1M26A

Crystal structure of jacalin-t-antigen complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the jacalin-T-antigen complex and a comparative study of lectin-T-antigen complexs
pubmed doi rcsb
molecule keywords Jacalin, alpha chain
molecule tags Sugar binding protein, plant protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2002-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 1m26A00
4PIKA 2GTYA 5J4XA 3P8SA 2NU5A 5J4TA 3LLZA 3R50A 2BMZA 1VBPA 1C3MA 1WS4C 4WOGA 3LL2A 2GUCA 1XEZA 3WOCA 4R6NA 1PXDA 1TP8A 1UGXA 5J51A 3LKYA 1UGWC 3WOBA 5AV7A 3LL1A 4R6RA 4GX7A 1M26A 3LM1A 1C3KA 4AK4A 1OUWA 1UGWA 3R52A 4DDNA 5JM1A 3APAA 2JZ4A 2HYQA 3VZGA 1UGYA 4R6QA 5EXGA 1J4SA 1J4TA 4PIFA 4PITA 3MIVA 5BN6E 3MIUA 3R51A 3O44A 4MQ0A 3LLYA 1JOTA 4R6PA 4PIUA 1UGYC 3VY6A 1KU8A 2BN0A 2HYRA 2BMYA 2GUXA 3MITA 4AKDA 1C3NA 1ZGSA 1KUJA 3VZEA 1J4UA 3VY7A 1JACA 1VBOA 1XXQA 4AKBA 1UH1A 4AKCA 3VZFA 3LL0A 1WS5C 5J50A 2GUDA 1TOQA 1XXRA 1X1VA 4R6OA 1UH0A 1WS5A 2GUEA 1ZGRA 1WS4A 3AQGA 2NUOA
chains in the Genus database with same CATH superfamily
4PIKA 2GTYA 5J4XA 3P8SA 2NU5A 5J4TA 3LLZA 3R50A 2BMZA 4QX1A 1VBPA 4QX2A 1C3MA 1WS4C 4ARXA 4WOGA 4W8JA 3LL2A 2GUCA 1XEZA 3WOCA 4R6NA 1PXDA 1TP8A 1UGXA 4ARYA 5J51A 1DLCA 3LKYA 1UGWC 4D8MA 3EB7A 3WOBA 5AV7A 3LL1A 4R6RA 4GX7A 1M26A 3LM1A 1C3KA 4AK4A 1OUWA 1UGWA 3R52A 4DDNA 5JM1A 3APAA 2JZ4A 1JI6A 2HYQA 3VZGA 1UGYA 4R6QA 5EXGA 1J4SA 1J4TA 4PIFA 4PITA 3MIVA 5BN6E 3MIUA 3R51A 3O44A 1CIYA 1I5PA 4MQ0A 2C9KA 3LLYA 1JOTA 4R6PA 4PIUA 4QX0A 1UGYC 3VY6A 1W99A 1VMOA 1KU8A 2BN0A 2HYRA 2BMYA 2GUXA 2QP2A 3MITA 3TOWA 4AKDA 1C3NA 1ZGSA 1KUJA 3VZEA 1J4UA 4MOAA 3VY7A 1JACA 1VBOA 1XXQA 4AKBA 1UH1A 4AKCA 3VZFA 3LL0A 1WS5C 5J50A 2GUDA 1TOQA 1XXRA 1X1VA 4R6OA 1UH0A 1WS5A 2GUEA 1ZGRA 1WS4A 4QX3A 3AQGA 2NUOA
chains in the Genus database with same CATH topology
4PIKA 2GTYA 5J4XA 3P8SA 2NU5A 5J4TA 3LLZA 3R50A 2BMZA 1VBPA 1C3MA 1WS4C 4WOGA 3LL2A 2GUCA 1XEZA 3WOCA 4R6NA 1PXDA 1TP8A 1UGXA 5J51A 3LKYA 1UGWC 3WOBA 5AV7A 3LL1A 4R6RA 4GX7A 1M26A 3LM1A 1C3KA 4AK4A 1OUWA 1UGWA 3R52A 4DDNA 5JM1A 3APAA 2JZ4A 2HYQA 3VZGA 1UGYA 4R6QA 5EXGA 1J4SA 1J4TA 4PIFA 4PITA 3MIVA 5BN6E 3MIUA 3R51A 3O44A 4MQ0A 3LLYA 1JOTA 4R6PA 4PIUA 1UGYC 3VY6A 1KU8A 2BN0A 2HYRA 2BMYA 2GUXA 3MITA 4AKDA 1C3NA 1ZGSA 1KUJA 3VZEA 1J4UA 3VY7A 1JACA 1VBOA 1XXQA 4AKBA 1UH1A 4AKCA 3VZFA 3LL0A 1WS5C 5J50A 2GUDA 1TOQA 1XXRA 1X1VA 4R6OA 1UH0A 1WS5A 2GUEA 1ZGRA 1WS4A 3AQGA 2NUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PIK A;  2GTY A;  5J4X A;  3P8S A;  2NU5 A;  5J4T A;  3LLZ A;  3R50 A;  2BMZ A;  1VBP A;  1C3M A;  1WS4 C;  4WOG A;  3LL2 A;  2GUC A;  1XEZ A;  3WOC A;  4R6N A;  1PXD A;  1TP8 A;  1UGX A;  5J51 A;  3LKY A;  1UGW C;  3WOB A;  5AV7 A;  3LL1 A;  4R6R A;  4GX7 A;  1M26 A;  3LM1 A;  1C3K A;  4AK4 A;  1OUW A;  1UGW A;  3R52 A;  4DDN A;  5JM1 A;  3APA A;  2JZ4 A;  2HYQ A;  3VZG A;  1UGY A;  4R6Q A;  5EXG A;  1J4S A;  1J4T A;  4PIF A;  4PIT A;  3MIV A;  5BN6 E;  3MIU A;  3R51 A;  3O44 A;  4MQ0 A;  3LLY A;  1JOT A;  4R6P A;  4PIU A;  1UGY C;  3VY6 A;  1KU8 A;  2BN0 A;  2HYR A;  2BMY A;  2GUX A;  3MIT A;  4AKD A;  1C3N A;  1ZGS A;  1KUJ A;  3VZE A;  1J4U A;  3VY7 A;  1JAC A;  1VBO A;  1XXQ A;  4AKB A;  1UH1 A;  4AKC A;  3VZF A;  3LL0 A;  1WS5 C;  5J50 A;  2GUD A;  1TOQ A;  1XXR A;  1X1V A;  4R6O A;  1UH0 A;  1WS5 A;  2GUE A;  1ZGR A;  1WS4 A;  3AQG A;  2NUO A; 
#chains in the Genus database with same CATH topology
 4PIK A;  2GTY A;  5J4X A;  3P8S A;  2NU5 A;  5J4T A;  3LLZ A;  3R50 A;  2BMZ A;  4QX1 A;  1VBP A;  4QX2 A;  1C3M A;  1WS4 C;  4ARX A;  4WOG A;  4W8J A;  3LL2 A;  2GUC A;  1XEZ A;  3WOC A;  4R6N A;  1PXD A;  1TP8 A;  1UGX A;  4ARY A;  5J51 A;  1DLC A;  3LKY A;  1UGW C;  4D8M A;  3EB7 A;  3WOB A;  5AV7 A;  3LL1 A;  4R6R A;  4GX7 A;  1M26 A;  3LM1 A;  1C3K A;  4AK4 A;  1OUW A;  1UGW A;  3R52 A;  4DDN A;  5JM1 A;  3APA A;  2JZ4 A;  1JI6 A;  2HYQ A;  3VZG A;  1UGY A;  4R6Q A;  5EXG A;  1J4S A;  1J4T A;  4PIF A;  4PIT A;  3MIV A;  5BN6 E;  3MIU A;  3R51 A;  3O44 A;  1CIY A;  1I5P A;  4MQ0 A;  2C9K A;  3LLY A;  1JOT A;  4R6P A;  4PIU A;  4QX0 A;  1UGY C;  3VY6 A;  1W99 A;  1VMO A;  1KU8 A;  2BN0 A;  2HYR A;  2BMY A;  2GUX A;  2QP2 A;  3MIT A;  3TOW A;  4AKD A;  1C3N A;  1ZGS A;  1KUJ A;  3VZE A;  1J4U A;  4MOA A;  3VY7 A;  1JAC A;  1VBO A;  1XXQ A;  4AKB A;  1UH1 A;  4AKC A;  3VZF A;  3LL0 A;  1WS5 C;  5J50 A;  2GUD A;  1TOQ A;  1XXR A;  1X1V A;  4R6O A;  1UH0 A;  1WS5 A;  2GUE A;  1ZGR A;  1WS4 A;  4QX3 A;  3AQG A;  2NUO A; 
#chains in the Genus database with same CATH homology
 4PIK A;  2GTY A;  5J4X A;  3P8S A;  2NU5 A;  5J4T A;  3LLZ A;  3R50 A;  2BMZ A;  1VBP A;  1C3M A;  1WS4 C;  4WOG A;  3LL2 A;  2GUC A;  1XEZ A;  3WOC A;  4R6N A;  1PXD A;  1TP8 A;  1UGX A;  5J51 A;  3LKY A;  1UGW C;  3WOB A;  5AV7 A;  3LL1 A;  4R6R A;  4GX7 A;  1M26 A;  3LM1 A;  1C3K A;  4AK4 A;  1OUW A;  1UGW A;  3R52 A;  4DDN A;  5JM1 A;  3APA A;  2JZ4 A;  2HYQ A;  3VZG A;  1UGY A;  4R6Q A;  5EXG A;  1J4S A;  1J4T A;  4PIF A;  4PIT A;  3MIV A;  5BN6 E;  3MIU A;  3R51 A;  3O44 A;  4MQ0 A;  3LLY A;  1JOT A;  4R6P A;  4PIU A;  1UGY C;  3VY6 A;  1KU8 A;  2BN0 A;  2HYR A;  2BMY A;  2GUX A;  3MIT A;  4AKD A;  1C3N A;  1ZGS A;  1KUJ A;  3VZE A;  1J4U A;  3VY7 A;  1JAC A;  1VBO A;  1XXQ A;  4AKB A;  1UH1 A;  4AKC A;  3VZF A;  3LL0 A;  1WS5 C;  5J50 A;  2GUD A;  1TOQ A;  1XXR A;  1X1V A;  4R6O A;  1UH0 A;  1WS5 A;  2GUE A;  1ZGR A;  1WS4 A;  3AQG A;  2NUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...