1M8VA

Structure of pyrococcus abyssii sm protein in complex with a uridine heptamer
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
b'AERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
publication title Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Rna binding protein/rna
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m8vA00
1HK9A 3V8JA 3RKYA 3JB9G 4M75C 4M77A 4MMKA 4F7UG 1JBMA 2DTIA 4XTUA 4V2SA 3BFMA 4X9DA 3HFOA 4XTWA 3JCMd 4QVCA 1H641 4M78C 4RCBA 4C8QC 5GANe 5GMKj 3JB9F 4J6WA 3RKWA 4EMHA 3JCMc 3V7CA 2E64A 4J6XA 5GAMe 4M77G 2EJGA 3JCMP 2RB6A 2RD1A 4PJOE 1I5LA 3HFNA 5LJ3e 4XU0A 5GAOl 4C92F 1D3BB 2QTXA 4HA8A 3RIRA 3JB9I 2E1HA 4EMKC 1HXDA 5GANd 3HSBA 4M7AE 5LJ5h 1M5Q1 4N0AC 3GIBA 4DQ2A 5GMKi 3JCMV 4EMKB 5GMKl 4M78G 5LJ3g 5GAOr 4PJOC 5GAMd 5GAN3 4EMKA 4NL3A 4PJOB 2FYKA 2VC8A 3JCMg 5LJ5j 1KQ2A 3EFRA 4N0AA 2YLCA 4MMLA 4X9CA 4F7UF 3QO3A 5GMKh 4HT8A 5GAOq 4M7AC 5LJ3d 4M7DE 4PJOA 3QUIA 5LJ5f 1KQ1A 3RERA 4M7AB 4M75B 2FB7A 2VXEA 3FJPA 4M7AA 4M75A 1WPYA 3M4GA 3V7RA 2E41A 4M7DC 1B34B 4C8QE 4M78B 4C8QB 4EMGA 2HNIA 1B34A 4M77F 4M78A 4RCCA 4PJOG 4C8QA 4M7DB 1YCYA 1LJOA 5GANg 2YHTA 4A53A 4M7DA 4JRIA 2JN0A 2VXFA 4M75F 2EJFA 4M7AG 4M75G 5GAMg 2CGHA 2RM4A 2RA2A 3JCMX 4J5YA 1TH7A 2DEQA 2EAYA 4M78F 1LOJA 4C8QF 5GANj 1X01A 4C8QG 5GMKm 4M7DF 4M7DG 2DZCA 4A54A 1U1SA 3L1AA 4XU3A 5GAN6 5GAMj 4HT9A 4XU1A 5GAN4 3FB9A 2DTHA 2ZGWA 1I81A 3JCMh 3SB2A 5LJ3j 4M77D 4QVDA 5LJ5e 2EJ9A 1WNLA 5GAN8 2YLBA 4JUVA 5LJ3f 2DKGA 3QSUA 2DVEA 2DXTA 3BY7A 4C92D 4XTZA 4PJOF 3JCMf 5GMKe 2Y90A 2DZ9A 3BW1A 1WQWA 3V8LA 3RKXA 2K57A 4C92E 5I21A 1I8FA 4NL2A 3L2ZA 4JRKA 4M7AF 5GANh 4OP0A 5GAOm 5LJ5d 3JB9H 1JRIA 5GAN7 3JB9D 2E65A 2I2LA 1WQ7A 4WF2A 3RESA 5GAOp 5GAMh 4XTVA 5GAN2 4C92C 5DY9A 3INZA 4F7UE 1Y96B 1M8VA 4C92B 5LJ3h 5GANf 1I4K1 4XU2A 1Y96A 3V7SA 3QHSA 1N9SA 2E10A 4PNOA 4C92A 3BDUA 5GAMf 1BIBA 4PJOD 4NOYA 4XQ3A 5GAOn 2EWNA 4J6YA 3EFSA 1LNXA 3RUXA 3JCMJ 4XTXA 4M77E 1U1TA 1BIAA 2DJZA 3SWNC 4JLIA 4F7UB 5GAN5 4M7AD 4M75D 3VU3C 3JB9J 4F7UA 3SWNB 1N9RA 5LJ5g 2DTOA 4C92G 3JCMW 5CAIA 3JCMe 4M75E 1D3BA 4XTYA 3SWNA 4Y91A 3V8KA 4M78D 4C8QD 3AHUA 4M77C 2DXUA 3PGGA 3JCMQ 3JCMb 4M7DD 4M78E 3FIFA 1MGQA 4M77B
chains in the Genus database with same CATH superfamily
3UA6A 1Q7YC 1JXOA 1UDLA 3CCVA 1KK7A 1UEBA 1V76A 2J05A 1RLPC 2DO3A 2RD1A 3E9FA 3ME9A 4HCKA 1M2OA 3HKSA 3VS3A 1OX8A 3MKDA 2QTXA 3H0IA 1VQ5A 1W6XA 4HA8A 2YSQA 4BDZA 1OU8A 3MEVA 3LGLA 3GIBA 1U06A 1SF9A 2DD5A 2XDBA 2D8JA 3QUIA 2CT3A 2RI3A 2FB7A 3KFVA 2X4XA 3I5RA 1JU5C 3CCEQ 3H9NA 3A8MB 4LDWA 1JXMA 3PFSA 2JOYA 1YCYA 2D0QB 4ZNXA 1YI2T 3QXEB 3GLXA 3ZL7C 3PTAA 4IUQA 1QVFP 3RDVA 4E7ZA 1TH7A 1VQ7A 4LE9A 2RI2A 2KAFA 4CC3A 4UC4A 4C0DB 1OI1A 2E4HA 2ZGWA 1QVGS 1VQLQ 3NTIA 1S72T 4FSXA 1VQ9A 1YHQQ 4WTOB 2RPNA 3FRNA 4BI3A 4J7IA 2LNHB 1M90R 3EG1A 2KBTA 2RHYA 3LWIA 2MYSA 1AWOA 1M8VA 3VS4A 3M54A 4C92A 2NUPB 3CBPA 4OB2B 3CCST 2DVJA 4N4GA 3LLRA 2L0AA 5IAYA 4XTXA 5GAN5 5A2QE 2J7IA 3QWXX 2FO0A 1GCQA 1VQ4A 3JCMe 3CCUA 1BI3A 1OPLA 4C8QD 1M2VA 4M7DD 1DJ7B 4M4ZA 3L2VA 3RKYA 1VQPA 1D1BA 2DTIA 4ORZA 3OB9A 4C8QC 1WJQA 3C0CA 4CC2A 4J6WA 2RQUA 4CC7A 2HQEA 1ZBJA 2A3LA 1I5LA 3OYFA 3PIOA 4KUDK 4XU0A 1RAAB 4IUTA 4RG8A 3M59A 3NPFA 5LJ3g 5GAOr 1VQ6A 1UB4A 2LRQA 2HZYA 1NYGA 1VA7A 1W4SA 5AT1B 2A28A 2M0OA 3CMET 1W70A 1MV3A 1BU1A 2RJFA 2NWMA 1PKSA 2CZ1B 2CZ7B 1VQ8Q 3CC7T 5KYNA 3CCQA 5GAN4 3FB9A 2RQTA 4II1A 1AVZC 4DBRA 1WNLA 1IZ6A 1YI2A 1C1AA 2KK4A 5D6XA 4FM4B 4C0ZA 1EX4A 2AKLA 5KH6A 3JCMf 2E6NA 2CUBA 1MV0B 2CDTA 4A4EA 1Y96B 5KYYB 1S72A 2CZ0B 2EQJA 1M3BA 1OOTA 2SEMA 1D0ZA 2MIOA 2O31A 3C95A 2DBMA 4R0KA 2R57A 2DXCA 1E6GA 1K9MC 3VYHB 3DLMA 3CCSA 5GAN6 4BI8B 3M56A 2WSFE 3TU4K 3A8GB 4RMOA 2RK2A 3VRZA 4LD9K 5IT9E 2VUBA 1QCOA 4GLMA 4RTUA 3OS0A 4J6XA 4JRPA 1AWWA 1K8AR 3QYHB 3JCMP 4Q5WA 1D3BB 2L2PA 3M0PA 4PKCC 5HKCA 4Z88A 1M5Q1 1YJ9T 1TWBA 3OS5A 2J6FA 4C0DC 1O9SA 2QQ9A 3OYGA 2CT4A 4PJJA 1KQ1A 2E5KA 1FWZA 2QXFA 3MJXA 5IXBA 1KHCA 1YHQT 4RCCA 3LH0A 1LJOA 1T3SA 4A53A 3OYMA 1G3TA 2J06A 4OB1B 4M75F 2COWA 2M16A 4J5YA 2YRDA 6AT1B 1QKWA 4M78F 2GFUA 2DL7A 4J9HA 5FLXE 4AFQC 2DD4A 3GNFB 3OY9A 4D6WA 1I81A 3CMEA 1G3SA 4B9WA 2P4TA 3VKIA 1NJIC 2D9TA 1KQSS 4J83A 1I8FA 1BI2A 1K9MU 1AHJB 3CC7A 3VS5A 1GFCA 1B07A 4AFZC 2OTLQ 3RMQA 2QASA 4J9DA 2E6ZA 5GAN2 3M55A 5DY9A 4C92B 1KFZA 3V7SA 1OX9A 3JV3A 4J9CA 4NOYA 3LGFA 1HSQA 3CEYA 2MWPA 2LX7A 5CAIA 3G6EQ 4L59A 1M2VB 1JO8A 2Z0WA 3FIFA 4R56A 4ZN3A 3U23A 4JPBW 2RHXA 3M4YA 2QDLA 5FU6B 2F5TX 3CD6T 2GTJA 1Q95G 4RTYA 1G2BA 2DETA 1FXXA 1WX6A 3EG9A 1N8RR 1TU0B 4FCYA 4AFSC 4ME7A 4F04B 1YWPA 2DJQA 3M58A 1ZSZC 1XTDA 2DFUA 2DA9A 2GCXA 2L3RA 9ATCB 4M78G 4ZTJA 2LMJA 1VIEA 4M7DE 1W2BA 5GAOq 3CCLT 1M3AA 2QQRA 4ESRA 8ATCB 2LJ1A 1HJDA 1NJIU 5FRNA 1X2QA 2MCNA 3P8HA 1B34A 2CREA 4B6MA 1YJ9A 3VS7A 3MEUA 2OI3A 3META 4MDXA 2FZKB 4XAXB 2YUOA 2DEQA 1D1AA 2VWFA 3M0SA 3QIIA 2L3QA 4C5IA 1YHQA 2QQSA 7AT1B 2IG0A 2QGGA 3NFCA 3KBGA 4XU1A 4Z89A 4LUEA 1PD1A 2DMOA 2KY9A 3QSUA 3WVDB 3E19A 3CXCA 4PJOF 1B3QA 4C0GA 2DZ9A 1D0XA 1NLPC 2EFIA 4RTZA 1RLQC 4M7AF 4P5NA 3L2UA 3JB9H 5I2MA 2JMAA 4IUVA 5EC7A 2PUKB 4JZ4A 2ABLA 4KRTA 1AD5A 4LD6A 1PC0A 3OW2A 1UGVA 3S3OA 1JJ2S 1UHFA 3EFSA 1LNXA 1WYXA 2RJEA 1NBEB 3OBYA 4JLIA 1XQHA 2XK0A 1K9AA 1Y7XA 2L89A 2ZPFB 5CCAA 1J3TA 1H8KA 1UECA 2WSEE 4ZGDB 1VUBA 3L2WA 2ZPBB 1FYNA 2YUPA 1K73R 1YITT 4PFOA 2OJ2A 2PUOB 3M0TA 2GQVA 2O4XA 4HCBA 1OYXA 2P0KA 1VQMT 1LCKA 3MPUB 4N4IA 1KC8C 4IIMA 2PVGB 1KHIA 2X51A 1VQNQ 1X2KA 4OMPA 2M02A 2W10A 2PVOB 1TUDA 2ATCB 1QW1A 2V26A 3TCJA 5CKBA 4EMKA 3CD6A 1YIJQ 3CCRA 1D09B 3EFOA 2RH2A 4VUBA 4ZGJB 2F69A 1OQKA 2HSEB 2HD0A 3H6ZA 2HNIA 2VYTA 4M77F 4PJOG 1VQKT 4JRIA 1XJWB 4M7AG 3EGUA 1R0BG 3M0UA 1KIKA 3CCLA 2FRYA 3G7ZA 4PFZA 5GMKm 1SRMA 1RL2A 2GGRA 1G5VA 2DL4A 2O2OA 4LDYA 1K0XA 5GAN8 2EJ9A 5HK0A 2EYWA 5LJ3f 4FT4A 2IPOB 3G6ET 3V8LA 5CKHA 3E1SA 2RHZA 5I22A 3EGXA 3UPUA 3JB9D 3RESA 4GBQA 3X28B 3MO8A 1R77A 1VYVA 4HXJA 2KR3A 1BCOA 3QG1A 1KC8U 1GBQA 3OW2P 1YWOA 2AZSA 1R8OB 1X27A 2DL5A 3SWNC 1R0CB 3VU3C 2X3WD 5HY6A 1M1FA 1Y07A 5CIUA 3TSWA 2P0QA 2W0ZA 5J26A 4YTLA 3SDZA 4C5HA 5KYUA 3EGDA 3BFMA 4L5GA 2C0IA 1Q86C 2C06A 4QVCA 1YJNT 3EG9B 2EQIA 2E5QA 3WXMB 2XU8A 5J39A 2HKNA 4M77G 4X34A 2RB6A 2KGTA 3P8BB 5M9OA 1MNEA 2F2VA 1BB9A 2DF6A 1YITA 2X4WA 2ED1A 3F70A 2AIRB 3PMIA 2RJDA 3HL8A 5GAMd 5FWCA 1VQMA 1M1KU 1IGUA 1JEGA 4F7UF 3P8DA 2KXDA 2JUFA 1YJWQ 2JTMA 2VXEA 1B34B 5FU7B 1RI0A 1M3CA 2G3RA 3HRSA 4KGXB 5HK3A 3VS2A 1G3WA 4J7FA 2NLUA 2EJFA 1M1GA 5GAMg 2RA2A 3MCAB 1CKAA 1C6VX 4RUGA 4C8QF 1X75C 3GBQA 4M7DF 5IN1A 1E6HA 2CP5A 5GAMj 1TUCA 4HT9A 1ZQ1A 3VUZA 1VQKA 1NE8A 1NG2A 2QTVA 4Z8AA 4QQGA 3EH2A 4RKUE 3TSZA 3EAEA 1ARKA 3DB4A 2ESWA 3REBB 2QEXQ 3CPWA 1ZUUA 3CMAT 4PJMA 1I07A 5GAMh 3X26B 2MI6A 2DRKA 4PJNA 2GNCA 2RNAA 5CQXA 1Q86U 3QWYA 4PNOA 1PRMC 5IHIA 2A0FB 1K76A 1BIBA 3R6OA 1OEBA 2K2VA 1H92A 1JQQA 2QQBA 3VS0A 2JZ2A 2D8HA 1SKUB 1AWJA 1KD1R 2ROTA 3RNJA 3AHUA 1BYMA 2DL3A 1YIJT 3EG0A 1Q7YU 4F7UG 2K5IA 2O4XB 4XTUA 3T9NA 3D7SB 3M0QA 3ULRB 1UUEA 3OSVA 4BY6B 1WGSA 1QQJA 1T0JA 1X69A 1PNJA 3V7CA 1YNZA 3BE3A 1SHFA 3DLLA 4JJCA 3TREA 4FSSA 2DK3A 3H8ZA 4PL6A 4E7SA 4F14A 4EMKB 2MWOA 3THKA 2DXBA 1YJNA 2EYZA 3EFOB 1WHLA 4N0AA 4PJOA 2QG9B 3MEWA 5LJ3d 2V8KA 1OZ2A 4M7AA 2QA4Q 4M7DC 2JT4A 3OMGA 1P92A 2FEIA 2H8HA 1G3YA 3OYIA 2JN0A 2DL8A 3OYBA 1PSFA 1LVKA 1Q81C 4ZTFA 4MDWA 4FYWB 2K6DA 2D0NA 1BI0A 1D1CA 1MMAA 2AK5A 4JJNK 2YRCA 5LJ3j 2HSPA 2OTJT 1G83A 3BW1A 4C92E 2CUDA 3EGXB 3M57A 3PVQA 1PWTA 2K2MA 1IHVA 3OYEA 3A5ZB 3CPWP 2M9UA 3ZFJA 2K5FA 4EPCA 3CC2Q 1ZUYA 1BCMA 2K7AA 1QVGA 3G4ST 3RBBB 5LJ3h 3J81E 4AG2C 2DIGA 2ENMA 4J6YA 1RAGB 3EG3A 2RF0A 2A37A 3CMAA 1ACMB 3UATA 2ED0A 2KDSA 3JCMW 4RTWA 4LUDA 3PGGA 4KUIA 3JCMb 1RAIB 5KE2A 2JTEA 5KYUB 3V8JA 4M77A 1O75A 1JBMA 4FYVB 2QQAA 2MPXC 1V1CA 4HVUA 1H641 2PVDB 3A1PA 2XMFA 2E12A 2CH4W 2B86A 4OVAA 3G71Q 1YIJA 2EPDA 1PKTA 4C5EA 2IVWA 4PLLA 4D8DA 3UT1A 3JCMV 2O88A 5GAN3 2C0OA 3FLGA 1KQ2A 2YLCA 3QO3A 1VIFA 5L8RE 4HKEA 1Z9QA 4FYYB 3CCET 1Q7YR 1RAFB 1BI1A 1U3OA 4J9IA 2CGHA 3OS2A 2RK1A 2LT1A 2YDLA 1IB8A 1PD0A 4J8OA 1OULA 1GRIA 3OMCA 1VQLT 4GLKA 3L42A 1UTIA 5KCOA 3RR6A 3C4SA 5I21A 2DILA 2KRMA 3EH1A 2LTOA 2P84A 1ABOA 3X25B 2E65A 5D6WA 4QVZA 1QVGP 1T0HA 1W2BS 2JMCA 4J9EA 2OTJA 1QWEA 3S6WA 2JJ9A 5GAOn 3PT9A 1GCPA 3CCVQ 1U1TA 4AFUC 5CKEA 3OYNA 2FG0A 4F7UA 2KYMA 4QKUA 5ECAA 3CCMQ 3G4SA 4BACA 1RAHB 2KE9A 4MMKA 1VQ5Q 4FW2A 4V2SA 1TOVA 4EMHA 2X9HA 5GAMe 2GBQA 3CXCS 4MZMA 4KH0B 3JAME 1QMCA 3HSBA 2AT1B 5GANd 4JJDA 1YFNA 5GMKi 4CRIA 5CVIA 4PJOB 4KGVB 2IIMA 1Q82C 4M7AB 1VQ7Q 3FJPA 1PSEA 4ELZC 2LJ0A 3HHTB 2HDAA 2MOXA 2J6KA 2V8JA 2O9SA 3OS1A 5CO7A 3NMZC 2RHIA 5GANg 3M5AA 2VXFA 3HTRA 3M9QA 2KMTA 4M75G 2KXCA 1VQ9Q 3CC2T 1VQ8T 5GANj 4LDVA 2DZCA 3CCEA 2VV5A 1I0CA 1NPPA 2RMOA 2RO0A 1HYOA 2EKHA 1MNDA 4C5GA 2MAMA 1WXUA 3RKXA 3J80E 1BBZA 2P0PA 5GANh 4OMOA 5GAN7 1VQLA 4C0FA 3SFMA 2VKNA 2LNVA 3WVEB 1VQ4Q 4E7IA 5FWBA 4XU2A 3QHSA 3I55Q 4A63B 5GAMf 1KQSA 2K3YA 2HKQB 2Y4XA 3G71T 2FL7A 4BB7A 2AKKA 2A7YA 1AEYA 2O01E 1N9RA 4XTYA 3SHWA 1M8MA 2COYA 2YRVA 4BD3A 2G6FX 3JCMQ 4M77B 3HRTA 5DM7R 5A0LA 3X20B 1WHGA 3C12A 1YP5A 5GMKj 1PCXA 1VQ6Q 3RKWA 3CC4Q 2BE9B 2EQUA 3FEOA 1N27A 3ER0A 1YCSB 5LJ3e 2DLPA 5KYXA 2RHUA 4DBQA 3LX7A 3I9QA 3FDRA 1QVFS 1MHNA 1EZZB 3JB9F 3EFRA 5GMKh 1K9MR 3BDLA 1GL5A 1WHKA 1WIEA 5IHNA 4A4HA 2XHCA 2FPEA 2FZGB 1C0MA 5A0DA 3CCQQ 3I35A 1M90C 2M1HA 5GJVB 3E9GA 4J9GA 2ZCFB 4OMQA 3L2RA 3S3NA 4DA4A 1PG5B 4XU3A 3OYJA 4RTVA 3QJ6A 4AG1C 3CCVT 1CKBA 2MMPA 4JUVA 2DKGA 2DXTA 2FPFA 1S72Q 4C92D 2EKOA 2KQWA 2CYZB 3UA7A 1VQ8A 2QK0A 3CCMT 1WLPB 3E2UA 2OTLT 2V1RA 4AT1B 5LJ5d 1CSKA 3KXTA 4LNPA 4DOVA 4C92C 3NTHA 3N5BB 5FW9A 4JJBA 4KULA 4HCZA 2XKOC 3CCSQ 5GJWB 4PJOD 4FL6A 3QZ9B 1KQSP 1GCQC 4QT7A 2X3XD 3JCMJ 4F7UB 2AZVA 4M7AD 1V29B 3JB9J 2EQKA 5LJ5g 4OGCA 3M53A 3PNWC 3QDRB 2LJ3A 1OV3A 3MHXA 4Y91A 1KG1A 1NJIR 3CPFA 3FJ5A 1MMDA 1N5ZA 3ASKA 3A8OB 1UGSB 4JZ3A 4BE0A 3JB9G 3G1JA 1XNIA 5FU6C 1VQ7T 4X1VA 2FRWA 2DBKA 3NTKA 1JJ2A 2OX7A 1SSFA 1K4US 1QWFA 4BDYA 2LCSA 4D8KA 1M90U 2KVQG 2XIDA 1VQ9T 2XD0A 1RACB 2KI7A 2GQIA 5CKDA 5LJ5h 4DQ2A 4E47A 1ZSZA 1WA7A 2K3XA 5KYWA 1F1BB 1NEBA 2BZXA 2F5KA 2JS2A 2KT8A 4E7LA 4MMLA 5EG2A 2WSCE 3DB3A 4M75A 1WPYA 3M4GA 2KROA 3HP9A 1QCFA 4M78A 5KE3A 5CK9A 2LVMA 3KUFA 4FYXB 1K1ZA 4EDUA 4JRQA 1LPLA 3HPWA 2MF2A 2CP3A 4RG2A 5J3BA 3I55T 4A54A 3CC7Q 2LDMA 3X24B 2FZCB 2PNIA 3SB2A 2ZPGB 4M77D 1M30A 2YLBA 2EQMA 2K57A 1QVPA 1VQOQ 3L2ZA 2VGMA 2KSSA 5GAOm 2FHDA 2COZA 2I2LA 1H3ZA 5GAOp 3INZA 3L2QA 1K8AC 1I4K1 2E10A 1VQ6T 1SSHA 3CC4T 2PU9B 1FMWA 5LL6S 2JS0A 2E70A 3CCMA 3LWHA 2OTLA 1BIAA 2K4YA 2DYBA 1AZEA 4Z02A 4J9FA 3OSSC 4M75E 1D3BA 4JS4A 2EYXA 1UGPB 1SPKA 2KT1A 1TXQA 4M78E 1JB0E 1I1JA 4QW2A 2YUNA 1HD3A 3SEMA 1SRLA 4X9DA 4RCBA 1ABQA 2PQWA 2P4RA 2RQVA 5GANe 3FC3A 1FMVA 1Y0MA 3CCQT 1JJ2P 3G6EA 2R5AA 4J9BA 5D6YA 1VQNT 2HEQA 5KYXB 2ROLA 2ZPIB 2RJCA 2E1HA 3I56Q 1WI7A 2R58A 1AT1B 5CR2A 1YJ9Q 1UG1A 2FYKA 2SRCA 1ZHIA 1AZGB 4X9CA 4HT8A 3H0HA 2ZZDA 2VVKA 2NUTA 4EMGA 4OMLA 2OAWA 4OB3B 2BUDA 1TUGB 2NYSA 1NYFA 2LX9A 2DPPB 4OGEA 1KC8R 2EVRA 1M27C 2JVVA 1UE9A 1RADB 4FW1A 1OZ3A 3O5ZA 3GP8A 1D0YA 4C8QG 2DAQA 4DEYA 1K8AU 4M7DG 3L1AA 3SD4A 3REAB 4LDUA 3ZEHA 3QDFA 5D7UA 3OQ5A 3TVTA 4IIOA 1UJYA 3URGA 5GMKe 1QP3A 1FMKA 3VJPA 3I55A 2Y4YA 1M4ZA 2PZ1A 2ZPHB 3H41A 3IQLA 4HVVA 5GANf 4DOWA 1N8RC 5I11A 3S3MA 2LCCA 3MP8A 3BDUA 3QYGB 2EWNA 1M1KR 2V8IA 3OA6A 3SWNA 3V8KA 1T3LA 2OAUA 3C94A 2XI9A 2V1QA 1TG0A 3CC4A 1H3HA 2BKDN 2HAXA 1FX7A 2CH4A 3HFOA 3GOXA 2J6OA 3JRZA 3CCJQ 3CD6Q 1GXIE 2QYZA 3OYAA 2E64A 1AWXA 3CCRQ 4PJOE 1UGQB 3HRUA 2HQHA 4KGZB 4E6RA 3TQ7P 4KT0E 4M7AE 1ZSZB 4BUGA 1W1FA 5KYWB 2I0NA 4LDXA 4NL3A 1TSFA 2LCLA 3CBMA 3EGDB 1YJWT 3QKJA 4BE2A 4M75B 1VQNA 3CCLQ 5FU7C 3NHNA 1QKXA 4M78B 2XDDA 2HCKA 1VQOT 1Q86R 2E3IA 4RTXA 2B8AA 1Q81U 2EW3A 2EAYA 2KNBB 1U8RA 2MK5A 4K11A 1N8RU 1U1SA 1IXDA 3A98A 1WHMA 5LJ5e 3BY7A 1UGRB 3UF4A 1WQWA 4FIBA 2QEXT 1K73C 3DKMA 4OP0A 1ZA2B 2XG8D 2DERA 1IREB 1PHTA 3OYKA 2VGNA 1TS9A 1X43A 3GF5A 4PFPA 1IRXA 2CP2A 2ECZA 4XQ3A 4M77E 3VRYA 1VYUA 3I56T 3AT1B 1X6OA 1ZA1B 2M51A 1ZBXA 4O5VA 3VV0A 3A8HB 1BK2A 3VUBA 2CP0A 4IURA 1HK9A 1YITQ 3MP1A 4BY6C 3QJYA 3QZ5B 1VQMQ 1NM7A 3MP6A 3JCMc 1KJWA 5HCKA 1RABB 2RQWA 2DX1A 3H0FA 2KEAA 5FROA 3RIRA 2EBPA 3JB9I 4EMKC 1HXDA 3OYLA 4E2FB 1WJRA 5DLOA 2X4JA 2K3BA 2K79A 2M0YA 2E3HA 2CSQA 2LQKA 2A08A 2H3JA 5A0GA 5LJ5f 5CQYA 1Y57A 3I5SA 1G8XA 2NUTB 2QA4T 3VYGA 4WCIA 2DNUA 2E41A 4C8QA 3LH5A 1K73U 4BI4A 4M7DA 1EIFA 1VQKQ 2CP7A 2DYIA 4LXCA 3OYYA 2QDYB 2RM4A 3JCMX 2KYBA 5CKFA 1YJWA 1WDXA 2JM9A 2CSIA 1B7TA 1X01A 2CZ6B 1GFDA 4B9XA 1NZ9A 1XOVA 1RI9A 2DTHA 1WJSA 2X4YA 1VQOA 4QVDA 4JLGA 3EHRA 1ZSGA 2BE7D 2DVEA 2RI5A 2JTFA 3OW2S 3GNGA 3NGPA 4XTZA 4IKFA 2Y90A 3VS1A 1WXTA 4LN2A 1JRIA 4DBFA 1WQ7A 2HL5C 2NUZA 3PMTA 4F7UE 2DRMA 2PTKA 1VOMA 4PJLA 4Y92A 1QCNA 4DBHA 3CCJT 1Q81R 1I5OB 2LC4A 3CCRT 4QQDA 2QEXA 2JW4A 2FPDA 1OU9A 3CBOA 4M75D 1E7OA 3SWNB 3LYIA 2YXYA 4M78D 3UDCA 2DXUA 2D6FA 1X6BA 5IHKA 2BIVA 3EG2A 4C8QE 1KSWA 2L3PA 4ZN1A 4M75C 3CCUQ 4BE1A 3JCMd 3GPLA 3Q1JA 4M78C 3M0RA 2EGAA 1WFWA 3I56A 1YJNQ 3OYCA 4MZTA 1VQPQ 2K5LA 4TVRA 2EJGA 2BZ8A 2DE0X 1SG5A 4C92F 2GTOA 4FU6A 4OMMA 2L5QA 1M9SA 3PIPA 4HVWA 1MMGA 1WHHA 1Y71A 2LQWA 5GMKl 2KRNA 3JCMg 1RUWA 1Q82U 2H3EB 2C0TA 5I2SA 3RERA 2L3SA 4ELYC 4OMNA 3V7RA 1X6GA 3J7AF 4KH1B 5IH2A 2A36A 2XDPA 5DLQE 2YHTA 2EGEA 2GFAA 2EYQA 2HQXA 4FT2A 3A8LB 2HMAA 3OBWA 3MEAA 2LP5A 2F2WA 4E7KA 1S1NA 3ZBDA 1SHGA 2BTTA 2F2XA 2GF7A 2QA4A 2LT4A 4NS5A 3JCMh 8AT1B 1KD1C 4E7JA 2ZPEB 2JM8A 4GY5A 2F1LA 2EGCA 1PM3A 1QLYA 4OMFB 4NL2A 4OF1A 1YI2Q 2YWWA 4JS5A 1WZOA 1ZUKA 3CMAQ 4WF2A 4XTVA 2X35A 2KRSA 2BZYA 2XICA 2HBPA 2K9GA 1TTHB 3PVLA 1N9SA 2NUPA 1N6AA 2L8DA 1IGQA 3RUXA 2EYYA 2RQRA 2FVUA 1VYTA 3EHQA 2WACA 4ZGEB 2LQ8A 2DTOA 4L6V5 4C92G 3CC2A 4QQ6A 4O6JA 3CCJA 1MGQA 4PLIA 4CI0C 1VQ5T 1W2BP 2O9VA 2HL3A 4XTWA 5C0MA 4HCCA 1SEMA 4N4HA 2EIFA 1OPKA 3HFNA 4Y28E 4DEXA 2QGFB 5GAOl 4IUUA 4N0AC 4PJOC 1UJ0A 3JSCA 4A4KA 1YBYA 2VC8A 4ANJA 5LJ5j 1M1KC 2DEUA 2CP6A 2YUQA 4F16A 3UWNA 4M7AC 3RMSA 1PRLC 5KCHA 3G71A 1K0SA 4A4GA 1KD1U 2D1XA 2CKKA 2DIQA 4MZPA 1AOJA 1UFFA 4C8QB 2VB6A 3CXCP 4M7DB 1WXBA 1QVFA 2LQNA 4ATOA 2RN8A 4A4FA 3R6NA 5FRMA 1LOJA 1BKBA 1Z9ZA 4CC4B 2LZ6B 3CPWS 4KBMB 4PK4A 3OYHA 5AYFA 2JXBA 3QBYA 1WHJA 4E7HA 3TEEA 1GBRA 5IXFA 4JDSA 3VS6A 4R55A 2YT6A 1Q82R 2VASA 1NPRA 2OTJQ 2R5MA 2CS7A 3CMEQ 4JRKA 3QPHA 1QP2A 4RTTA 5L23A 1A0NB 4F17A 2ZAEA 1YN8A 1VQ4T 1IO6A 5C6SA 3CCUT 1MUZA 1ZLMA 1Y96A 4EIKA 3G4SQ 5KYYA 3LW5E 4OB0B 1IHWA 2QAZA 3PE0A 3CQTA 1UHCA 1VQPT 2DM1A 4AMCA 4XK8E 3OYDA 2HBWA 1NLOC 2QI2A 2DJZA 1U5SA 1EFNA 4IUPA 1MMNA 1RAEB 1NEGA 4M77C 3O8VA 2JNGA 1ZX6A 2AHJB
chains in the Genus database with same CATH topology
3CC4A 1YITT 1Q7YC 2BKDN 4MMKA 3CCVA 4V2SA 2PUOB 2HAXA 1FX7A 3HFOA 2GQVA 2O4XA 4HCBA 1OYXA 2P0KA 3GOXA 1VQMT 1UEBA 3JRZA 4N4IA 1KC8C 1GXIE 4EMHA 2DO3A 3OYAA 2E64A 5GAMe 2PVGB 1KHIA 4PJOE 2RD1A 3E9FA 1UGQB 3ME9A 3HRUA 3CXCS 3HKSA 4MZMA 2QTXA 3JAME 1VQ5A 4HA8A 2PVOB 3HSBA 4KT0E 4M7AE 5GANd 4BDZA 4BUGA 3MEVA 3LGLA 3TCJA 1QW1A 5GMKi 3GIBA 5CKBA 4LDXA 2DD5A 4CRIA 5CVIA 4EMKA 4NL3A 2LCLA 3CBMA 2XDBA 3CD6A 4PJOB 3CCRA 1Q82C 1YJWT 3QUIA 2RH2A 4VUBA 3QKJA 4ZGJB 4M7AB 4M75B 2RI3A 4BE2A 2FB7A 1VQNA 2F69A 3FJPA 1PSEA 2X4XA 3HHTB 4ELZC 5FU7C 2HD0A 2V8JA 3H6ZA 4M78B 2XDDA 2HNIA 5CO7A 3OS1A 2VYTA 3A8MB 4LDWA 4M77F 4PJOG 3PFSA 1VQOT 2JOYA 1YCYA 2D0QB 2RHIA 5GANg 3M5AA 1YI2T 1VQKT 4JRIA 2VXFA 3QXEB 3GLXA 3PTAA 3M9QA 4IUQA 2KMTA 4M75G 4M7AG 2B8AA 1Q81U 3CC2T 1VQ8T 1TH7A 2EAYA 1VQ7A 3CCLA 3G7ZA 1U8RA 5GANj 2RI2A 2KAFA 5GMKm 1N8RU 4LDVA 2DZCA 3CCEA 1U1SA 2VV5A 4UC4A 1RL2A 4C0DB 1OI1A 1G5VA 2ZGWA 1QVGS 4LDYA 5LJ5e 5GAN8 2EJ9A 3NTIA 5HK0A 1S72T 4FSXA 1NPPA 4FT4A 2RO0A 5LJ3f 1VQ9A 3BY7A 1UGRB 4C5GA 3G6ET 2MAMA 3V8LA 1WQWA 4FIBA 3RKXA 2QEXT 1K73C 5CKHA 3DKMA 3E1SA 2RHZA 2P0PA 3FRNA 4BI3A 5GANh 4OP0A 2XG8D 3J80E 3UPUA 1IREB 4J7IA 5GAN7 3JB9D 3OYKA 1VQLA 4C0FA 3RESA 3SFMA 2VGNA 2LNVA 2RHYA 3WVEB 3X28B 3LWIA 3MO8A 4E7IA 1M8VA 3GF5A 4XU2A 3M54A 3QHSA 3QG1A 4C92A 4OB2B 3CBPA 3CCST 1KC8U 4N4GA 5GAMf 1KQSA 2K3YA 4XQ3A 3LLRA 1R8OB 2Y4XA 3G71T 5IAYA 4XTXA 2FL7A 4M77E 3SWNC 5GAN5 5A2QE 4BB7A 3VU3C 2A7YA 2O01E 1N9RA 3I56T 1X6OA 5HY6A 1VQ4A 3JCMe 1M1FA 4XTYA 1Y07A 1ZBXA 1BI3A 5CIUA 3CCUA 4O5VA 3VV0A 4C8QD 2YRVA 2P0QA 3A8HB 4BD3A 5J26A 3JCMQ 4YTLA 4M7DD 3VUBA 3SDZA 4IURA 4M77B 1DJ7B 1HK9A 3HRTA 3L2VA 3RKYA 4C5HA 5DM7R 5A0LA 1VQPA 3X20B 3CC2A 2DTIA 3MP1A 3C12A 3BFMA 4BY6C 3QJYA 4L5GA 1Q86C 2C06A 4QVCA 5GMKj 3OB9A 3QZ5B 4C8QC 1WJQA 1YJNT 2E5QA 3WXMB 2XU8A 4J6WA 3RKWA 3MP6A 3JCMc 2EQUA 2HQEA 3FEOA 5J39A 1N27A 4M77G 2A3LA 4X34A 3ER0A 2RB6A 3P8BB 5M9OA 1I5LA 3OYFA 3PIOA 5LJ3e 4XU0A 4KUDK 5FROA 2RHUA 4IUTA 3LX7A 4RG8A 2X4WA 1HXDA 3F70A 3RIRA 3M59A 4EMKC 3JB9I 3OYLA 1WJRA 5DLOA 2X4JA 3FDRA 5LJ3g 3PMIA 5GAOr 1QVFS 1MHNA 2RJDA 3HL8A 5GAMd 1VQMA 1M1KU 1UB4A 2LRQA 1VQ6A 3JB9F 2LQKA 3EFRA 4F7UF 3P8DA 5GMKh 2H3JA 5A0GA 5LJ5f 1W4SA 2JUFA 3BDLA 5CQYA 2JTMA 2VXEA 2QA4T 3VYGA 4A4HA 2E41A 2XHCA 1B34B 5A0DA 5FU7B 2M0OA 3CMET 4C8QA 1M90C 1RI0A 1K73U 2G3RA 4BI4A 4M7DA 3HRSA 1EIFA 5HK3A 2RJFA 1G3WA 4J7FA 2NLUA 2EJFA 2M1HA 1M1GA 3OYYA 5GAMg 2QDYB 2RM4A 2CZ1B 2RA2A 3MCAB 3JCMX 5CKFA 1YJWA 2CZ7B 3E9GA 4C8QF 2ZCFB 1X01A 1X75C 2CZ6B 4M7DF 3CC7T 5IN1A 3L2RA 3S3NA 4DA4A 3CCQA 4XU3A 4B9XA 5GAMj 1NZ9A 1XOVA 3OYJA 4HT9A 5GAN4 1ZQ1A 2DTHA 3FB9A 1WJSA 2X4YA 3VUZA 1VQOA 3QJ6A 1VQKA 4II1A 1NE8A 4QVDA 1WNLA 1IZ6A 4JLGA 3CCVT 1YI2A 2KK4A 4QQGA 2MMPA 5D6XA 4FM4B 4JUVA 4RKUE 2DKGA 4C0ZA 2DVEA 2RI5A 2DXTA 2JTFA 5KH6A 4C92D 3GNGA 2EKOA 3OW2S 4XTZA 4IKFA 3JCMf 2KQWA 2CYZB 2Y90A 3EAEA 1VQ8A 3CCMT 3DB4A 2OTLT 3CPWA 5LJ5d 3KXTA 1JRIA 3CMAT 1WQ7A 2E6NA 5GAMh 4DOVA 3X26B 4C92C 2MI6A 3PMTA 3NTHA 4A4EA 3N5BB 1Y96B 4F7UE 5CQXA 1S72A 1Q86U 2CZ0B 2EQJA 4PNOA 3CCJT 4KULA 4HCZA 2LC4A 2XKOC 3CCRT 1BIBA 3R6OA 4QQDA 2QEXA 4PJOD 4FL6A 3QZ9B 3JCMJ 2K2VA 4F7UB 3CBOA 4M7AD 1V29B 3C95A 4M75D 2R57A 2EQKA 2QQBA 2JZ2A 3SWNB 5LJ5g 4OGCA 3M53A 3JB9J 3LYIA 2DXCA 3PNWC 3QDRB 3MHXA 4Y91A 4M78D 1KG1A 1K9MC 3AHUA 3UDCA 1BYMA 3CPFA 2DXUA 2D6FA 3ASKA 2BIVA 3A8OB 3VYHB 3DLMA 4C8QE 3CCSA 1YIJT 1UGSB 5GAN6 4BI8B 3M56A 2WSFE 4BE0A 4ZN1A 3TU4K 3JB9G 4M75C 4F7UG 1Q7YU 1XNIA 2K5IA 3A8GB 4RMOA 2O4XB 4XTUA 5FU6C 1VQ7T 3T9NA 2RK2A 4BE1A 3NTKA 3JCMd 3GPLA 3Q1JA 4M78C 1JJ2A 3OSVA 4BY6B 4LD9K 1SSFA 1WGSA 3I56A 2VUBA 4BDYA 5IT9E 3OYCA 3V7CA 3OS0A 4MZTA 4J6XA 4JRPA 1M90U 2K5LA 4TVRA 2EJGA 3QYHB 3DLLA 3JCMP 2KVQG 4Q5WA 3TREA 2XIDA 4C92F 1D3BB 1VQ9T 2DK3A 3H8ZA 2XD0A 4PL6A 4FU6A 2L5QA 5CKDA 1M9SA 4PKCC 5HKCA 1M5Q1 5LJ5h 3PIPA 1YJ9T 3OS5A 4DQ2A 4E47A 1Y71A 4EMKB 5GMKl 2MWOA 2K3XA 4C0DC 2F5KA 1O9SA 2DXBA 3JCMg 4E7LA 1YJNA 4N0AA 4MMLA 5EG2A 2QQ9A 4PJOA 2WSCE 3OYGA 1Q82U 3MEWA 5LJ3d 2V8KA 1KQ1A 5I2SA 3RERA 1FWZA 1OZ2A 2QXFA 3DB3A 4ELYC 4M7AA 4M75A 1KHCA 1WPYA 3M4GA 3V7RA 1YHQT 4M7DC 3HP9A 3J7AF 3OMGA 1P92A 4M78A 4RCCA 3LH0A 1G3YA 2LVMA 2XDPA 3KUFA 5DLQE 1LJOA 5CK9A 5KE3A 2YHTA 4A53A 3OYIA 3OYMA 2JN0A 1G3TA 2GFAA 4OB1B 2EYQA 2HQXA 4M75F 1PSFA 4FT2A 3A8LB 4EDUA 3OYBA 4JRQA 3HPWA 2M16A 3OBWA 1Q81C 2MF2A 4J5YA 3MEAA 4ZTFA 4MDWA 4M78F 4E7KA 3ZBDA 4RG2A 2GF7A 2GFUA 2QA4A 2LT4A 1KQ2A 5J3BA 3I55T 5FLXE 4A54A 2DD4A 1BI0A 3GNFB 2LDMA 4NS5A 3X24B 4D6WA 3JCMh 1I81A 3OY9A 3CMEA 1G3SA 4JJNK 3SB2A 2ZPGB 4B9WA 5LJ3j 4M77D 1KD1C 4E7JA 2YLBA 2P4TA 2ZPEB 2EQMA 3VKIA 1NJIC 4GY5A 2D9TA 2OTJT 1KQSS 4J83A 3BW1A 2K57A 4C92E 1QVPA 1I8FA 3M57A 3L2ZA 4NL2A 4OMFB 1BI2A 2VGMA 4OF1A 1K9MU 3OYEA 1AHJB 3A5ZB 3CC7A 2KSSA 5GAOm 4JS5A 3RMQA 2FHDA 2M9UA 3ZFJA 2I2LA 2K5FA 4WF2A 2E6ZA 4EPCA 5GAOp 4XTVA 2X35A 5GAN2 1H3ZA 1M1KC 3M55A 3INZA 5DY9A 2XICA 1QVGA 2HBPA 3L2QA 4C92B 5LJ3h 3G4ST 1I4K1 3J81E 1K8AC 3V7SA 1N9SA 2E10A 1VQ6T 2DIGA 3CC4T 2PU9B 1N6AA 5LL6S 2L8DA 4NOYA 2E70A 3CCMA 4J6YA 3LWHA 3RUXA 2OTLA 3LGFA 1BIAA 2K4YA 3CMAA 2FVUA 4ZGEB 3CEYA 2WACA 2MWPA 2LQ8A 2DTOA 4L6V5 2KDSA 3OSSC 4Z02A 4C92G 5CAIA 3JCMW 4M75E 1D3BA 4L59A 4JS4A 4QQ6A 3PGGA 4KUIA 1UGPB 4O6JA 3JCMb 5KE2A 4M78E 3FIFA 3CCJA 4R56A 1JB0E 1MGQA 4ZN3A 4PLIA 4CI0C 1VQ5T 4QW2A 3V8JA 2RHXA 1O75A 4M77A 1JBMA 2QQAA 3M4YA 4X9DA 4XTWA 5C0MA 4HCCA 1H641 2PVDB 2F5TX 4RCBA 2PQWA 5FU6B 5GANe 3FC3A 3CCQT 2E12A 4N4HA 3CD6T 2EIFA 3G6EA 1FXXA 2R5AA 5D6YA 4OVAA 1VQNT 3HFNA 4ME7A 4Y28E 5GAOl 1YIJA 3M58A 2ZPIB 1XTDA 2RJCA 4C5EA 2IVWA 2E1HA 4IUUA 4PLLA 3UT1A 2GCXA 2R58A 2L3RA 4N0AC 4PJOC 3JSCA 3JCMV 5CR2A 4M78G 4A4KA 4ZTJA 5GAN3 1YBYA 2FYKA 1VIEA 1ZHIA 2VC8A 3FLGA 4X9CA 2YLCA 5LJ5j 1W2BA 4HT8A 3QO3A 3UWNA 1VIFA 2ZZDA 3RMSA 5GAOq 4M7AC 5L8RE 3CCLT 2QQRA 5KCHA 4HKEA 3G71A 4A4GA 1KD1U 2CKKA 3CCET 2DIQA 4MZPA 1NJIU 5FRNA 4C8QB 4EMGA 1BI1A 3P8HA 4OB3B 1B34A 2BUDA 4M7DB 1YJ9A 2LX9A 3MEUA 2DPPB 3META 4OGEA 4MDXA 4XAXB 1QVFA 2JVVA 4ATOA 2CGHA 4A4FA 3OS2A 1OZ3A 5FRMA 2DEQA 2RK1A 1LOJA 1BKBA 3GP8A 2LT1A 3CPWS 4C8QG 4KBMB 2DAQA 3QIIA 4J8OA 3OYHA 1K8AU 5AYFA 4C5IA 1YHQA 2QQSA 3L1AA 2IG0A 3NFCA 4M7DG 3KBGA 3QBYA 3OMCA 4XU1A 3SD4A 4E7HA 3TEEA 1VQLT 4GLKA 3L42A 4LDUA 4JDSA 3ZEHA 4R55A 2KY9A 3QSUA 3OQ5A 3WVDB 1YITA 3E19A 3CXCA 5KCOA 4PJOF 3URGA 5GMKe 1QP3A 1NPRA 2DZ9A 4C0GA 2R5MA 2CS7A 3C4SA 2EFIA 5I21A 3VJPA 4JRKA 2LTOA 3QPHA 4M7AF 4P5NA 3I55A 2Y4YA 3L2UA 3JB9H 1QP2A 1M4ZA 5I2MA 3X25B 4IUVA 2E65A 5D6WA 1VQ4T 5C6SA 2PUKB 3CCUT 2ZPHB 4QVZA 5GANf 4DOWA 1N8RC 1Y96A 3S3MA 1W2BS 2LCCA 3MP8A 3BDUA 3LW5E 4OB0B 2OTJA 3S6WA 4LD6A 1VQPT 3OW2A 3QYGB 5GAOn 3PT9A 2EWNA 3S3OA 1JJ2S 3EFSA 4XK8E 1LNXA 3OYDA 1U1TA 2DJZA 2QI2A 2RJEA 3OBYA 4JLIA 5CKEA 3OYNA 1XQHA 2XK0A 4F7UA 2L89A 1Y7XA 4IUPA 2ZPFB 2V8IA 5CCAA 3OA6A 3SWNA 3V8KA 2WSEE 2OAUA 4ZGDB 1VUBA 3C94A 4M77C 2XI9A 3G4SA 4M7DE 3O8VA 4BACA 2JNGA 3L2WA 2AHJB 2ZPBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  3V8J A;  3RKY A;  3JB9 G;  4M75 C;  4M77 A;  4MMK A;  4F7U G;  1JBM A;  2DTI A;  4XTU A;  4V2S A;  3BFM A;  4X9D A;  3HFO A;  4XTW A;  3JCM d;  4QVC A;  1H64 1;  4M78 C;  4RCB A;  4C8Q C;  5GAN e;  5GMK j;  3JB9 F;  4J6W A;  3RKW A;  4EMH A;  3JCM c;  3V7C A;  2E64 A;  4J6X A;  5GAM e;  4M77 G;  2EJG A;  3JCM P;  2RB6 A;  2RD1 A;  4PJO E;  1I5L A;  3HFN A;  5LJ3 e;  4XU0 A;  5GAO l;  4C92 F;  1D3B B;  2QTX A;  4HA8 A;  3RIR A;  3JB9 I;  2E1H A;  4EMK C;  1HXD A;  5GAN d;  3HSB A;  4M7A E;  5LJ5 h;  1M5Q 1;  4N0A C;  3GIB A;  4DQ2 A;  5GMK i;  3JCM V;  4EMK B;  5GMK l;  4M78 G;  5LJ3 g;  5GAO r;  4PJO C;  5GAM d;  5GAN 3;  4EMK A;  4NL3 A;  4PJO B;  2FYK A;  2VC8 A;  3JCM g;  5LJ5 j;  1KQ2 A;  3EFR A;  4N0A A;  2YLC A;  4MML A;  4X9C A;  4F7U F;  3QO3 A;  5GMK h;  4HT8 A;  5GAO q;  4M7A C;  5LJ3 d;  4M7D E;  4PJO A;  3QUI A;  5LJ5 f;  1KQ1 A;  3RER A;  4M7A B;  4M75 B;  2FB7 A;  2VXE A;  3FJP A;  4M7A A;  4M75 A;  1WPY A;  3M4G A;  3V7R A;  2E41 A;  4M7D C;  1B34 B;  4C8Q E;  4M78 B;  4C8Q B;  4EMG A;  2HNI A;  1B34 A;  4M77 F;  4M78 A;  4RCC A;  4PJO G;  4C8Q A;  4M7D B;  1YCY A;  1LJO A;  5GAN g;  2YHT A;  4A53 A;  4M7D A;  4JRI A;  2JN0 A;  2VXF A;  4M75 F;  2EJF A;  4M7A G;  4M75 G;  5GAM g;  2CGH A;  2RM4 A;  2RA2 A;  3JCM X;  4J5Y A;  1TH7 A;  2DEQ A;  2EAY A;  4M78 F;  1LOJ A;  4C8Q F;  5GAN j;  1X01 A;  4C8Q G;  5GMK m;  4M7D F;  4M7D G;  2DZC A;  4A54 A;  1U1S A;  3L1A A;  4XU3 A;  5GAN 6;  5GAM j;  4HT9 A;  4XU1 A;  5GAN 4;  3FB9 A;  2DTH A;  2ZGW A;  1I81 A;  3JCM h;  3SB2 A;  5LJ3 j;  4M77 D;  4QVD A;  5LJ5 e;  2EJ9 A;  1WNL A;  5GAN 8;  2YLB A;  4JUV A;  5LJ3 f;  2DKG A;  3QSU A;  2DVE A;  2DXT A;  3BY7 A;  4C92 D;  4XTZ A;  4PJO F;  3JCM f;  5GMK e;  2Y90 A;  2DZ9 A;  3BW1 A;  1WQW A;  3V8L A;  3RKX A;  2K57 A;  4C92 E;  5I21 A;  1I8F A;  4NL2 A;  3L2Z A;  4JRK A;  4M7A F;  5GAN h;  4OP0 A;  5GAO m;  5LJ5 d;  3JB9 H;  1JRI A;  5GAN 7;  3JB9 D;  2E65 A;  2I2L A;  1WQ7 A;  4WF2 A;  3RES A;  5GAO p;  5GAM h;  4XTV A;  5GAN 2;  4C92 C;  5DY9 A;  3INZ A;  4F7U E;  1Y96 B;  1M8V A;  4C92 B;  5LJ3 h;  5GAN f;  1I4K 1;  4XU2 A;  1Y96 A;  3V7S A;  3QHS A;  1N9S A;  2E10 A;  4PNO A;  4C92 A;  3BDU A;  5GAM f;  1BIB A;  4PJO D;  4NOY A;  4XQ3 A;  5GAO n;  2EWN A;  4J6Y A;  3EFS A;  1LNX A;  3RUX A;  3JCM J;  4XTX A;  4M77 E;  1U1T A;  1BIA A;  2DJZ A;  3SWN C;  4JLI A;  4F7U B;  5GAN 5;  4M7A D;  4M75 D;  3VU3 C;  3JB9 J;  4F7U A;  3SWN B;  1N9R A;  5LJ5 g;  2DTO A;  4C92 G;  3JCM W;  5CAI A;  3JCM e;  4M75 E;  1D3B A;  4XTY A;  3SWN A;  4Y91 A;  3V8K A;  4M78 D;  4C8Q D;  3AHU A;  4M77 C;  2DXU A;  3PGG A;  3JCM Q;  3JCM b;  4M7D D;  4M78 E;  3FIF A;  1MGQ A;  4M77 B; 
#chains in the Genus database with same CATH topology
 3UA6 A;  1Q7Y C;  1JXO A;  1UDL A;  3CCV A;  1KK7 A;  1UEB A;  1V76 A;  2J05 A;  1RLP C;  2DO3 A;  2RD1 A;  3E9F A;  3ME9 A;  4HCK A;  1M2O A;  3HKS A;  3VS3 A;  1OX8 A;  3MKD A;  2QTX A;  3H0I A;  1VQ5 A;  1W6X A;  4HA8 A;  2YSQ A;  4BDZ A;  1OU8 A;  3MEV A;  3LGL A;  3GIB A;  1U06 A;  1SF9 A;  2DD5 A;  2XDB A;  2D8J A;  3QUI A;  2CT3 A;  2RI3 A;  2FB7 A;  3KFV A;  2X4X A;  3I5R A;  1JU5 C;  3CCE Q;  3H9N A;  3A8M B;  4LDW A;  1JXM A;  3PFS A;  2JOY A;  1YCY A;  2D0Q B;  4ZNX A;  1YI2 T;  3QXE B;  3GLX A;  3ZL7 C;  3PTA A;  4IUQ A;  1QVF P;  3RDV A;  4E7Z A;  1TH7 A;  1VQ7 A;  4LE9 A;  2RI2 A;  2KAF A;  4CC3 A;  4UC4 A;  4C0D B;  1OI1 A;  2E4H A;  2ZGW A;  1QVG S;  1VQL Q;  3NTI A;  1S72 T;  4FSX A;  1VQ9 A;  1YHQ Q;  4WTO B;  2RPN A;  3FRN A;  4BI3 A;  4J7I A;  2LNH B;  1M90 R;  3EG1 A;  2KBT A;  2RHY A;  3LWI A;  2MYS A;  1AWO A;  1M8V A;  3VS4 A;  3M54 A;  4C92 A;  2NUP B;  3CBP A;  4OB2 B;  3CCS T;  2DVJ A;  4N4G A;  3LLR A;  2L0A A;  5IAY A;  4XTX A;  5GAN 5;  5A2Q E;  2J7I A;  3QWX X;  2FO0 A;  1GCQ A;  1VQ4 A;  3JCM e;  3CCU A;  1BI3 A;  1OPL A;  4C8Q D;  1M2V A;  4M7D D;  1DJ7 B;  4M4Z A;  3L2V A;  3RKY A;  1VQP A;  1D1B A;  2DTI A;  4ORZ A;  3OB9 A;  4C8Q C;  1WJQ A;  3C0C A;  4CC2 A;  4J6W A;  2RQU A;  4CC7 A;  2HQE A;  1ZBJ A;  2A3L A;  1I5L A;  3OYF A;  3PIO A;  4KUD K;  4XU0 A;  1RAA B;  4IUT A;  4RG8 A;  3M59 A;  3NPF A;  5LJ3 g;  5GAO r;  1VQ6 A;  1UB4 A;  2LRQ A;  2HZY A;  1NYG A;  1VA7 A;  1W4S A;  5AT1 B;  2A28 A;  2M0O A;  3CME T;  1W70 A;  1MV3 A;  1BU1 A;  2RJF A;  2NWM A;  1PKS A;  2CZ1 B;  2CZ7 B;  1VQ8 Q;  3CC7 T;  5KYN A;  3CCQ A;  5GAN 4;  3FB9 A;  2RQT A;  4II1 A;  1AVZ C;  4DBR A;  1WNL A;  1IZ6 A;  1YI2 A;  1C1A A;  2KK4 A;  5D6X A;  4FM4 B;  4C0Z A;  1EX4 A;  2AKL A;  5KH6 A;  3JCM f;  2E6N A;  2CUB A;  1MV0 B;  2CDT A;  4A4E A;  1Y96 B;  5KYY B;  1S72 A;  2CZ0 B;  2EQJ A;  1M3B A;  1OOT A;  2SEM A;  1D0Z A;  2MIO A;  2O31 A;  3C95 A;  2DBM A;  4R0K A;  2R57 A;  2DXC A;  1E6G A;  1K9M C;  3VYH B;  3DLM A;  3CCS A;  5GAN 6;  4BI8 B;  3M56 A;  2WSF E;  3TU4 K;  3A8G B;  4RMO A;  2RK2 A;  3VRZ A;  4LD9 K;  5IT9 E;  2VUB A;  1QCO A;  4GLM A;  4RTU A;  3OS0 A;  4J6X A;  4JRP A;  1AWW A;  1K8A R;  3QYH B;  3JCM P;  4Q5W A;  1D3B B;  2L2P A;  3M0P A;  4PKC C;  5HKC A;  4Z88 A;  1M5Q 1;  1YJ9 T;  1TWB A;  3OS5 A;  2J6F A;  4C0D C;  1O9S A;  2QQ9 A;  3OYG A;  2CT4 A;  4PJJ A;  1KQ1 A;  2E5K A;  1FWZ A;  2QXF A;  3MJX A;  5IXB A;  1KHC A;  1YHQ T;  4RCC A;  3LH0 A;  1LJO A;  1T3S A;  4A53 A;  3OYM A;  1G3T A;  2J06 A;  4OB1 B;  4M75 F;  2COW A;  2M16 A;  4J5Y A;  2YRD A;  6AT1 B;  1QKW A;  4M78 F;  2GFU A;  2DL7 A;  4J9H A;  5FLX E;  4AFQ C;  2DD4 A;  3GNF B;  3OY9 A;  4D6W A;  1I81 A;  3CME A;  1G3S A;  4B9W A;  2P4T A;  3VKI A;  1NJI C;  2D9T A;  1KQS S;  4J83 A;  1I8F A;  1BI2 A;  1K9M U;  1AHJ B;  3CC7 A;  3VS5 A;  1GFC A;  1B07 A;  4AFZ C;  2OTL Q;  3RMQ A;  2QAS A;  4J9D A;  2E6Z A;  5GAN 2;  3M55 A;  5DY9 A;  4C92 B;  1KFZ A;  3V7S A;  1OX9 A;  3JV3 A;  4J9C A;  4NOY A;  3LGF A;  1HSQ A;  3CEY A;  2MWP A;  2LX7 A;  5CAI A;  3G6E Q;  4L59 A;  1M2V B;  1JO8 A;  2Z0W A;  3FIF A;  4R56 A;  4ZN3 A;  3U23 A;  4JPB W;  2RHX A;  3M4Y A;  2QDL A;  5FU6 B;  2F5T X;  3CD6 T;  2GTJ A;  1Q95 G;  4RTY A;  1G2B A;  2DET A;  1FXX A;  1WX6 A;  3EG9 A;  1N8R R;  1TU0 B;  4FCY A;  4AFS C;  4ME7 A;  4F04 B;  1YWP A;  2DJQ A;  3M58 A;  1ZSZ C;  1XTD A;  2DFU A;  2DA9 A;  2GCX A;  2L3R A;  9ATC B;  4M78 G;  4ZTJ A;  2LMJ A;  1VIE A;  4M7D E;  1W2B A;  5GAO q;  3CCL T;  1M3A A;  2QQR A;  4ESR A;  8ATC B;  2LJ1 A;  1HJD A;  1NJI U;  5FRN A;  1X2Q A;  2MCN A;  3P8H A;  1B34 A;  2CRE A;  4B6M A;  1YJ9 A;  3VS7 A;  3MEU A;  2OI3 A;  3MET A;  4MDX A;  2FZK B;  4XAX B;  2YUO A;  2DEQ A;  1D1A A;  2VWF A;  3M0S A;  3QII A;  2L3Q A;  4C5I A;  1YHQ A;  2QQS A;  7AT1 B;  2IG0 A;  2QGG A;  3NFC A;  3KBG A;  4XU1 A;  4Z89 A;  4LUE A;  1PD1 A;  2DMO A;  2KY9 A;  3QSU A;  3WVD B;  3E19 A;  3CXC A;  4PJO F;  1B3Q A;  4C0G A;  2DZ9 A;  1D0X A;  1NLP C;  2EFI A;  4RTZ A;  1RLQ C;  4M7A F;  4P5N A;  3L2U A;  3JB9 H;  5I2M A;  2JMA A;  4IUV A;  5EC7 A;  2PUK B;  4JZ4 A;  2ABL A;  4KRT A;  1AD5 A;  4LD6 A;  1PC0 A;  3OW2 A;  1UGV A;  3S3O A;  1JJ2 S;  1UHF A;  3EFS A;  1LNX A;  1WYX A;  2RJE A;  1NBE B;  3OBY A;  4JLI A;  1XQH A;  2XK0 A;  1K9A A;  1Y7X A;  2L89 A;  2ZPF B;  5CCA A;  1J3T A;  1H8K A;  1UEC A;  2WSE E;  4ZGD B;  1VUB A;  3L2W A;  2ZPB B;  1FYN A;  2YUP A;  1K73 R;  1YIT T;  4PFO A;  2OJ2 A;  2PUO B;  3M0T A;  2GQV A;  2O4X A;  4HCB A;  1OYX A;  2P0K A;  1VQM T;  1LCK A;  3MPU B;  4N4I A;  1KC8 C;  4IIM A;  2PVG B;  1KHI A;  2X51 A;  1VQN Q;  1X2K A;  4OMP A;  2M02 A;  2W10 A;  2PVO B;  1TUD A;  2ATC B;  1QW1 A;  2V26 A;  3TCJ A;  5CKB A;  4EMK A;  3CD6 A;  1YIJ Q;  3CCR A;  1D09 B;  3EFO A;  2RH2 A;  4VUB A;  4ZGJ B;  2F69 A;  1OQK A;  2HSE B;  2HD0 A;  3H6Z A;  2HNI A;  2VYT A;  4M77 F;  4PJO G;  1VQK T;  4JRI A;  1XJW B;  4M7A G;  3EGU A;  1R0B G;  3M0U A;  1KIK A;  3CCL A;  2FRY A;  3G7Z A;  4PFZ A;  5GMK m;  1SRM A;  1RL2 A;  2GGR A;  1G5V A;  2DL4 A;  2O2O A;  4LDY A;  1K0X A;  5GAN 8;  2EJ9 A;  5HK0 A;  2EYW A;  5LJ3 f;  4FT4 A;  2IPO B;  3G6E T;  3V8L A;  5CKH A;  3E1S A;  2RHZ A;  5I22 A;  3EGX A;  3UPU A;  3JB9 D;  3RES A;  4GBQ A;  3X28 B;  3MO8 A;  1R77 A;  1VYV A;  4HXJ A;  2KR3 A;  1BCO A;  3QG1 A;  1KC8 U;  1GBQ A;  3OW2 P;  1YWO A;  2AZS A;  1R8O B;  1X27 A;  2DL5 A;  3SWN C;  1R0C B;  3VU3 C;  2X3W D;  5HY6 A;  1M1F A;  1Y07 A;  5CIU A;  3TSW A;  2P0Q A;  2W0Z A;  5J26 A;  4YTL A;  3SDZ A;  4C5H A;  5KYU A;  3EGD A;  3BFM A;  4L5G A;  2C0I A;  1Q86 C;  2C06 A;  4QVC A;  1YJN T;  3EG9 B;  2EQI A;  2E5Q A;  3WXM B;  2XU8 A;  5J39 A;  2HKN A;  4M77 G;  4X34 A;  2RB6 A;  2KGT A;  3P8B B;  5M9O A;  1MNE A;  2F2V A;  1BB9 A;  2DF6 A;  1YIT A;  2X4W A;  2ED1 A;  3F70 A;  2AIR B;  3PMI A;  2RJD A;  3HL8 A;  5GAM d;  5FWC A;  1VQM A;  1M1K U;  1IGU A;  1JEG A;  4F7U F;  3P8D A;  2KXD A;  2JUF A;  1YJW Q;  2JTM A;  2VXE A;  1B34 B;  5FU7 B;  1RI0 A;  1M3C A;  2G3R A;  3HRS A;  4KGX B;  5HK3 A;  3VS2 A;  1G3W A;  4J7F A;  2NLU A;  2EJF A;  1M1G A;  5GAM g;  2RA2 A;  3MCA B;  1CKA A;  1C6V X;  4RUG A;  4C8Q F;  1X75 C;  3GBQ A;  4M7D F;  5IN1 A;  1E6H A;  2CP5 A;  5GAM j;  1TUC A;  4HT9 A;  1ZQ1 A;  3VUZ A;  1VQK A;  1NE8 A;  1NG2 A;  2QTV A;  4Z8A A;  4QQG A;  3EH2 A;  4RKU E;  3TSZ A;  3EAE A;  1ARK A;  3DB4 A;  2ESW A;  3REB B;  2QEX Q;  3CPW A;  1ZUU A;  3CMA T;  4PJM A;  1I07 A;  5GAM h;  3X26 B;  2MI6 A;  2DRK A;  4PJN A;  2GNC A;  2RNA A;  5CQX A;  1Q86 U;  3QWY A;  4PNO A;  1PRM C;  5IHI A;  2A0F B;  1K76 A;  1BIB A;  3R6O A;  1OEB A;  2K2V A;  1H92 A;  1JQQ A;  2QQB A;  3VS0 A;  2JZ2 A;  2D8H A;  1SKU B;  1AWJ A;  1KD1 R;  2ROT A;  3RNJ A;  3AHU A;  1BYM A;  2DL3 A;  1YIJ T;  3EG0 A;  1Q7Y U;  4F7U G;  2K5I A;  2O4X B;  4XTU A;  3T9N A;  3D7S B;  3M0Q A;  3ULR B;  1UUE A;  3OSV A;  4BY6 B;  1WGS A;  1QQJ A;  1T0J A;  1X69 A;  1PNJ A;  3V7C A;  1YNZ A;  3BE3 A;  1SHF A;  3DLL A;  4JJC A;  3TRE A;  4FSS A;  2DK3 A;  3H8Z A;  4PL6 A;  4E7S A;  4F14 A;  4EMK B;  2MWO A;  3THK A;  2DXB A;  1YJN A;  2EYZ A;  3EFO B;  1WHL A;  4N0A A;  4PJO A;  2QG9 B;  3MEW A;  5LJ3 d;  2V8K A;  1OZ2 A;  4M7A A;  2QA4 Q;  4M7D C;  2JT4 A;  3OMG A;  1P92 A;  2FEI A;  2H8H A;  1G3Y A;  3OYI A;  2JN0 A;  2DL8 A;  3OYB A;  1PSF A;  1LVK A;  1Q81 C;  4ZTF A;  4MDW A;  4FYW B;  2K6D A;  2D0N A;  1BI0 A;  1D1C A;  1MMA A;  2AK5 A;  4JJN K;  2YRC A;  5LJ3 j;  2HSP A;  2OTJ T;  1G83 A;  3BW1 A;  4C92 E;  2CUD A;  3EGX B;  3M57 A;  3PVQ A;  1PWT A;  2K2M A;  1IHV A;  3OYE A;  3A5Z B;  3CPW P;  2M9U A;  3ZFJ A;  2K5F A;  4EPC A;  3CC2 Q;  1ZUY A;  1BCM A;  2K7A A;  1QVG A;  3G4S T;  3RBB B;  5LJ3 h;  3J81 E;  4AG2 C;  2DIG A;  2ENM A;  4J6Y A;  1RAG B;  3EG3 A;  2RF0 A;  2A37 A;  3CMA A;  1ACM B;  3UAT A;  2ED0 A;  2KDS A;  3JCM W;  4RTW A;  4LUD A;  3PGG A;  4KUI A;  3JCM b;  1RAI B;  5KE2 A;  2JTE A;  5KYU B;  3V8J A;  4M77 A;  1O75 A;  1JBM A;  4FYV B;  2QQA A;  2MPX C;  1V1C A;  4HVU A;  1H64 1;  2PVD B;  3A1P A;  2XMF A;  2E12 A;  2CH4 W;  2B86 A;  4OVA A;  3G71 Q;  1YIJ A;  2EPD A;  1PKT A;  4C5E A;  2IVW A;  4PLL A;  4D8D A;  3UT1 A;  3JCM V;  2O88 A;  5GAN 3;  2C0O A;  3FLG A;  1KQ2 A;  2YLC A;  3QO3 A;  1VIF A;  5L8R E;  4HKE A;  1Z9Q A;  4FYY B;  3CCE T;  1Q7Y R;  1RAF B;  1BI1 A;  1U3O A;  4J9I A;  2CGH A;  3OS2 A;  2RK1 A;  2LT1 A;  2YDL A;  1IB8 A;  1PD0 A;  4J8O A;  1OUL A;  1GRI A;  3OMC A;  1VQL T;  4GLK A;  3L42 A;  1UTI A;  5KCO A;  3RR6 A;  3C4S A;  5I21 A;  2DIL A;  2KRM A;  3EH1 A;  2LTO A;  2P84 A;  1ABO A;  3X25 B;  2E65 A;  5D6W A;  4QVZ A;  1QVG P;  1T0H A;  1W2B S;  2JMC A;  4J9E A;  2OTJ A;  1QWE A;  3S6W A;  2JJ9 A;  5GAO n;  3PT9 A;  1GCP A;  3CCV Q;  1U1T A;  4AFU C;  5CKE A;  3OYN A;  2FG0 A;  4F7U A;  2KYM A;  4QKU A;  5ECA A;  3CCM Q;  3G4S A;  4BAC A;  1RAH B;  2KE9 A;  4MMK A;  1VQ5 Q;  4FW2 A;  4V2S A;  1TOV A;  4EMH A;  2X9H A;  5GAM e;  2GBQ A;  3CXC S;  4MZM A;  4KH0 B;  3JAM E;  1QMC A;  3HSB A;  2AT1 B;  5GAN d;  4JJD A;  1YFN A;  5GMK i;  4CRI A;  5CVI A;  4PJO B;  4KGV B;  2IIM A;  1Q82 C;  4M7A B;  1VQ7 Q;  3FJP A;  1PSE A;  4ELZ C;  2LJ0 A;  3HHT B;  2HDA A;  2MOX A;  2J6K A;  2V8J A;  2O9S A;  3OS1 A;  5CO7 A;  3NMZ C;  2RHI A;  5GAN g;  3M5A A;  2VXF A;  3HTR A;  3M9Q A;  2KMT A;  4M75 G;  2KXC A;  1VQ9 Q;  3CC2 T;  1VQ8 T;  5GAN j;  4LDV A;  2DZC A;  3CCE A;  2VV5 A;  1I0C A;  1NPP A;  2RMO A;  2RO0 A;  1HYO A;  2EKH A;  1MND A;  4C5G A;  2MAM A;  1WXU A;  3RKX A;  3J80 E;  1BBZ A;  2P0P A;  5GAN h;  4OMO A;  5GAN 7;  1VQL A;  4C0F A;  3SFM A;  2VKN A;  2LNV A;  3WVE B;  1VQ4 Q;  4E7I A;  5FWB A;  4XU2 A;  3QHS A;  3I55 Q;  4A63 B;  5GAM f;  1KQS A;  2K3Y A;  2HKQ B;  2Y4X A;  3G71 T;  2FL7 A;  4BB7 A;  2AKK A;  2A7Y A;  1AEY A;  2O01 E;  1N9R A;  4XTY A;  3SHW A;  1M8M A;  2COY A;  2YRV A;  4BD3 A;  2G6F X;  3JCM Q;  4M77 B;  3HRT A;  5DM7 R;  5A0L A;  3X20 B;  1WHG A;  3C12 A;  1YP5 A;  5GMK j;  1PCX A;  1VQ6 Q;  3RKW A;  3CC4 Q;  2BE9 B;  2EQU A;  3FEO A;  1N27 A;  3ER0 A;  1YCS B;  5LJ3 e;  2DLP A;  5KYX A;  2RHU A;  4DBQ A;  3LX7 A;  3I9Q A;  3FDR A;  1QVF S;  1MHN A;  1EZZ B;  3JB9 F;  3EFR A;  5GMK h;  1K9M R;  3BDL A;  1GL5 A;  1WHK A;  1WIE A;  5IHN A;  4A4H A;  2XHC A;  2FPE A;  2FZG B;  1C0M A;  5A0D A;  3CCQ Q;  3I35 A;  1M90 C;  2M1H A;  5GJV B;  3E9G A;  4J9G A;  2ZCF B;  4OMQ A;  3L2R A;  3S3N A;  4DA4 A;  1PG5 B;  4XU3 A;  3OYJ A;  4RTV A;  3QJ6 A;  4AG1 C;  3CCV T;  1CKB A;  2MMP A;  4JUV A;  2DKG A;  2DXT A;  2FPF A;  1S72 Q;  4C92 D;  2EKO A;  2KQW A;  2CYZ B;  3UA7 A;  1VQ8 A;  2QK0 A;  3CCM T;  1WLP B;  3E2U A;  2OTL T;  2V1R A;  4AT1 B;  5LJ5 d;  1CSK A;  3KXT A;  4LNP A;  4DOV A;  4C92 C;  3NTH A;  3N5B B;  5FW9 A;  4JJB A;  4KUL A;  4HCZ A;  2XKO C;  3CCS Q;  5GJW B;  4PJO D;  4FL6 A;  3QZ9 B;  1KQS P;  1GCQ C;  4QT7 A;  2X3X D;  3JCM J;  4F7U B;  2AZV A;  4M7A D;  1V29 B;  3JB9 J;  2EQK A;  5LJ5 g;  4OGC A;  3M53 A;  3PNW C;  3QDR B;  2LJ3 A;  1OV3 A;  3MHX A;  4Y91 A;  1KG1 A;  1NJI R;  3CPF A;  3FJ5 A;  1MMD A;  1N5Z A;  3ASK A;  3A8O B;  1UGS B;  4JZ3 A;  4BE0 A;  3JB9 G;  3G1J A;  1XNI A;  5FU6 C;  1VQ7 T;  4X1V A;  2FRW A;  2DBK A;  3NTK A;  1JJ2 A;  2OX7 A;  1SSF A;  1K4U S;  1QWF A;  4BDY A;  2LCS A;  4D8K A;  1M90 U;  2KVQ G;  2XID A;  1VQ9 T;  2XD0 A;  1RAC B;  2KI7 A;  2GQI A;  5CKD A;  5LJ5 h;  4DQ2 A;  4E47 A;  1ZSZ A;  1WA7 A;  2K3X A;  5KYW A;  1F1B B;  1NEB A;  2BZX A;  2F5K A;  2JS2 A;  2KT8 A;  4E7L A;  4MML A;  5EG2 A;  2WSC E;  3DB3 A;  4M75 A;  1WPY A;  3M4G A;  2KRO A;  3HP9 A;  1QCF A;  4M78 A;  5KE3 A;  5CK9 A;  2LVM A;  3KUF A;  4FYX B;  1K1Z A;  4EDU A;  4JRQ A;  1LPL A;  3HPW A;  2MF2 A;  2CP3 A;  4RG2 A;  5J3B A;  3I55 T;  4A54 A;  3CC7 Q;  2LDM A;  3X24 B;  2FZC B;  2PNI A;  3SB2 A;  2ZPG B;  4M77 D;  1M30 A;  2YLB A;  2EQM A;  2K57 A;  1QVP A;  1VQO Q;  3L2Z A;  2VGM A;  2KSS A;  5GAO m;  2FHD A;  2COZ A;  2I2L A;  1H3Z A;  5GAO p;  3INZ A;  3L2Q A;  1K8A C;  1I4K 1;  2E10 A;  1VQ6 T;  1SSH A;  3CC4 T;  2PU9 B;  1FMW A;  5LL6 S;  2JS0 A;  2E70 A;  3CCM A;  3LWH A;  2OTL A;  1BIA A;  2K4Y A;  2DYB A;  1AZE A;  4Z02 A;  4J9F A;  3OSS C;  4M75 E;  1D3B A;  4JS4 A;  2EYX A;  1UGP B;  1SPK A;  2KT1 A;  1TXQ A;  4M78 E;  1JB0 E;  1I1J A;  4QW2 A;  2YUN A;  1HD3 A;  3SEM A;  1SRL A;  4X9D A;  4RCB A;  1ABQ A;  2PQW A;  2P4R A;  2RQV A;  5GAN e;  3FC3 A;  1FMV A;  1Y0M A;  3CCQ T;  1JJ2 P;  3G6E A;  2R5A A;  4J9B A;  5D6Y A;  1VQN T;  2HEQ A;  5KYX B;  2ROL A;  2ZPI B;  2RJC A;  2E1H A;  3I56 Q;  1WI7 A;  2R58 A;  1AT1 B;  5CR2 A;  1YJ9 Q;  1UG1 A;  2FYK A;  2SRC A;  1ZHI A;  1AZG B;  4X9C A;  4HT8 A;  3H0H A;  2ZZD A;  2VVK A;  2NUT A;  4EMG A;  4OML A;  2OAW A;  4OB3 B;  2BUD A;  1TUG B;  2NYS A;  1NYF A;  2LX9 A;  2DPP B;  4OGE A;  1KC8 R;  2EVR A;  1M27 C;  2JVV A;  1UE9 A;  1RAD B;  4FW1 A;  1OZ3 A;  3O5Z A;  3GP8 A;  1D0Y A;  4C8Q G;  2DAQ A;  4DEY A;  1K8A U;  4M7D G;  3L1A A;  3SD4 A;  3REA B;  4LDU A;  3ZEH A;  3QDF A;  5D7U A;  3OQ5 A;  3TVT A;  4IIO A;  1UJY A;  3URG A;  5GMK e;  1QP3 A;  1FMK A;  3VJP A;  3I55 A;  2Y4Y A;  1M4Z A;  2PZ1 A;  2ZPH B;  3H41 A;  3IQL A;  4HVV A;  5GAN f;  4DOW A;  1N8R C;  5I11 A;  3S3M A;  2LCC A;  3MP8 A;  3BDU A;  3QYG B;  2EWN A;  1M1K R;  2V8I A;  3OA6 A;  3SWN A;  3V8K A;  1T3L A;  2OAU A;  3C94 A;  2XI9 A;  2V1Q A;  1TG0 A;  3CC4 A;  1H3H A;  2BKD N;  2HAX A;  1FX7 A;  2CH4 A;  3HFO A;  3GOX A;  2J6O A;  3JRZ A;  3CCJ Q;  3CD6 Q;  1GXI E;  2QYZ A;  3OYA A;  2E64 A;  1AWX A;  3CCR Q;  4PJO E;  1UGQ B;  3HRU A;  2HQH A;  4KGZ B;  4E6R A;  3TQ7 P;  4KT0 E;  4M7A E;  1ZSZ B;  4BUG A;  1W1F A;  5KYW B;  2I0N A;  4LDX A;  4NL3 A;  1TSF A;  2LCL A;  3CBM A;  3EGD B;  1YJW T;  3QKJ A;  4BE2 A;  4M75 B;  1VQN A;  3CCL Q;  5FU7 C;  3NHN A;  1QKX A;  4M78 B;  2XDD A;  2HCK A;  1VQO T;  1Q86 R;  2E3I A;  4RTX A;  2B8A A;  1Q81 U;  2EW3 A;  2EAY A;  2KNB B;  1U8R A;  2MK5 A;  4K11 A;  1N8R U;  1U1S A;  1IXD A;  3A98 A;  1WHM A;  5LJ5 e;  3BY7 A;  1UGR B;  3UF4 A;  1WQW A;  4FIB A;  2QEX T;  1K73 C;  3DKM A;  4OP0 A;  1ZA2 B;  2XG8 D;  2DER A;  1IRE B;  1PHT A;  3OYK A;  2VGN A;  1TS9 A;  1X43 A;  3GF5 A;  4PFP A;  1IRX A;  2CP2 A;  2ECZ A;  4XQ3 A;  4M77 E;  3VRY A;  1VYU A;  3I56 T;  3AT1 B;  1X6O A;  1ZA1 B;  2M51 A;  1ZBX A;  4O5V A;  3VV0 A;  3A8H B;  1BK2 A;  3VUB A;  2CP0 A;  4IUR A;  1HK9 A;  1YIT Q;  3MP1 A;  4BY6 C;  3QJY A;  3QZ5 B;  1VQM Q;  1NM7 A;  3MP6 A;  3JCM c;  1KJW A;  5HCK A;  1RAB B;  2RQW A;  2DX1 A;  3H0F A;  2KEA A;  5FRO A;  3RIR A;  2EBP A;  3JB9 I;  4EMK C;  1HXD A;  3OYL A;  4E2F B;  1WJR A;  5DLO A;  2X4J A;  2K3B A;  2K79 A;  2M0Y A;  2E3H A;  2CSQ A;  2LQK A;  2A08 A;  2H3J A;  5A0G A;  5LJ5 f;  5CQY A;  1Y57 A;  3I5S A;  1G8X A;  2NUT B;  2QA4 T;  3VYG A;  4WCI A;  2DNU A;  2E41 A;  4C8Q A;  3LH5 A;  1K73 U;  4BI4 A;  4M7D A;  1EIF A;  1VQK Q;  2CP7 A;  2DYI A;  4LXC A;  3OYY A;  2QDY B;  2RM4 A;  3JCM X;  2KYB A;  5CKF A;  1YJW A;  1WDX A;  2JM9 A;  2CSI A;  1B7T A;  1X01 A;  2CZ6 B;  1GFD A;  4B9X A;  1NZ9 A;  1XOV A;  1RI9 A;  2DTH A;  1WJS A;  2X4Y A;  1VQO A;  4QVD A;  4JLG A;  3EHR A;  1ZSG A;  2BE7 D;  2DVE A;  2RI5 A;  2JTF A;  3OW2 S;  3GNG A;  3NGP A;  4XTZ A;  4IKF A;  2Y90 A;  3VS1 A;  1WXT A;  4LN2 A;  1JRI A;  4DBF A;  1WQ7 A;  2HL5 C;  2NUZ A;  3PMT A;  4F7U E;  2DRM A;  2PTK A;  1VOM A;  4PJL A;  4Y92 A;  1QCN A;  4DBH A;  3CCJ T;  1Q81 R;  1I5O B;  2LC4 A;  3CCR T;  4QQD A;  2QEX A;  2JW4 A;  2FPD A;  1OU9 A;  3CBO A;  4M75 D;  1E7O A;  3SWN B;  3LYI A;  2YXY A;  4M78 D;  3UDC A;  2DXU A;  2D6F A;  1X6B A;  5IHK A;  2BIV A;  3EG2 A;  4C8Q E;  1KSW A;  2L3P A;  4ZN1 A;  4M75 C;  3CCU Q;  4BE1 A;  3JCM d;  3GPL A;  3Q1J A;  4M78 C;  3M0R A;  2EGA A;  1WFW A;  3I56 A;  1YJN Q;  3OYC A;  4MZT A;  1VQP Q;  2K5L A;  4TVR A;  2EJG A;  2BZ8 A;  2DE0 X;  1SG5 A;  4C92 F;  2GTO A;  4FU6 A;  4OMM A;  2L5Q A;  1M9S A;  3PIP A;  4HVW A;  1MMG A;  1WHH A;  1Y71 A;  2LQW A;  5GMK l;  2KRN A;  3JCM g;  1RUW A;  1Q82 U;  2H3E B;  2C0T A;  5I2S A;  3RER A;  2L3S A;  4ELY C;  4OMN A;  3V7R A;  1X6G A;  3J7A F;  4KH1 B;  5IH2 A;  2A36 A;  2XDP A;  5DLQ E;  2YHT A;  2EGE A;  2GFA A;  2EYQ A;  2HQX A;  4FT2 A;  3A8L B;  2HMA A;  3OBW A;  3MEA A;  2LP5 A;  2F2W A;  4E7K A;  1S1N A;  3ZBD A;  1SHG A;  2BTT A;  2F2X A;  2GF7 A;  2QA4 A;  2LT4 A;  4NS5 A;  3JCM h;  8AT1 B;  1KD1 C;  4E7J A;  2ZPE B;  2JM8 A;  4GY5 A;  2F1L A;  2EGC A;  1PM3 A;  1QLY A;  4OMF B;  4NL2 A;  4OF1 A;  1YI2 Q;  2YWW A;  4JS5 A;  1WZO A;  1ZUK A;  3CMA Q;  4WF2 A;  4XTV A;  2X35 A;  2KRS A;  2BZY A;  2XIC A;  2HBP A;  2K9G A;  1TTH B;  3PVL A;  1N9S A;  2NUP A;  1N6A A;  2L8D A;  1IGQ A;  3RUX A;  2EYY A;  2RQR A;  2FVU A;  1VYT A;  3EHQ A;  2WAC A;  4ZGE B;  2LQ8 A;  2DTO A;  4L6V 5;  4C92 G;  3CC2 A;  4QQ6 A;  4O6J A;  3CCJ A;  1MGQ A;  4PLI A;  4CI0 C;  1VQ5 T;  1W2B P;  2O9V A;  2HL3 A;  4XTW A;  5C0M A;  4HCC A;  1SEM A;  4N4H A;  2EIF A;  1OPK A;  3HFN A;  4Y28 E;  4DEX A;  2QGF B;  5GAO l;  4IUU A;  4N0A C;  4PJO C;  1UJ0 A;  3JSC A;  4A4K A;  1YBY A;  2VC8 A;  4ANJ A;  5LJ5 j;  1M1K C;  2DEU A;  2CP6 A;  2YUQ A;  4F16 A;  3UWN A;  4M7A C;  3RMS A;  1PRL C;  5KCH A;  3G71 A;  1K0S A;  4A4G A;  1KD1 U;  2D1X A;  2CKK A;  2DIQ A;  4MZP A;  1AOJ A;  1UFF A;  4C8Q B;  2VB6 A;  3CXC P;  4M7D B;  1WXB A;  1QVF A;  2LQN A;  4ATO A;  2RN8 A;  4A4F A;  3R6N A;  5FRM A;  1LOJ A;  1BKB A;  1Z9Z A;  4CC4 B;  2LZ6 B;  3CPW S;  4KBM B;  4PK4 A;  3OYH A;  5AYF A;  2JXB A;  3QBY A;  1WHJ A;  4E7H A;  3TEE A;  1GBR A;  5IXF A;  4JDS A;  3VS6 A;  4R55 A;  2YT6 A;  1Q82 R;  2VAS A;  1NPR A;  2OTJ Q;  2R5M A;  2CS7 A;  3CME Q;  4JRK A;  3QPH A;  1QP2 A;  4RTT A;  5L23 A;  1A0N B;  4F17 A;  2ZAE A;  1YN8 A;  1VQ4 T;  1IO6 A;  5C6S A;  3CCU T;  1MUZ A;  1ZLM A;  1Y96 A;  4EIK A;  3G4S Q;  5KYY A;  3LW5 E;  4OB0 B;  1IHW A;  2QAZ A;  3PE0 A;  3CQT A;  1UHC A;  1VQP T;  2DM1 A;  4AMC A;  4XK8 E;  3OYD A;  2HBW A;  1NLO C;  2QI2 A;  2DJZ A;  1U5S A;  1EFN A;  4IUP A;  1MMN A;  1RAE B;  1NEG A;  4M77 C;  3O8V A;  2JNG A;  1ZX6 A;  2AHJ B; 
#chains in the Genus database with same CATH homology
 3CC4 A;  1YIT T;  1Q7Y C;  2BKD N;  4MMK A;  3CCV A;  4V2S A;  2PUO B;  2HAX A;  1FX7 A;  3HFO A;  2GQV A;  2O4X A;  4HCB A;  1OYX A;  2P0K A;  3GOX A;  1VQM T;  1UEB A;  3JRZ A;  4N4I A;  1KC8 C;  1GXI E;  4EMH A;  2DO3 A;  3OYA A;  2E64 A;  5GAM e;  2PVG B;  1KHI A;  4PJO E;  2RD1 A;  3E9F A;  1UGQ B;  3ME9 A;  3HRU A;  3CXC S;  3HKS A;  4MZM A;  2QTX A;  3JAM E;  1VQ5 A;  4HA8 A;  2PVO B;  3HSB A;  4KT0 E;  4M7A E;  5GAN d;  4BDZ A;  4BUG A;  3MEV A;  3LGL A;  3TCJ A;  1QW1 A;  5GMK i;  3GIB A;  5CKB A;  4LDX A;  2DD5 A;  4CRI A;  5CVI A;  4EMK A;  4NL3 A;  2LCL A;  3CBM A;  2XDB A;  3CD6 A;  4PJO B;  3CCR A;  1Q82 C;  1YJW T;  3QUI A;  2RH2 A;  4VUB A;  3QKJ A;  4ZGJ B;  4M7A B;  4M75 B;  2RI3 A;  4BE2 A;  2FB7 A;  1VQN A;  2F69 A;  3FJP A;  1PSE A;  2X4X A;  3HHT B;  4ELZ C;  5FU7 C;  2HD0 A;  2V8J A;  3H6Z A;  4M78 B;  2XDD A;  2HNI A;  5CO7 A;  3OS1 A;  2VYT A;  3A8M B;  4LDW A;  4M77 F;  4PJO G;  3PFS A;  1VQO T;  2JOY A;  1YCY A;  2D0Q B;  2RHI A;  5GAN g;  3M5A A;  1YI2 T;  1VQK T;  4JRI A;  2VXF A;  3QXE B;  3GLX A;  3PTA A;  3M9Q A;  4IUQ A;  2KMT A;  4M75 G;  4M7A G;  2B8A A;  1Q81 U;  3CC2 T;  1VQ8 T;  1TH7 A;  2EAY A;  1VQ7 A;  3CCL A;  3G7Z A;  1U8R A;  5GAN j;  2RI2 A;  2KAF A;  5GMK m;  1N8R U;  4LDV A;  2DZC A;  3CCE A;  1U1S A;  2VV5 A;  4UC4 A;  1RL2 A;  4C0D B;  1OI1 A;  1G5V A;  2ZGW A;  1QVG S;  4LDY A;  5LJ5 e;  5GAN 8;  2EJ9 A;  3NTI A;  5HK0 A;  1S72 T;  4FSX A;  1NPP A;  4FT4 A;  2RO0 A;  5LJ3 f;  1VQ9 A;  3BY7 A;  1UGR B;  4C5G A;  3G6E T;  2MAM A;  3V8L A;  1WQW A;  4FIB A;  3RKX A;  2QEX T;  1K73 C;  5CKH A;  3DKM A;  3E1S A;  2RHZ A;  2P0P A;  3FRN A;  4BI3 A;  5GAN h;  4OP0 A;  2XG8 D;  3J80 E;  3UPU A;  1IRE B;  4J7I A;  5GAN 7;  3JB9 D;  3OYK A;  1VQL A;  4C0F A;  3RES A;  3SFM A;  2VGN A;  2LNV A;  2RHY A;  3WVE B;  3X28 B;  3LWI A;  3MO8 A;  4E7I A;  1M8V A;  3GF5 A;  4XU2 A;  3M54 A;  3QHS A;  3QG1 A;  4C92 A;  4OB2 B;  3CBP A;  3CCS T;  1KC8 U;  4N4G A;  5GAM f;  1KQS A;  2K3Y A;  4XQ3 A;  3LLR A;  1R8O B;  2Y4X A;  3G71 T;  5IAY A;  4XTX A;  2FL7 A;  4M77 E;  3SWN C;  5GAN 5;  5A2Q E;  4BB7 A;  3VU3 C;  2A7Y A;  2O01 E;  1N9R A;  3I56 T;  1X6O A;  5HY6 A;  1VQ4 A;  3JCM e;  1M1F A;  4XTY A;  1Y07 A;  1ZBX A;  1BI3 A;  5CIU A;  3CCU A;  4O5V A;  3VV0 A;  4C8Q D;  2YRV A;  2P0Q A;  3A8H B;  4BD3 A;  5J26 A;  3JCM Q;  4YTL A;  4M7D D;  3VUB A;  3SDZ A;  4IUR A;  4M77 B;  1DJ7 B;  1HK9 A;  3HRT A;  3L2V A;  3RKY A;  4C5H A;  5DM7 R;  5A0L A;  1VQP A;  3X20 B;  3CC2 A;  2DTI A;  3MP1 A;  3C12 A;  3BFM A;  4BY6 C;  3QJY A;  4L5G A;  1Q86 C;  2C06 A;  4QVC A;  5GMK j;  3OB9 A;  3QZ5 B;  4C8Q C;  1WJQ A;  1YJN T;  2E5Q A;  3WXM B;  2XU8 A;  4J6W A;  3RKW A;  3MP6 A;  3JCM c;  2EQU A;  2HQE A;  3FEO A;  5J39 A;  1N27 A;  4M77 G;  2A3L A;  4X34 A;  3ER0 A;  2RB6 A;  3P8B B;  5M9O A;  1I5L A;  3OYF A;  3PIO A;  5LJ3 e;  4XU0 A;  4KUD K;  5FRO A;  2RHU A;  4IUT A;  3LX7 A;  4RG8 A;  2X4W A;  1HXD A;  3F70 A;  3RIR A;  3M59 A;  4EMK C;  3JB9 I;  3OYL A;  1WJR A;  5DLO A;  2X4J A;  3FDR A;  5LJ3 g;  3PMI A;  5GAO r;  1QVF S;  1MHN A;  2RJD A;  3HL8 A;  5GAM d;  1VQM A;  1M1K U;  1UB4 A;  2LRQ A;  1VQ6 A;  3JB9 F;  2LQK A;  3EFR A;  4F7U F;  3P8D A;  5GMK h;  2H3J A;  5A0G A;  5LJ5 f;  1W4S A;  2JUF A;  3BDL A;  5CQY A;  2JTM A;  2VXE A;  2QA4 T;  3VYG A;  4A4H A;  2E41 A;  2XHC A;  1B34 B;  5A0D A;  5FU7 B;  2M0O A;  3CME T;  4C8Q A;  1M90 C;  1RI0 A;  1K73 U;  2G3R A;  4BI4 A;  4M7D A;  3HRS A;  1EIF A;  5HK3 A;  2RJF A;  1G3W A;  4J7F A;  2NLU A;  2EJF A;  2M1H A;  1M1G A;  3OYY A;  5GAM g;  2QDY B;  2RM4 A;  2CZ1 B;  2RA2 A;  3MCA B;  3JCM X;  5CKF A;  1YJW A;  2CZ7 B;  3E9G A;  4C8Q F;  2ZCF B;  1X01 A;  1X75 C;  2CZ6 B;  4M7D F;  3CC7 T;  5IN1 A;  3L2R A;  3S3N A;  4DA4 A;  3CCQ A;  4XU3 A;  4B9X A;  5GAM j;  1NZ9 A;  1XOV A;  3OYJ A;  4HT9 A;  5GAN 4;  1ZQ1 A;  2DTH A;  3FB9 A;  1WJS A;  2X4Y A;  3VUZ A;  1VQO A;  3QJ6 A;  1VQK A;  4II1 A;  1NE8 A;  4QVD A;  1WNL A;  1IZ6 A;  4JLG A;  3CCV T;  1YI2 A;  2KK4 A;  4QQG A;  2MMP A;  5D6X A;  4FM4 B;  4JUV A;  4RKU E;  2DKG A;  4C0Z A;  2DVE A;  2RI5 A;  2DXT A;  2JTF A;  5KH6 A;  4C92 D;  3GNG A;  2EKO A;  3OW2 S;  4XTZ A;  4IKF A;  3JCM f;  2KQW A;  2CYZ B;  2Y90 A;  3EAE A;  1VQ8 A;  3CCM T;  3DB4 A;  2OTL T;  3CPW A;  5LJ5 d;  3KXT A;  1JRI A;  3CMA T;  1WQ7 A;  2E6N A;  5GAM h;  4DOV A;  3X26 B;  4C92 C;  2MI6 A;  3PMT A;  3NTH A;  4A4E A;  3N5B B;  1Y96 B;  4F7U E;  5CQX A;  1S72 A;  1Q86 U;  2CZ0 B;  2EQJ A;  4PNO A;  3CCJ T;  4KUL A;  4HCZ A;  2LC4 A;  2XKO C;  3CCR T;  1BIB A;  3R6O A;  4QQD A;  2QEX A;  4PJO D;  4FL6 A;  3QZ9 B;  3JCM J;  2K2V A;  4F7U B;  3CBO A;  4M7A D;  1V29 B;  3C95 A;  4M75 D;  2R57 A;  2EQK A;  2QQB A;  2JZ2 A;  3SWN B;  5LJ5 g;  4OGC A;  3M53 A;  3JB9 J;  3LYI A;  2DXC A;  3PNW C;  3QDR B;  3MHX A;  4Y91 A;  4M78 D;  1KG1 A;  1K9M C;  3AHU A;  3UDC A;  1BYM A;  3CPF A;  2DXU A;  2D6F A;  3ASK A;  2BIV A;  3A8O B;  3VYH B;  3DLM A;  4C8Q E;  3CCS A;  1YIJ T;  1UGS B;  5GAN 6;  4BI8 B;  3M56 A;  2WSF E;  4BE0 A;  4ZN1 A;  3TU4 K;  3JB9 G;  4M75 C;  4F7U G;  1Q7Y U;  1XNI A;  2K5I A;  3A8G B;  4RMO A;  2O4X B;  4XTU A;  5FU6 C;  1VQ7 T;  3T9N A;  2RK2 A;  4BE1 A;  3NTK A;  3JCM d;  3GPL A;  3Q1J A;  4M78 C;  1JJ2 A;  3OSV A;  4BY6 B;  4LD9 K;  1SSF A;  1WGS A;  3I56 A;  2VUB A;  4BDY A;  5IT9 E;  3OYC A;  3V7C A;  3OS0 A;  4MZT A;  4J6X A;  4JRP A;  1M90 U;  2K5L A;  4TVR A;  2EJG A;  3QYH B;  3DLL A;  3JCM P;  2KVQ G;  4Q5W A;  3TRE A;  2XID A;  4C92 F;  1D3B B;  1VQ9 T;  2DK3 A;  3H8Z A;  2XD0 A;  4PL6 A;  4FU6 A;  2L5Q A;  5CKD A;  1M9S A;  4PKC C;  5HKC A;  1M5Q 1;  5LJ5 h;  3PIP A;  1YJ9 T;  3OS5 A;  4DQ2 A;  4E47 A;  1Y71 A;  4EMK B;  5GMK l;  2MWO A;  2K3X A;  4C0D C;  2F5K A;  1O9S A;  2DXB A;  3JCM g;  4E7L A;  1YJN A;  4N0A A;  4MML A;  5EG2 A;  2QQ9 A;  4PJO A;  2WSC E;  3OYG A;  1Q82 U;  3MEW A;  5LJ3 d;  2V8K A;  1KQ1 A;  5I2S A;  3RER A;  1FWZ A;  1OZ2 A;  2QXF A;  3DB3 A;  4ELY C;  4M7A A;  4M75 A;  1KHC A;  1WPY A;  3M4G A;  3V7R A;  1YHQ T;  4M7D C;  3HP9 A;  3J7A F;  3OMG A;  1P92 A;  4M78 A;  4RCC A;  3LH0 A;  1G3Y A;  2LVM A;  2XDP A;  3KUF A;  5DLQ E;  1LJO A;  5CK9 A;  5KE3 A;  2YHT A;  4A53 A;  3OYI A;  3OYM A;  2JN0 A;  1G3T A;  2GFA A;  4OB1 B;  2EYQ A;  2HQX A;  4M75 F;  1PSF A;  4FT2 A;  3A8L B;  4EDU A;  3OYB A;  4JRQ A;  3HPW A;  2M16 A;  3OBW A;  1Q81 C;  2MF2 A;  4J5Y A;  3MEA A;  4ZTF A;  4MDW A;  4M78 F;  4E7K A;  3ZBD A;  4RG2 A;  2GF7 A;  2GFU A;  2QA4 A;  2LT4 A;  1KQ2 A;  5J3B A;  3I55 T;  5FLX E;  4A54 A;  2DD4 A;  1BI0 A;  3GNF B;  2LDM A;  4NS5 A;  3X24 B;  4D6W A;  3JCM h;  1I81 A;  3OY9 A;  3CME A;  1G3S A;  4JJN K;  3SB2 A;  2ZPG B;  4B9W A;  5LJ3 j;  4M77 D;  1KD1 C;  4E7J A;  2YLB A;  2P4T A;  2ZPE B;  2EQM A;  3VKI A;  1NJI C;  4GY5 A;  2D9T A;  2OTJ T;  1KQS S;  4J83 A;  3BW1 A;  2K57 A;  4C92 E;  1QVP A;  1I8F A;  3M57 A;  3L2Z A;  4NL2 A;  4OMF B;  1BI2 A;  2VGM A;  4OF1 A;  1K9M U;  3OYE A;  1AHJ B;  3A5Z B;  3CC7 A;  2KSS A;  5GAO m;  4JS5 A;  3RMQ A;  2FHD A;  2M9U A;  3ZFJ A;  2I2L A;  2K5F A;  4WF2 A;  2E6Z A;  4EPC A;  5GAO p;  4XTV A;  2X35 A;  5GAN 2;  1H3Z A;  1M1K C;  3M55 A;  3INZ A;  5DY9 A;  2XIC A;  1QVG A;  2HBP A;  3L2Q A;  4C92 B;  5LJ3 h;  3G4S T;  1I4K 1;  3J81 E;  1K8A C;  3V7S A;  1N9S A;  2E10 A;  1VQ6 T;  2DIG A;  3CC4 T;  2PU9 B;  1N6A A;  5LL6 S;  2L8D A;  4NOY A;  2E70 A;  3CCM A;  4J6Y A;  3LWH A;  3RUX A;  2OTL A;  3LGF A;  1BIA A;  2K4Y A;  3CMA A;  2FVU A;  4ZGE B;  3CEY A;  2WAC A;  2MWP A;  2LQ8 A;  2DTO A;  4L6V 5;  2KDS A;  3OSS C;  4Z02 A;  4C92 G;  5CAI A;  3JCM W;  4M75 E;  1D3B A;  4L59 A;  4JS4 A;  4QQ6 A;  3PGG A;  4KUI A;  1UGP B;  4O6J A;  3JCM b;  5KE2 A;  4M78 E;  3FIF A;  3CCJ A;  4R56 A;  1JB0 E;  1MGQ A;  4ZN3 A;  4PLI A;  4CI0 C;  1VQ5 T;  4QW2 A;  3V8J A;  2RHX A;  1O75 A;  4M77 A;  1JBM A;  2QQA A;  3M4Y A;  4X9D A;  4XTW A;  5C0M A;  4HCC A;  1H64 1;  2PVD B;  2F5T X;  4RCB A;  2PQW A;  5FU6 B;  5GAN e;  3FC3 A;  3CCQ T;  2E12 A;  4N4H A;  3CD6 T;  2EIF A;  3G6E A;  1FXX A;  2R5A A;  5D6Y A;  4OVA A;  1VQN T;  3HFN A;  4ME7 A;  4Y28 E;  5GAO l;  1YIJ A;  3M58 A;  2ZPI B;  1XTD A;  2RJC A;  4C5E A;  2IVW A;  2E1H A;  4IUU A;  4PLL A;  3UT1 A;  2GCX A;  2R58 A;  2L3R A;  4N0A C;  4PJO C;  3JSC A;  3JCM V;  5CR2 A;  4M78 G;  4A4K A;  4ZTJ A;  5GAN 3;  1YBY A;  2FYK A;  1VIE A;  1ZHI A;  2VC8 A;  3FLG A;  4X9C A;  2YLC A;  5LJ5 j;  1W2B A;  4HT8 A;  3QO3 A;  3UWN A;  1VIF A;  2ZZD A;  3RMS A;  5GAO q;  4M7A C;  5L8R E;  3CCL T;  2QQR A;  5KCH A;  4HKE A;  3G71 A;  4A4G A;  1KD1 U;  2CKK A;  3CCE T;  2DIQ A;  4MZP A;  1NJI U;  5FRN A;  4C8Q B;  4EMG A;  1BI1 A;  3P8H A;  4OB3 B;  1B34 A;  2BUD A;  4M7D B;  1YJ9 A;  2LX9 A;  3MEU A;  2DPP B;  3MET A;  4OGE A;  4MDX A;  4XAX B;  1QVF A;  2JVV A;  4ATO A;  2CGH A;  4A4F A;  3OS2 A;  1OZ3 A;  5FRM A;  2DEQ A;  2RK1 A;  1LOJ A;  1BKB A;  3GP8 A;  2LT1 A;  3CPW S;  4C8Q G;  4KBM B;  2DAQ A;  3QII A;  4J8O A;  3OYH A;  1K8A U;  5AYF A;  4C5I A;  1YHQ A;  2QQS A;  3L1A A;  2IG0 A;  3NFC A;  4M7D G;  3KBG A;  3QBY A;  3OMC A;  4XU1 A;  3SD4 A;  4E7H A;  3TEE A;  1VQL T;  4GLK A;  3L42 A;  4LDU A;  4JDS A;  3ZEH A;  4R55 A;  2KY9 A;  3QSU A;  3OQ5 A;  3WVD B;  1YIT A;  3E19 A;  3CXC A;  5KCO A;  4PJO F;  3URG A;  5GMK e;  1QP3 A;  1NPR A;  2DZ9 A;  4C0G A;  2R5M A;  2CS7 A;  3C4S A;  2EFI A;  5I21 A;  3VJP A;  4JRK A;  2LTO A;  3QPH A;  4M7A F;  4P5N A;  3I55 A;  2Y4Y A;  3L2U A;  3JB9 H;  1QP2 A;  1M4Z A;  5I2M A;  3X25 B;  4IUV A;  2E65 A;  5D6W A;  1VQ4 T;  5C6S A;  2PUK B;  3CCU T;  2ZPH B;  4QVZ A;  5GAN f;  4DOW A;  1N8R C;  1Y96 A;  3S3M A;  1W2B S;  2LCC A;  3MP8 A;  3BDU A;  3LW5 E;  4OB0 B;  2OTJ A;  3S6W A;  4LD6 A;  1VQP T;  3OW2 A;  3QYG B;  5GAO n;  3PT9 A;  2EWN A;  3S3O A;  1JJ2 S;  3EFS A;  4XK8 E;  1LNX A;  3OYD A;  1U1T A;  2DJZ A;  2QI2 A;  2RJE A;  3OBY A;  4JLI A;  5CKE A;  3OYN A;  1XQH A;  2XK0 A;  4F7U A;  2L89 A;  1Y7X A;  4IUP A;  2ZPF B;  2V8I A;  5CCA A;  3OA6 A;  3SWN A;  3V8K A;  2WSE E;  2OAU A;  4ZGD B;  1VUB A;  3C94 A;  4M77 C;  2XI9 A;  3G4S A;  4M7D E;  3O8V A;  4BAC A;  2JNG A;  3L2W A;  2AHJ B;  2ZPB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...