1M1KM

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1m1kM02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1m1kM01
3G4SL 1VQ8L 1K9MM 1Q81P 3CCML 1VQ6L 3CCVL 3I55O 1Q86M 1Q7YM 1YJ9O 3G4SO 1VQ8O 1K73M 1K8AM 1KD1M 2QEXL 1QVGN 3G71L 3CCMO 1VQ6O 3CCVO 1KC8M 1VQKL 1M1KP 2QEXO 3CPWK 3G71O 1VQ5L 3CCRL 1YIJL 1YJWL 1NJIP 3CD6L 3G6EL 1VQKO 1VQNL 1N8RM 1M90M 1VQ5O 1YHQL 3CCRO 1YIJO 1YJWO 1JJ2N 3CD6O 3G6EO 3CC7L 1QVFK 1VQNO 3OW2N 1YHQO 2QA4L 1VQPL 1S72L 1VQOO 3CC7O 1Q81M 2OTJL 3CCQL 1QVGK 1VQLL 2QA4O 3CCSO 1VQPO 1VQ7L 1Q82P 1S72O 1KQSK 1K9MP 2OTJO 3CXCK 3I56L 3CCQO 1VQLO 1W2BK 1Q86P 1VQ7O 1VQOL 1Q7YP 1VQ4L 3CCLL 1M1KM 3CC4L 1K73P 3CCEL 1K8AP 1KD1P 3I56O 3CCJL 3CCSL 3CC2L 1NJIM 3CCUL 1KC8P 1QVFN 3CC4O 1VQ4O 3CCLO 3CCEO 2OTLL 1JJ2K 1VQ9L 3CCJO 1YJNL 3CC2O 3OW2K 3CCUO 1YITL 3CPWN 1YI2L 2OTLO 3CMAL 1VQML 1N8RP 1M90P 1VQ9O 3CMEL 1YJNO 1YITO 1KQSN 3CXCN 1YI2O 3CMAO 1VQMO 3CMEO 1W2BN 3I55L 1Q82M 1YJ9L
chains in the Genus database with same CATH superfamily
3G4SL 1VQ8L 1K9MM 1Q81P 3CCML 1VQ6L 3CCVL 4XTKA 3I55O 1Q86M 1Q7YM 1YJ9O 3G4SO 1VQ8O 1K73M 1K8AM 1KD1M 2QEXL 1QVGN 3G71L 3CCMO 1VQ6O 3CCVO 1KC8M 1VQKL 1M1KP 2QEXO 3CPWK 3G71O 1VQ5L 3CCRL 5DLJA 1YIJL 1YJWL 1NJIP 3CD6L 3G6EL 1VQKO 1VQNL 1N8RM 1M90M 1VQ5O 1YHQL 3CCRO 1YIJO 1YJWO 1JJ2N 3CD6O 3G6EO 3CC7L 1QVFK 1VQNO 3OW2N 5DS4A 1YHQO 2QA4L 1VQPL 1S72L 1VQOO 3CC7O 1Q81M 2OTJL 5DQTA 3CCQL 1QVGK 1VQLL 2QA4O 3CCSO 1VQPO 1VQ7L 4P6IC 5DS5A 1Q82P 1S72O 5DS6A 1KQSK 1K9MP 2OTJO 3I56L 3CXCK 5FCLA 3CCQO 5DQZA 1VQLO 1W2BK 1Q86P 1VQ7O 1VQOL 1Q7YP 1VQ4L 3CCLL 1M1KM 2YZSA 3CC4L 1K73P 3CCEL 1K8AP 1KD1P 3I56O 3CCJL 3CCSL 3CC2L 1NJIM 4N06A 3CCUL 1KC8P 1QVFN 3CC4O 1VQ4O 3CCLO 3CCEO 2OTLL 1JJ2K 3GODA 1VQ9L 4W8KA 3CCJO 3NKDA 1YJNL 3CC2O 3OW2K 3CCUO 1YITL 3CPWN 4WJ0A 1YI2L 2OTLO 3CMAL 1VQML 1N8RP 1M90P 1VQ9O 3CMEL 1YJNO 1YITO 1KQSN 3CXCN 1YI2O 4QDLA 3CMAO 1VQMO 3CMEO 1W2BN 3I55L 1Q82M 1YJ9L
chains in the Genus database with same CATH topology
3G4SL 1VQ8L 1K9MM 1Q81P 3CCML 1VQ6L 3CCVL 4XTKA 3I55O 1Q86M 1Q7YM 1YJ9O 3G4SO 1VQ8O 1K73M 1K8AM 1KD1M 2QEXL 1QVGN 3G71L 3CCMO 1VQ6O 3CCVO 1KC8M 1VQKL 1M1KP 2QEXO 3CPWK 3G71O 1VQ5L 3CCRL 5DLJA 1YIJL 1YJWL 1NJIP 3CD6L 3G6EL 1VQKO 1VQNL 1N8RM 1M90M 1VQ5O 1YHQL 3CCRO 1YIJO 1YJWO 1JJ2N 3CD6O 3G6EO 3CC7L 1QVFK 1VQNO 3OW2N 5DS4A 1YHQO 2QA4L 1VQPL 1S72L 1VQOO 3CC7O 1Q81M 2OTJL 5DQTA 3CCQL 1QVGK 1VQLL 2QA4O 3CCSO 1VQPO 1VQ7L 4P6IC 5DS5A 1Q82P 1S72O 5DS6A 1KQSK 1K9MP 2OTJO 3I56L 3CXCK 5FCLA 3CCQO 5DQZA 1VQLO 1W2BK 1Q86P 1VQ7O 1VQOL 1Q7YP 1VQ4L 3CCLL 1M1KM 2YZSA 3CC4L 1K73P 3CCEL 1K8AP 1KD1P 3I56O 3CCJL 3CCSL 3CC2L 1NJIM 4N06A 3CCUL 1KC8P 1QVFN 3CC4O 1VQ4O 3CCLO 3CCEO 2OTLL 1JJ2K 3GODA 1VQ9L 4W8KA 3CCJO 3NKDA 1YJNL 3CC2O 3OW2K 3CCUO 1YITL 3CPWN 4WJ0A 1YI2L 2OTLO 3CMAL 1VQML 1N8RP 1M90P 1VQ9O 3CMEL 1YJNO 1YITO 1KQSN 3CXCN 1YI2O 4QDLA 3CMAO 1VQMO 3CMEO 1W2BN 3I55L 1Q82M 1YJ9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S L;  1VQ8 L;  1K9M M;  1Q81 P;  3CCM L;  1VQ6 L;  3CCV L;  3I55 O;  1Q86 M;  1Q7Y M;  1YJ9 O;  3G4S O;  1VQ8 O;  1K73 M;  1K8A M;  1KD1 M;  2QEX L;  1QVG N;  3G71 L;  3CCM O;  1VQ6 O;  3CCV O;  1KC8 M;  1VQK L;  1M1K P;  2QEX O;  3CPW K;  3G71 O;  1VQ5 L;  3CCR L;  1YIJ L;  1YJW L;  1NJI P;  3CD6 L;  3G6E L;  1VQK O;  1VQN L;  1N8R M;  1M90 M;  1VQ5 O;  1YHQ L;  3CCR O;  1YIJ O;  1YJW O;  1JJ2 N;  3CD6 O;  3G6E O;  3CC7 L;  1QVF K;  1VQN O;  3OW2 N;  1YHQ O;  2QA4 L;  1VQP L;  1S72 L;  1VQO O;  3CC7 O;  1Q81 M;  2OTJ L;  3CCQ L;  1QVG K;  1VQL L;  2QA4 O;  3CCS O;  1VQP O;  1VQ7 L;  1Q82 P;  1S72 O;  1KQS K;  1K9M P;  2OTJ O;  3CXC K;  3I56 L;  3CCQ O;  1VQL O;  1W2B K;  1Q86 P;  1VQ7 O;  1VQO L;  1Q7Y P;  1VQ4 L;  3CCL L;  1M1K M;  3CC4 L;  1K73 P;  3CCE L;  1K8A P;  1KD1 P;  3I56 O;  3CCJ L;  3CCS L;  3CC2 L;  1NJI M;  3CCU L;  1KC8 P;  1QVF N;  3CC4 O;  1VQ4 O;  3CCL O;  3CCE O;  2OTL L;  1JJ2 K;  1VQ9 L;  3CCJ O;  1YJN L;  3CC2 O;  3OW2 K;  3CCU O;  1YIT L;  3CPW N;  1YI2 L;  2OTL O;  3CMA L;  1VQM L;  1N8R P;  1M90 P;  1VQ9 O;  3CME L;  1YJN O;  1YIT O;  1KQS N;  3CXC N;  1YI2 O;  3CMA O;  1VQM O;  3CME O;  1W2B N;  3I55 L;  1Q82 M;  1YJ9 L; 
#chains in the Genus database with same CATH topology
 3G4S L;  1VQ8 L;  1K9M M;  1Q81 P;  3CCM L;  1VQ6 L;  3CCV L;  4XTK A;  3I55 O;  1Q86 M;  1Q7Y M;  1YJ9 O;  3G4S O;  1VQ8 O;  1K73 M;  1K8A M;  1KD1 M;  2QEX L;  1QVG N;  3G71 L;  3CCM O;  1VQ6 O;  3CCV O;  1KC8 M;  1VQK L;  1M1K P;  2QEX O;  3CPW K;  3G71 O;  1VQ5 L;  3CCR L;  5DLJ A;  1YIJ L;  1YJW L;  1NJI P;  3CD6 L;  3G6E L;  1VQK O;  1VQN L;  1N8R M;  1M90 M;  1VQ5 O;  1YHQ L;  3CCR O;  1YIJ O;  1YJW O;  1JJ2 N;  3CD6 O;  3G6E O;  3CC7 L;  1QVF K;  1VQN O;  3OW2 N;  5DS4 A;  1YHQ O;  2QA4 L;  1VQP L;  1S72 L;  1VQO O;  3CC7 O;  1Q81 M;  2OTJ L;  5DQT A;  3CCQ L;  1QVG K;  1VQL L;  2QA4 O;  3CCS O;  1VQP O;  1VQ7 L;  4P6I C;  5DS5 A;  1Q82 P;  1S72 O;  5DS6 A;  1KQS K;  1K9M P;  2OTJ O;  3I56 L;  3CXC K;  5FCL A;  3CCQ O;  5DQZ A;  1VQL O;  1W2B K;  1Q86 P;  1VQ7 O;  1VQO L;  1Q7Y P;  1VQ4 L;  3CCL L;  1M1K M;  2YZS A;  3CC4 L;  1K73 P;  3CCE L;  1K8A P;  1KD1 P;  3I56 O;  3CCJ L;  3CCS L;  3CC2 L;  1NJI M;  4N06 A;  3CCU L;  1KC8 P;  1QVF N;  3CC4 O;  1VQ4 O;  3CCL O;  3CCE O;  2OTL L;  1JJ2 K;  3GOD A;  1VQ9 L;  4W8K A;  3CCJ O;  3NKD A;  1YJN L;  3CC2 O;  3OW2 K;  3CCU O;  1YIT L;  3CPW N;  4WJ0 A;  1YI2 L;  2OTL O;  3CMA L;  1VQM L;  1N8R P;  1M90 P;  1VQ9 O;  3CME L;  1YJN O;  1YIT O;  1KQS N;  3CXC N;  1YI2 O;  4QDL A;  3CMA O;  1VQM O;  3CME O;  1W2B N;  3I55 L;  1Q82 M;  1YJ9 L; 
#chains in the Genus database with same CATH homology
 3G4S L;  1VQ8 L;  1K9M M;  1Q81 P;  3CCM L;  1VQ6 L;  3CCV L;  4XTK A;  3I55 O;  1Q86 M;  1Q7Y M;  1YJ9 O;  3G4S O;  1VQ8 O;  1K73 M;  1K8A M;  1KD1 M;  2QEX L;  1QVG N;  3G71 L;  3CCM O;  1VQ6 O;  3CCV O;  1KC8 M;  1VQK L;  1M1K P;  2QEX O;  3CPW K;  3G71 O;  1VQ5 L;  3CCR L;  5DLJ A;  1YIJ L;  1YJW L;  1NJI P;  3CD6 L;  3G6E L;  1VQK O;  1VQN L;  1N8R M;  1M90 M;  1VQ5 O;  1YHQ L;  3CCR O;  1YIJ O;  1YJW O;  1JJ2 N;  3CD6 O;  3G6E O;  3CC7 L;  1QVF K;  1VQN O;  3OW2 N;  5DS4 A;  1YHQ O;  2QA4 L;  1VQP L;  1S72 L;  1VQO O;  3CC7 O;  1Q81 M;  2OTJ L;  5DQT A;  3CCQ L;  1QVG K;  1VQL L;  2QA4 O;  3CCS O;  1VQP O;  1VQ7 L;  4P6I C;  5DS5 A;  1Q82 P;  1S72 O;  5DS6 A;  1KQS K;  1K9M P;  2OTJ O;  3I56 L;  3CXC K;  5FCL A;  3CCQ O;  5DQZ A;  1VQL O;  1W2B K;  1Q86 P;  1VQ7 O;  1VQO L;  1Q7Y P;  1VQ4 L;  3CCL L;  1M1K M;  2YZS A;  3CC4 L;  1K73 P;  3CCE L;  1K8A P;  1KD1 P;  3I56 O;  3CCJ L;  3CCS L;  3CC2 L;  1NJI M;  4N06 A;  3CCU L;  1KC8 P;  1QVF N;  3CC4 O;  1VQ4 O;  3CCL O;  3CCE O;  2OTL L;  1JJ2 K;  3GOD A;  1VQ9 L;  4W8K A;  3CCJ O;  3NKD A;  1YJN L;  3CC2 O;  3OW2 K;  3CCU O;  1YIT L;  3CPW N;  4WJ0 A;  1YI2 L;  2OTL O;  3CMA L;  1VQM L;  1N8R P;  1M90 P;  1VQ9 O;  3CME L;  1YJN O;  1YIT O;  1KQS N;  3CXC N;  1YI2 O;  4QDL A;  3CMA O;  1VQM O;  3CME O;  1W2B N;  3I55 L;  1Q82 M;  1YJ9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...