKHA 2ZBLA 1TN6B 3HXBB 3T0DA 3WKGA 3BLCA 3VDAA 1ULVA 1F9GA 4OK4A 1O1TB 1XWQA 3H3KA 1PX4A 2DRQA 2XWJB 3BS6A 1N7OA 1JZ4A 1SNZA 1KFGA 1L2AA 1NSSA 3I3BA 1NC5A 3TY1A 1HN1A 1KSDA 1XW2A 2V8KA 4BZGA 1SA4B 2BEDB 1H36A 1O1RB 1NSRA 4M76A 2FUZA 1SA5B 4DUVA 3OS7A 1RWHA 5CA3A 1H12A 1K1WA 3DCDA 1FP3A 2BRPA 1G87A 1O6RA 1IS9A 3T2QA 3SDVA 2GOXA 5DGQA 1PX3A 4DUXA 2B4FA 2V3NA 3DSTB 2I07B 1Z45A 3HXFB 5E1QA 2EACA 1NSXA 1JYNA 3Q79B 1JZ5A 4WU0A 4MU9A 1HMUA 4ONTA 1SQCA 3E37B 4NEIA 4KKJA 1I8QA 4FUSA 4D94A 2H6IB 2EABA 4BZEA 1N9AB 2H6FB 4BOKA 3S4CA 1TXKA 2EADA 2WYNA 1W3YA 3M7BA 1KWFA 1V7VA 1N7PA 3W7TA 1H54A 3IMHA 1LTXB 3VW5A 4BZHA 1HM3A 5JMDA 3PYAA 3GT5A 3SDQA 3OB8A 3KSLB 3VXDA 1FBOA 4J5TA 3ANIA 3A0OA 1DOGA 5GW7A 2R2LB 3WC3A 1J0NA 4MBGB 3PZ3B 1D8EB 3W5MA 4D4BA 2NVPA 1J0MA 1TNBB 3E7JA 5JPMB 1K1YA 1X1HA 1F4HA 1RW9A 2WIIB 1H3AA 1KRFA 3S4BA 3GZKA 3SQCA 3M75A 1H13A 2Q1FA 4CJ0A 5FO8B 2NOJA 3K7XA 3M7EA 5GY3A 3WFAA 1QSJA 3P5RA 1N4PB 5JMFA 1C82A 5E2JA 2BB6A 3E80A 2A8ZA 4AYOA 2JKEA 3RSYA 2B39A 3M78A 3Q7FB 3M7CA 1WU5A 1H37A 3H7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IA6 A;  2WW3 A;  3QWT A;  3WIR A;  3ECQ A;  4CJ1 A;  3VD3 A;  2DRR A;  1GLM A;  3QT3 A;  5A1A A;  1RWF A;  1L7J A;  1IA7 A;  1XWT A;  3TF4 A;  3MUY 1;  2E24 A;  3ACS A;  1MMX A;  1GAH A;  1F9D A;  3A24 A;  3QT9 A;  1V7W A;  3RX5 A;  1JYW A;  3RX7 A;  4DUW A;  1FBW A;  4WVA A;  3RRS A;  1AGM A;  3I3E A;  1JZ2 A;  3K11 A;  3T33 A;  1LF6 A;  1X1J A;  2JG0 A;  1MMZ A;  1KSC A;  2FV1 A;  2CQT A;  3T09 A;  1V5D A;  1OJM A;  3T0A A;  3T2P A;  1HCU A;  1YQ2 A;  1OJO A;  1YGA A;  4TTG A;  2CIR A;  1JZ6 A;  3QDE A;  2WVX B;  1X1I A;  3T08 A;  4WVC A;  2XHN A;  2AHF A;  4ZH5 A;  1AYX A;  2GZ6 A;  3VDC A;  4L0G A;  1NXC A;  1GA2 A;  2WVY A;  4AYR A;  2ZQ0 A;  1H14 A;  1JOV A;  2JJB A;  1OJP A;  3W5N A;  2OKX A;  2JF4 A;  3AFJ A;  3QRY A;  3REN A;  4DOE A;  3QG0 A;  3IAP A;  2WW2 A;  1G9G A;  2FBA A;  3E6U A;  1HN0 A;  1MN0 A;  4KTR A;  3NRE A;  1LF9 A;  3CZJ A;  5CZL A;  2WVX A;  1NS2 A;  5MEH A;  2WZS A;  1LOH A;  3WKF A;  3ACT A;  3VDB A;  2RGK A;  5DGR A;  1HMW A;  1NS7 A;  1FAE A;  3DYM A;  1F4A A;  4TXT A;  1FO2 A;  1CEM A;  3SEP A;  3QXQ A;  1F1S A;  3NJV A;  2WVZ A;  1V5C A;  5M7I A;  1RWG A;  3DYP A;  1RQ5 A;  2BRW A;  1SO0 A;  3QPF A;  3QFY A;  5M7Y A;  1HM2 A;  3K25 A;  4Q2B A;  1CLC A;  2YIK A;  5KKB A;  2RI9 A;  3T2O A;  3D3I A;  2Z07 A;  2JKP A;  4BZF A;  3GLY A;  1WZZ A;  1G6I A;  5CD2 A;  2D8L A;  3WIQ A;  1FCE A;  1NSZ A;  2X03 A;  1LUR A;  1MMU A;  4JJJ A;  3W7W A;  1OJN A;  2AHG A;  2VN7 A;  3MV1 1;  1KKT A;  3WKI A;  2CQS A;  3IAQ A;  1G9J A;  3S4D A;  4Z4J A;  1JZ3 A;  3PMM A;  1N7R A;  3W7U A;  4RNL A;  1UG9 A;  3WUX A;  3E73 A;  3DYO A;  2DRS A;  1JYX A;  4EL8 A;  3ANJ A;  3W7S A;  1KRE A;  1LXK A;  1WU4 A;  1NKG A;  1MMY A;  1K72 A;  2ZZR A;  3ON6 A;  1RWA A;  4CE7 A;  1L7K A;  2DRO A;  1X9D A;  1JZ8 A;  3S4A A;  4AYQ A;  3VD5 A;  3QFZ A;  2FV0 A;  4Z4L A;  4L6X A;  3I3D A;  3H2W A;  2GH4 A;  2F6D A;  2RI8 A;  2P0V A;  3VD7 A;  1N7N A;  1L1Y A;  3OBA A;  1KS8 A;  2XFG A;  1NS8 A;  2EAE A;  3ANK A;  1VD5 A;  3WIW A;  1LXM A;  1NSM A;  1NS4 A;  2WW1 A;  3EQA A;  3MV0 1;  3MWX A;  1FO3 A;  1N7Q A;  2BRV X;  2CIS A;  3CIH A;  1NSV A;  3MUZ 1;  1WU6 A;  2CIQ A;  2E22 A;  1DP0 A;  1FMI A;  2XSG A;  3VD4 A;  2QNO A;  2D73 A;  1EGU A;  1UT9 A;  3E1F 1;  1F9O A;  1JS4 A;  3A3V A;  4Q88 A;  2D5J A;  3NJX A;  2AFA A;  3T0B A;  3VD9 A;  3DEC A;  2WCO A;  2VN4 A;  2ZXQ A;  1NS0 A;  1GAI A;  3QSP A;  1NSU A;  1TF4 A;  1JZ7 A;  3EZ8 A;  1RWC A;  1DL2 A;  4DOD A;  4AQ0 A;  1K1X A;  2JKA A;  3RX8 A;  1V7X A;  3Q1N A;  1JYV A;  2HTA A;  4ZG8 A;  1CB8 A;  4AYP A;  2WW0 A;  3BGA A;  4WVB A;  3P2C A;  4XUV A;  3X17 A;  4TF4 A;  3J7H A;  2WDA A;  2HTB A;  4KTP A;  3QXF A;  3W7X A;  3WKH A;  2ZBL A;  3T0D A;  3WKG A;  3VDA A;  1ULV A;  1F9G A;  1XWQ A;  3H3K A;  1PX4 A;  2DRQ A;  1N7O A;  1JZ4 A;  1SNZ A;  1KFG A;  1L2A A;  1NSS A;  3I3B A;  1NC5 A;  1HN1 A;  1KSD A;  1XW2 A;  4BZG A;  1NSR A;  2FUZ A;  4DUV A;  3OS7 A;  1RWH A;  5CA3 A;  1H12 A;  1K1W A;  3DCD A;  1FP3 A;  2BRP A;  1G87 A;  1IS9 A;  3T2Q A;  5DGQ A;  1PX3 A;  4DUX A;  2B4F A;  1Z45 A;  5E1Q A;  2EAC A;  1NSX A;  1JYN A;  1JZ5 A;  4WU0 A;  1HMU A;  1I8Q A;  4FUS A;  2EAB A;  4BZE A;  3S4C A;  1TXK A;  2EAD A;  2WYN A;  1W3Y A;  1KWF A;  1V7V A;  1N7P A;  3W7T A;  1H54 A;  3IMH A;  3VW5 A;  4BZH A;  1HM3 A;  3GT5 A;  3OB8 A;  3VXD A;  1FBO A;  4J5T A;  3ANI A;  1DOG A;  5GW7 A;  1J0N A;  3WC3 A;  3W5M A;  2NVP A;  1J0M A;  1K1Y A;  1X1H A;  1F4H A;  1RW9 A;  1KRF A;  3S4B A;  3GZK A;  1H13 A;  2Q1F A;  4CJ0 A;  5GY3 A;  3WFA A;  1C82 A;  5E2J A;  2A8Z A;  4AYO A;  2JKE A;  3RSY A;  1WU5 A;  3H7L A; 
#chains in the Genus database with same CATH topology
 1LD7 B;  1IA6 A;  3DX0 A;  2WW3 A;  2V8J A;  3QWT A;  5DHI A;  3WIR A;  2G02 A;  3RJ3 A;  3DX4 A;  3ECQ A;  4CJ1 A;  3VD3 A;  2DRR A;  4BTW A;  1GLM A;  3QT3 A;  5A1A A;  5IK9 A;  1H3C A;  1RWF A;  1X81 B;  2XQW A;  1L7J A;  1IA7 A;  1XWT A;  3TF4 A;  2C10 A;  1TNZ B;  3MUY 1;  2E24 A;  3M00 A;  3ACS A;  1MMX A;  1GAH A;  2A73 B;  1F9D A;  3CZN A;  1TQS A;  3QT9 A;  2OOV C;  3A24 A;  1QWN A;  5IK6 A;  4EV5 A;  1V7W A;  4V1S A;  3RX5 A;  4KFD A;  3EU8 A;  1JYW A;  5FOB B;  2E2U A;  3D4Z A;  3RX7 A;  3X3X A;  1W2Z A;  1W6J A;  4EHM B;  4DUW A;  4L9P B;  1FBW A;  2OOV A;  1O6Q A;  4WVA A;  3RRS A;  2ZL8 A;  4MMI A;  1GSZ A;  1TN7 B;  3G4F A;  2WOF A;  1AGM A;  3X40 A;  3I3E A;  1JZ2 A;  3E32 B;  1AV4 A;  3K11 A;  4BOJ A;  3EJR A;  3BVU A;  1QWU A;  3T33 A;  3E34 B;  1LF6 A;  2H6H B;  1D6U A;  1X1J A;  2JG0 A;  1MMZ A;  1KSC A;  2FV1 A;  2CWU A;  4KKI A;  4LIX A;  3E30 B;  2CQT A;  1C3D A;  1EKM A;  4ZRP A;  1W5Z A;  3T09 A;  4ZH1 A;  1HZF A;  1V5D A;  3N0G A;  1OJM A;  1W4N A;  3T0A A;  1IVW A;  1QX1 A;  1HXC A;  3T2P A;  1HCU A;  1N20 A;  1YQ2 A;  1OJO A;  1YGA A;  3Q7A B;  5EAS A;  4TTG A;  1N1B A;  2CIR A;  3KQ4 A;  1JZ6 A;  1S64 B;  3QDE A;  2WVX B;  1X1I A;  3KSQ B;  3M73 A;  4FNR A;  3T08 A;  4WVC A;  3BUB A;  5IKA A;  2XHN A;  2AHF A;  4FNV A;  4ZH5 A;  1QAK A;  1TN8 B;  1AYX A;  1DCE B;  2GZ6 A;  3VDC A;  4L0G A;  5IL3 A;  1NXC A;  1IU7 A;  1GA2 A;  5ILY A;  2WVY A;  4FNT A;  4AYR A;  3DRA B;  2ZQ0 A;  1H14 A;  1JOV A;  2XWB B;  2JJB A;  1O79 A;  3PZ4 B;  5IM1 A;  1QAL A;  1OJP A;  3HII A;  1N21 A;  3W5N A;  2OKX A;  2JF4 A;  3AFJ A;  3QRY A;  3REN A;  4DOE A;  3QG0 A;  3IAP A;  1HTY A;  2WW2 A;  1G9G A;  2FBA A;  2PMV A;  2WY8 A;  1O7D D;  4FXG B;  3DSW B;  1HN0 A;  3E6U A;  4QT9 A;  3HXE B;  1MN0 A;  3DSV B;  4KTR A;  3NRE A;  1LF9 A;  1W6K A;  5ILK A;  4EV2 A;  3CZJ A;  2W0Q A;  5CZL A;  2E2V A;  1TNO B;  1JCS B;  2J5C A;  4GL3 A;  2V3P A;  2WVX A;  1NS2 A;  1R34 A;  4KFF A;  5EAT A;  5MEH A;  2WZS A;  1TQV A;  1LOH A;  3WKF A;  1FT2 B;  3ACT A;  3VDB A;  2RGK A;  4UFC A;  5DGR A;  4DI5 A;  1HMW A;  1N24 A;  1NS7 A;  4MMH A;  3M72 A;  1FAE A;  1JCQ B;  1WMN A;  3DYM A;  1F4A A;  2WIN B;  1FO2 A;  4TXT A;  1CEM A;  3M02 A;  1H39 A;  3QXQ A;  3SEP A;  4GTO B;  3X3Z A;  1F1S A;  3LOY A;  1HXA A;  1QAZ A;  4YDO B;  3NJV A;  4D4A A;  2WVZ A;  1V5C A;  5M7I A;  1KZP B;  1RWG A;  3N0F A;  4E1Y A;  2CG1 A;  1N4R B;  1LD8 B;  3DYP A;  1RQ5 A;  3M77 A;  3PYB A;  2BRW A;  1SO0 A;  3CV5 A;  3QPF A;  3QFY A;  2YFO A;  1RKY A;  3Q78 B;  5M7Y A;  1HM2 A;  4FXK B;  2OW6 A;  3K25 A;  4Q2B A;  3M71 A;  1CLC A;  2YIK A;  2G0D A;  4LNG B;  5KKB A;  2IEJ B;  1LVN A;  1OAC A;  3HXD B;  3D50 A;  2RI9 A;  1N9E A;  3WA2 X;  3T2O A;  2Y73 A;  4OJZ A;  3LVT A;  3D3I A;  2Z07 A;  3M74 A;  3SFY B;  1FPP B;  2JKP A;  3C72 B;  4BZF A;  1PS3 A;  3MI6 A;  3GLY A;  2XN2 A;  2V8I A;  1G6I A;  1WZZ A;  5CD2 A;  2D8L A;  2CG0 A;  3WIQ A;  2CWT A;  3CZS A;  1TNY B;  1WMO A;  1FCE A;  1TNU B;  1NSZ A;  2X03 A;  1LUR A;  1MMU A;  4JJJ A;  3W7W A;  1SII A;  3M76 A;  1OJN A;  2AHG A;  2VN7 A;  1W7C A;  4GTR B;  2RDY A;  2FUT A;  1QBQ B;  3VSN A;  3EUV B;  4ZRQ A;  4GTS B;  3MV1 1;  1KKT A;  3WKI A;  4OZV A;  2CQS A;  3Q75 B;  3EJQ A;  4GTP B;  3IAQ A;  1G9J A;  1RJO A;  2PNC A;  1QQF A;  3S4D A;  4YCR A;  3PZ1 B;  4FJQ A;  4Z4J A;  1JZ3 A;  3SDR A;  1NL4 B;  3VSM A;  4GAX A;  3PMM A;  3X41 A;  4OK2 A;  1N7R A;  3W7U A;  3DX2 A;  4RNL A;  1UG9 A;  3SAE A;  2BBC A;  3WUX A;  3E73 A;  4C1S A;  3SFX B;  3DYO A;  2DRS A;  1JYX A;  4GTQ B;  4EL8 A;  1GXN A;  3ANJ A;  3DSU B;  1N94 B;  1JRQ A;  3W7S A;  1KRE A;  1LXK A;  1WU4 A;  3HXC B;  3KN4 A;  3PGB A;  5JPN B;  1NKG A;  1MMY A;  1K72 A;  2ZZR A;  4D4C A;  4GTT B;  3ON6 A;  1RWA A;  2CFL A;  4CE7 A;  1L7K A;  5FO9 B;  5DHK A;  2BB5 A;  1US1 A;  1H3B A;  2F7Q A;  2DRO A;  1X9D A;  3NBB A;  1JZ8 A;  4YDE B;  1GXO A;  3D4Y A;  2ZIS B;  3S4A A;  4AYQ A;  3G4D A;  1FT1 B;  1HV6 A;  3QFZ A;  3VD5 A;  1UI7 A;  5IK0 A;  1N95 B;  5IKH A;  2FV0 A;  1R76 A;  2ONG A;  1N4Q B;  3NFV A;  2F7R A;  2XN1 A;  3D5R A;  4V1R A;  4Z4L A;  4L6X A;  2CFD A;  2FYV A;  3AFL A;  1NI1 B;  4F13 A;  3SDT A;  3I3D A;  3H2W A;  3P5P A;  4GTV B;  1KZO B;  3EU5 B;  2GH4 A;  2F6D A;  2RI8 A;  2YFN A;  2P0V A;  3VD7 A;  1N7N A;  1S63 B;  1IVU A;  1L1Y A;  3BUI A;  3OBA A;  4D4D A;  1KS8 A;  3MPH A;  1HWW A;  5EAU A;  3BUD A;  3BUP A;  2XFG A;  5GZK A;  1NS8 A;  3S9V A;  2WYH A;  2EAE A;  3ANK A;  1GXM A;  1VD5 A;  3DSX B;  1D8D B;  3PZ2 B;  1H35 A;  5AGD A;  3G6J B;  1LXM A;  3DSS B;  3WIW A;  2F0Y B;  1NSM A;  2OW7 A;  2WGQ A;  1NS4 A;  2F18 A;  4KFE A;  2SQC A;  3DPY B;  3EQA A;  4OZW A;  2WW1 A;  2YX9 A;  3MV0 1;  1GHQ A;  3MWX A;  1FO3 A;  1N7Q A;  2BRV X;  4GTM B;  3D51 A;  2CIS A;  3ALA A;  1IVV A;  1O5M B;  3CIH A;  2WOH A;  1NSV A;  3MUZ 1;  1WU6 A;  1HX9 A;  2CIQ A;  2E22 A;  4LNB B;  3OXU A;  4LNV A;  3BUQ A;  2PN5 A;  1O6H A;  1DP0 A;  1FMI A;  2XSG A;  1N4S B;  3VD4 A;  2ALW A;  3KLS A;  2QNO A;  1MZC B;  2D73 A;  1EGU A;  5FO7 B;  1AVK A;  1O1S B;  1UT9 A;  3BLB A;  3E1F 1;  1F9O A;  1JS4 A;  3A3V A;  3SDU A;  1TQT A;  4Q88 A;  2OQE C;  3WVF A;  2D5J A;  2H6G B;  1PU4 A;  2WY7 A;  3NJX A;  2XN0 A;  3M7L A;  2AFA A;  1UMP A;  3T0B A;  2FUQ A;  4K3A A;  3VD9 A;  3DEC A;  2WCO A;  2VN4 A;  2OQE A;  2ZXQ A;  1NS0 A;  2C11 A;  1GAI A;  1SIH A;  3QSP A;  1W6C A;  1JCR B;  1NSU A;  1TF4 A;  1AVL A;  2F7O A;  1JZ7 A;  3EZ8 A;  1RWC A;  1R33 A;  1DL2 A;  3CU7 A;  4DOD A;  4AQ0 A;  1K1X A;  2JKA A;  3EJP A;  3OED A;  3RX8 A;  3Q73 B;  1V7X A;  1TU5 A;  3BVX A;  3Q1N A;  1JYV A;  3E33 B;  4FNQ A;  2F1A A;  2E2T A;  3T0U A;  2HTA A;  4ZG8 A;  1CB8 A;  3D52 A;  2ZIR B;  3LZ9 A;  4AYP A;  1QAF A;  1WMP A;  2CWV A;  2WW0 A;  3BGA A;  1IVX A;  1HXG A;  4WVB A;  3P2C A;  4XUV A;  3X17 A;  4TF4 A;  3J7H A;  1KSI A;  2WDA A;  4FNP A;  2HTB A;  4KTP A;  3D5S A;  3QXF A;  3W7X A;  2F1B A;  3WKH A;  5ILZ A;  2ZBL A;  1TN6 B;  3HXB B;  3T0D A;  3WKG A;  3BLC A;  3VDA A;  1ULV A;  1F9G A;  4OK4 A;  1IQX A;  1O1T B;  1XWQ A;  3H3K A;  2CFW A;  3NBJ A;  1PX4 A;  2DRQ A;  2XWJ B;  3AMO B;  3BS6 A;  1N7O A;  1JZ4 A;  1SNZ A;  1KFG A;  2D1W A;  1N1Z A;  1L2A A;  1NSS A;  3I3B A;  1NC5 A;  3TY1 A;  1HN1 A;  1KSD A;  1XW2 A;  2V8K A;  5ILJ A;  4BZG A;  1W6G A;  2Y74 A;  4BTY A;  1SA4 B;  3BVT A;  2BED B;  3HIG A;  2BT3 A;  1H36 A;  1O1R B;  1NSR A;  4M76 A;  2FUZ A;  1SA5 B;  4DUV A;  3OS7 A;  1RWH A;  5IL8 A;  3DDF A;  2CFG A;  5CA3 A;  1H12 A;  1K1W A;  3DCD A;  3SXX A;  1FP3 A;  2BRP A;  1TQU A;  1G87 A;  1O6R A;  1IS9 A;  3T2Q A;  3SDV A;  2GOX A;  5DGQ A;  3X3Y A;  1PX3 A;  3X42 A;  4DUX A;  2B4F A;  2V3N A;  3DST B;  2I07 B;  1Z45 A;  3HXF B;  5E1Q A;  2EAC A;  4BTX A;  5ILH A;  1NSX A;  3BVW A;  1JYN A;  3Q79 B;  1JZ5 A;  4WU0 A;  4MU9 A;  3K5T A;  1HMU A;  4ONT A;  3KII A;  1SQC A;  4F10 A;  3E37 B;  4NEI A;  3AMO A;  1I8Q A;  4KKJ A;  3SX1 A;  4FUS A;  4D94 A;  2H6I B;  2EAB A;  1DYU A;  4BZE A;  1N9A B;  2H6F B;  4BOK A;  3S4C A;  1TXK A;  2EAD A;  1TQW A;  1W3Y A;  2WYN A;  2WYI A;  3M7B A;  3DX1 A;  1KWF A;  1V7V A;  4FNS A;  1N7P A;  3W7T A;  5C05 A;  1H54 A;  3IMH A;  3HI7 A;  3N9H A;  1LTX B;  1HXK A;  3EJU A;  3VW5 A;  1D6Z A;  2WO0 A;  4BZH A;  1HM3 A;  5JMD A;  3PYA A;  3GT5 A;  3SDQ A;  2F7P A;  1IQY A;  3OB8 A;  3KSL B;  3VXD A;  1FBO A;  5ILI A;  4J5T A;  3A0O A;  3ANI A;  1DOG A;  1A2V A;  5GW7 A;  1J0N A;  2R2L B;  3WC3 A;  1N23 A;  4MBG B;  3PZ3 B;  1D8E B;  3W5M A;  4D4B A;  2NVP A;  1J0M A;  1TNB B;  3E7J A;  5JPM B;  1K1Y A;  1X1H A;  2CFK A;  1F4H A;  3BVV A;  1RW9 A;  2WII B;  1H3A A;  5KBP A;  1SPU A;  4K35 A;  2ONH A;  3DDG A;  1KRF A;  3NNB A;  1UI8 A;  3S4B A;  3GZK A;  3SQC A;  3M75 A;  1H13 A;  2Q1F A;  4CJ0 A;  1N22 A;  5FO8 B;  2NOJ A;  5ILD A;  3K7X A;  3M7E A;  5GY3 A;  1D6Y A;  3DX3 A;  3WFA A;  1QSJ A;  3P5R A;  1N4P B;  5JMF A;  1C82 A;  5E2J A;  3WA3 A;  2BB6 A;  3E80 A;  2A8Z A;  3M01 A;  4AYO A;  2JKE A;  4RNQ A;  3RSY A;  2B39 A;  3EJT A;  3M78 A;  3Q7F B;  3EJS A;  4FNU A;  3M7C A;  1WU5 A;  1H37 A;  3H7L A; 
#chains in the Genus database with same CATH homology
 1LD7 B;  1IA6 A;  2WW3 A;  2V8J A;  3QWT A;  3WIR A;  2G02 A;  3RJ3 A;  3ECQ A;  4CJ1 A;  3VD3 A;  2DRR A;  1GLM A;  3QT3 A;  5A1A A;  1H3C A;  2XQW A;  1X81 B;  1RWF A;  1L7J A;  1IA7 A;  1XWT A;  3TF4 A;  3MUY 1;  1TNZ B;  2E24 A;  3ACS A;  1MMX A;  1GAH A;  2A73 B;  1F9D A;  3A24 A;  3QT9 A;  1V7W A;  4V1S A;  3RX5 A;  3EU8 A;  1JYW A;  5FOB B;  3RX7 A;  1W6J A;  4EHM B;  4DUW A;  4L9P B;  1FBW A;  1O6Q A;  4WVA A;  3RRS A;  4MMI A;  1GSZ A;  1TN7 B;  1AGM A;  3I3E A;  1JZ2 A;  3E32 B;  3K11 A;  4BOJ A;  3T33 A;  3E34 B;  1LF6 A;  2H6H B;  1X1J A;  2JG0 A;  1MMZ A;  1KSC A;  2FV1 A;  4KKI A;  4LIX A;  3E30 B;  2CQT A;  1C3D A;  4ZRP A;  3T09 A;  4ZH1 A;  1HZF A;  1V5D A;  1OJM A;  3T0A A;  3T2P A;  1HCU A;  1YQ2 A;  1OJO A;  1YGA A;  3Q7A B;  4TTG A;  2CIR A;  3KQ4 A;  1JZ6 A;  1S64 B;  3QDE A;  2WVX B;  3KSQ B;  3M73 A;  1X1I A;  3T08 A;  4WVC A;  2XHN A;  2AHF A;  4FNV A;  4ZH5 A;  1TN8 B;  1AYX A;  1DCE B;  2GZ6 A;  3VDC A;  4L0G A;  1NXC A;  1GA2 A;  2WVY A;  4AYR A;  3DRA B;  2ZQ0 A;  1H14 A;  1JOV A;  2XWB B;  2JJB A;  1O79 A;  3PZ4 B;  1OJP A;  3W5N A;  2OKX A;  2JF4 A;  3AFJ A;  3QRY A;  3REN A;  4DOE A;  3QG0 A;  3IAP A;  2WW2 A;  1G9G A;  2FBA A;  2PMV A;  2WY8 A;  4FXG B;  3DSW B;  3E6U A;  1HN0 A;  4QT9 A;  3HXE B;  1MN0 A;  3DSV B;  4KTR A;  3NRE A;  1LF9 A;  1W6K A;  3CZJ A;  5CZL A;  1TNO B;  1JCS B;  4GL3 A;  2V3P A;  2WVX A;  1NS2 A;  5MEH A;  2WZS A;  1LOH A;  3WKF A;  1FT2 B;  3ACT A;  3VDB A;  2RGK A;  5DGR A;  1HMW A;  1NS7 A;  4MMH A;  3M72 A;  1FAE A;  1JCQ B;  3DYM A;  1F4A A;  2WIN B;  1FO2 A;  4TXT A;  1CEM A;  1H39 A;  3QXQ A;  3SEP A;  4GTO B;  1F1S A;  4YDO B;  3NJV A;  4D4A A;  2WVZ A;  1V5C A;  5M7I A;  1KZP B;  1RWG A;  1N4R B;  1LD8 B;  3DYP A;  1RQ5 A;  3M77 A;  3PYB A;  2BRW A;  1SO0 A;  3QPF A;  3QFY A;  3Q78 B;  5M7Y A;  4FXK B;  1HM2 A;  3K25 A;  4Q2B A;  3M71 A;  1CLC A;  2YIK A;  2G0D A;  4LNG B;  5KKB A;  2IEJ B;  3HXD B;  2RI9 A;  3T2O A;  4OJZ A;  3D3I A;  2Z07 A;  3M74 A;  3SFY B;  1FPP B;  2JKP A;  3C72 B;  4BZF A;  3GLY A;  2V8I A;  1G6I A;  1WZZ A;  5CD2 A;  2D8L A;  3WIQ A;  1TNY B;  1FCE A;  1TNU B;  1NSZ A;  2X03 A;  1LUR A;  1MMU A;  4JJJ A;  3W7W A;  3M76 A;  1OJN A;  2AHG A;  2VN7 A;  4GTR B;  2FUT A;  1QBQ B;  3VSN A;  3EUV B;  4ZRQ A;  4GTS B;  3MV1 1;  1KKT A;  3WKI A;  2CQS A;  3Q75 B;  4GTP B;  3IAQ A;  1G9J A;  1QQF A;  3S4D A;  4YCR A;  3PZ1 B;  4Z4J A;  1JZ3 A;  3SDR A;  1NL4 B;  3VSM A;  3PMM A;  4OK2 A;  1N7R A;  3W7U A;  4RNL A;  1UG9 A;  3SAE A;  2BBC A;  3WUX A;  3E73 A;  4C1S A;  3SFX B;  3DYO A;  2DRS A;  1JYX A;  4GTQ B;  4EL8 A;  1GXN A;  3ANJ A;  3DSU B;  1N94 B;  3W7S A;  1KRE A;  1LXK A;  1WU4 A;  3HXC B;  5JPN B;  1NKG A;  1MMY A;  1K72 A;  2ZZR A;  4D4C A;  4GTT B;  3ON6 A;  1RWA A;  4CE7 A;  1L7K A;  5FO9 B;  2BB5 A;  1H3B A;  2DRO A;  1X9D A;  1JZ8 A;  4YDE B;  1GXO A;  2ZIS B;  3S4A A;  4AYQ A;  3VD5 A;  1FT1 B;  3QFZ A;  1N95 B;  2FV0 A;  1R76 A;  1N4Q B;  3D5R A;  4V1R A;  4Z4L A;  4L6X A;  3AFL A;  1NI1 B;  3SDT A;  3I3D A;  3H2W A;  3P5P A;  4GTV B;  1KZO B;  3EU5 B;  2GH4 A;  2F6D A;  2RI8 A;  2P0V A;  3VD7 A;  1N7N A;  1S63 B;  1L1Y A;  3OBA A;  4D4D A;  1KS8 A;  2XFG A;  5GZK A;  1NS8 A;  3S9V A;  2EAE A;  3ANK A;  1GXM A;  1VD5 A;  3DSX B;  1D8D B;  3PZ2 B;  1H35 A;  5AGD A;  3G6J B;  3DSS B;  3WIW A;  1LXM A;  2F0Y B;  1NSM A;  1NS4 A;  2SQC A;  3DPY B;  3EQA A;  2WW1 A;  3MV0 1;  1GHQ A;  3MWX A;  1FO3 A;  4GTM B;  1N7Q A;  2BRV X;  2CIS A;  1O5M B;  3CIH A;  1NSV A;  3MUZ 1;  1WU6 A;  2CIQ A;  2E22 A;  4LNB B;  3OXU A;  4LNV A;  2PN5 A;  1O6H A;  1DP0 A;  1FMI A;  2XSG A;  1N4S B;  3VD4 A;  3KLS A;  2QNO A;  1MZC B;  2D73 A;  1EGU A;  5FO7 B;  1O1S B;  1UT9 A;  3E1F 1;  1F9O A;  1JS4 A;  3A3V A;  3SDU A;  4Q88 A;  3WVF A;  2D5J A;  2H6G B;  2WY7 A;  3NJX A;  3M7L A;  2AFA A;  1UMP A;  3T0B A;  2FUQ A;  3VD9 A;  3DEC A;  2WCO A;  2VN4 A;  2ZXQ A;  1NS0 A;  1GAI A;  3QSP A;  1JCR B;  1NSU A;  1TF4 A;  1JZ7 A;  3EZ8 A;  1RWC A;  1DL2 A;  3CU7 A;  4DOD A;  4AQ0 A;  1K1X A;  2JKA A;  3OED A;  3RX8 A;  3Q73 B;  1V7X A;  3Q1N A;  1JYV A;  3E33 B;  2HTA A;  4ZG8 A;  1CB8 A;  2ZIR B;  4AYP A;  2WW0 A;  3BGA A;  4WVB A;  3P2C A;  4XUV A;  3X17 A;  4TF4 A;  3J7H A;  2WDA A;  2HTB A;  4KTP A;  3D5S A;  3QXF A;  3W7X A;  3WKH A;  2ZBL A;  1TN6 B;  3HXB B;  3T0D A;  3WKG A;  3BLC A;  3VDA A;  1ULV A;  1F9G A;  4OK4 A;  1O1T B;  1XWQ A;  3H3K A;  1PX4 A;  2DRQ A;  2XWJ B;  3BS6 A;  1N7O A;  1JZ4 A;  1SNZ A;  1KFG A;  1L2A A;  1NSS A;  3I3B A;  1NC5 A;  3TY1 A;  1HN1 A;  1KSD A;  1XW2 A;  2V8K A;  4BZG A;  1SA4 B;  2BED B;  1H36 A;  1O1R B;  1NSR A;  4M76 A;  2FUZ A;  1SA5 B;  4DUV A;  3OS7 A;  1RWH A;  5CA3 A;  1H12 A;  1K1W A;  3DCD A;  1FP3 A;  2BRP A;  1G87 A;  1O6R A;  1IS9 A;  3T2Q A;  3SDV A;  2GOX A;  5DGQ A;  1PX3 A;  4DUX A;  2B4F A;  2V3N A;  3DST B;  2I07 B;  1Z45 A;  3HXF B;  5E1Q A;  2EAC A;  1NSX A;  1JYN A;  3Q79 B;  1JZ5 A;  4WU0 A;  4MU9 A;  1HMU A;  4ONT A;  1SQC A;  3E37 B;  4NEI A;  4KKJ A;  1I8Q A;  4FUS A;  4D94 A;  2H6I B;  2EAB A;  4BZE A;  1N9A B;  2H6F B;  4BOK A;  3S4C A;  1TXK A;  2EAD A;  2WYN A;  1W3Y A;  3M7B A;  1KWF A;  1V7V A;  1N7P A;  3W7T A;  1H54 A;  3IMH A;  1LTX B;  3VW5 A;  4BZH A;  1HM3 A;  5JMD A;  3PYA A;  3GT5 A;  3SDQ A;  3OB8 A;  3KSL B;  3VXD A;  1FBO A;  4J5T A;  3ANI A;  3A0O A;  1DOG A;  5GW7 A;  2R2L B;  3WC3 A;  1J0N A;  4MBG B;  3PZ3 B;  1D8E B;  3W5M A;  4D4B A;  2NVP A;  1J0M A;  1TNB B;  3E7J A;  5JPM B;  1K1Y A;  1X1H A;  1F4H A;  1RW9 A;  2WII B;  1H3A A;  1KRF A;  3S4B A;  3GZK A;  3SQC A;  3M75 A;  1H13 A;  2Q1F A;  4CJ0 A;  5FO8 B;  2NOJ A;  3K7X A;  3M7E A;  5GY3 A;  3WFA A;  1QSJ A;  3P5R A;  1N4P B;  5JMF A;  1C82 A;  5E2J A;  2BB6 A;  3E80 A;  2A8Z A;  4AYO A;  2JKE A;  3RSY A;  2B39 A;  3M78 A;  3Q7F B;  3M7C A;  1WU5 A;  1H37 A;  3H7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...