1M90M

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1m90M02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1m90M01
3CCLO 3OW2N 3CCQO 2OTLL 3CC7O 3CCRL 1VQPL 3CCEO 3CPWK 3CCSL 1NJIM 1NJIP 1KQSK 1K9MM 1VQ7L 1K9MP 1VQ5L 1VQLL 1VQKL 3G4SL 1KD1M 1VQ9L 1KD1P 3CCJL 1YI2L 1K73M 1K73P 3G71O 3CC4O 1QVGK 1VQOL 3CD6L 3CMEO 1JJ2K 1QVFK 1YJWO 3CMAO 1VQ4L 3I56O 3CCUL 1VQ8L 3CPWN 1KQSN 3CC2L 1K8AM 1K8AP 3CCRO 1VQPO 3CXCK 3CCSO 1Q82P 3CCMO 1S72L 1VQLO 1YITL 1YJNO 1VQNL 1YI2O 2QA4O 1QVGN 1JJ2N 1YJ9L 1VQML 1QVFN 3I55L 1YHQL 1M1KP 1VQOO 3CD6O 1YIJO 1VQ4O 1VQ8O 3CCQL 3CXCN 3CCVL 3CC7L 1Q86M 1Q86P 3G6EL 1W2BK 2OTLO 1VQ6L 2QEXL 1Q82M 1S72O 1N8RM 1VQ7O 1VQ5O 1N8RP 1VQKO 3G4SO 1VQ9O 1YITO 1VQNO 3CCJO 3CC4L 1YJ9O 3CMEL 1YHQO 1M1KM 3I56L 2OTJL 1W2BN 3CCLL 3CCUO 3CCVO 3G6EO 3CCEL 3CC2O 1VQ6O 3OW2K 3CCML 2QEXO 1Q7YM 1Q7YP 1YJNL 2QA4L 3G71L 1KC8M 1M90M 1KC8P 1M90P 1Q81M 1Q81P 1VQMO 1YIJL 3I55O 1YJWL 3CMAL 2OTJO
chains in the Genus database with same CATH superfamily
5DQTA 3CCLO 3OW2N 3CCQO 2OTLL 3CC7O 3CCRL 1VQPL 3CCEO 3CPWK 3CCSL 1NJIM 1NJIP 1KQSK 1K9MM 1VQ7L 1K9MP 1VQ5L 1VQLL 1VQKL 3G4SL 1KD1M 1VQ9L 1KD1P 2YZSA 3CCJL 1YI2L 1K73M 1K73P 4XTKA 3G71O 3CC4O 1QVGK 1VQOL 3CD6L 3CMEO 1JJ2K 1QVFK 1YJWO 3CMAO 1VQ4L 3I56O 3CCUL 1VQ8L 3CPWN 1KQSN 3CC2L 1K8AM 1K8AP 3CCRO 1VQPO 3CXCK 3CCSO 1Q82P 3CCMO 1S72L 1VQLO 1YITL 4W8KA 1YJNO 1VQNL 1YI2O 2QA4O 1QVGN 4QDLA 1JJ2N 1YJ9L 1VQML 1QVFN 3I55L 4P6IC 1YHQL 1M1KP 1VQOO 3CD6O 1YIJO 5DS4A 1VQ4O 5DLJA 1VQ8O 3CCQL 3CXCN 3CCVL 3CC7L 1Q86M 1Q86P 3G6EL 1W2BK 2OTLO 1VQ6L 2QEXL 3NKDA 1Q82M 1S72O 1N8RM 1VQ7O 1VQ5O 1N8RP 1VQKO 3G4SO 1VQ9O 1YITO 1VQNO 3CCJO 5FCLA 3CC4L 1YJ9O 3CMEL 1YHQO 1M1KM 3I56L 2OTJL 1W2BN 3CCLL 3CCUO 3CCVO 3G6EO 3CCEL 5DQZA 3CC2O 1VQ6O 3OW2K 3CCML 2QEXO 4N06A 1Q7YM 1Q7YP 1YJNL 5DS6A 2QA4L 3GODA 3G71L 5DS5A 1KC8M 1M90M 1KC8P 1M90P 1Q81M 1Q81P 1VQMO 1YIJL 3I55O 4WJ0A 1YJWL 3CMAL 2OTJO
chains in the Genus database with same CATH topology
5DQTA 3CCLO 3OW2N 3CCQO 2OTLL 3CC7O 3CCRL 1VQPL 3CCEO 3CPWK 3CCSL 1NJIM 1NJIP 1KQSK 1K9MM 1VQ7L 1K9MP 1VQ5L 1VQLL 1VQKL 3G4SL 1KD1M 1VQ9L 1KD1P 2YZSA 3CCJL 1YI2L 1K73M 1K73P 4XTKA 3G71O 3CC4O 1QVGK 1VQOL 3CD6L 3CMEO 1JJ2K 1QVFK 1YJWO 3CMAO 1VQ4L 3I56O 3CCUL 1VQ8L 3CPWN 1KQSN 3CC2L 1K8AM 1K8AP 3CCRO 1VQPO 3CXCK 3CCSO 1Q82P 3CCMO 1S72L 1VQLO 1YITL 4W8KA 1YJNO 1VQNL 1YI2O 2QA4O 1QVGN 4QDLA 1JJ2N 1YJ9L 1VQML 1QVFN 3I55L 4P6IC 1YHQL 1M1KP 1VQOO 3CD6O 1YIJO 5DS4A 1VQ4O 5DLJA 1VQ8O 3CCQL 3CXCN 3CCVL 3CC7L 1Q86M 1Q86P 3G6EL 1W2BK 2OTLO 1VQ6L 2QEXL 3NKDA 1Q82M 1S72O 1N8RM 1VQ7O 1VQ5O 1N8RP 1VQKO 3G4SO 1VQ9O 1YITO 1VQNO 3CCJO 5FCLA 3CC4L 1YJ9O 3CMEL 1YHQO 1M1KM 3I56L 2OTJL 1W2BN 3CCLL 3CCUO 3CCVO 3G6EO 3CCEL 5DQZA 3CC2O 1VQ6O 3OW2K 3CCML 2QEXO 4N06A 1Q7YM 1Q7YP 1YJNL 5DS6A 2QA4L 3GODA 3G71L 5DS5A 1KC8M 1M90M 1KC8P 1M90P 1Q81M 1Q81P 1VQMO 1YIJL 3I55O 4WJ0A 1YJWL 3CMAL 2OTJO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL O;  3OW2 N;  3CCQ O;  2OTL L;  3CC7 O;  3CCR L;  1VQP L;  3CCE O;  3CPW K;  3CCS L;  1NJI M;  1NJI P;  1KQS K;  1K9M M;  1VQ7 L;  1K9M P;  1VQ5 L;  1VQL L;  1VQK L;  3G4S L;  1KD1 M;  1VQ9 L;  1KD1 P;  3CCJ L;  1YI2 L;  1K73 M;  1K73 P;  3G71 O;  3CC4 O;  1QVG K;  1VQO L;  3CD6 L;  3CME O;  1JJ2 K;  1QVF K;  1YJW O;  3CMA O;  1VQ4 L;  3I56 O;  3CCU L;  1VQ8 L;  3CPW N;  1KQS N;  3CC2 L;  1K8A M;  1K8A P;  3CCR O;  1VQP O;  3CXC K;  3CCS O;  1Q82 P;  3CCM O;  1S72 L;  1VQL O;  1YIT L;  1YJN O;  1VQN L;  1YI2 O;  2QA4 O;  1QVG N;  1JJ2 N;  1YJ9 L;  1VQM L;  1QVF N;  3I55 L;  1YHQ L;  1M1K P;  1VQO O;  3CD6 O;  1YIJ O;  1VQ4 O;  1VQ8 O;  3CCQ L;  3CXC N;  3CCV L;  3CC7 L;  1Q86 M;  1Q86 P;  3G6E L;  1W2B K;  2OTL O;  1VQ6 L;  2QEX L;  1Q82 M;  1S72 O;  1N8R M;  1VQ7 O;  1VQ5 O;  1N8R P;  1VQK O;  3G4S O;  1VQ9 O;  1YIT O;  1VQN O;  3CCJ O;  3CC4 L;  1YJ9 O;  3CME L;  1YHQ O;  1M1K M;  3I56 L;  2OTJ L;  1W2B N;  3CCL L;  3CCU O;  3CCV O;  3G6E O;  3CCE L;  3CC2 O;  1VQ6 O;  3OW2 K;  3CCM L;  2QEX O;  1Q7Y M;  1Q7Y P;  1YJN L;  2QA4 L;  3G71 L;  1KC8 M;  1M90 M;  1KC8 P;  1M90 P;  1Q81 M;  1Q81 P;  1VQM O;  1YIJ L;  3I55 O;  1YJW L;  3CMA L;  2OTJ O; 
#chains in the Genus database with same CATH topology
 5DQT A;  3CCL O;  3OW2 N;  3CCQ O;  2OTL L;  3CC7 O;  3CCR L;  1VQP L;  3CCE O;  3CPW K;  3CCS L;  1NJI M;  1NJI P;  1KQS K;  1K9M M;  1VQ7 L;  1K9M P;  1VQ5 L;  1VQL L;  1VQK L;  3G4S L;  1KD1 M;  1VQ9 L;  1KD1 P;  2YZS A;  3CCJ L;  1YI2 L;  1K73 M;  1K73 P;  4XTK A;  3G71 O;  3CC4 O;  1QVG K;  1VQO L;  3CD6 L;  3CME O;  1JJ2 K;  1QVF K;  1YJW O;  3CMA O;  1VQ4 L;  3I56 O;  3CCU L;  1VQ8 L;  3CPW N;  1KQS N;  3CC2 L;  1K8A M;  1K8A P;  3CCR O;  1VQP O;  3CXC K;  3CCS O;  1Q82 P;  3CCM O;  1S72 L;  1VQL O;  1YIT L;  4W8K A;  1YJN O;  1VQN L;  1YI2 O;  2QA4 O;  1QVG N;  4QDL A;  1JJ2 N;  1YJ9 L;  1VQM L;  1QVF N;  3I55 L;  4P6I C;  1YHQ L;  1M1K P;  1VQO O;  3CD6 O;  1YIJ O;  5DS4 A;  1VQ4 O;  5DLJ A;  1VQ8 O;  3CCQ L;  3CXC N;  3CCV L;  3CC7 L;  1Q86 M;  1Q86 P;  3G6E L;  1W2B K;  2OTL O;  1VQ6 L;  2QEX L;  3NKD A;  1Q82 M;  1S72 O;  1N8R M;  1VQ7 O;  1VQ5 O;  1N8R P;  1VQK O;  3G4S O;  1VQ9 O;  1YIT O;  1VQN O;  3CCJ O;  5FCL A;  3CC4 L;  1YJ9 O;  3CME L;  1YHQ O;  1M1K M;  3I56 L;  2OTJ L;  1W2B N;  3CCL L;  3CCU O;  3CCV O;  3G6E O;  3CCE L;  5DQZ A;  3CC2 O;  1VQ6 O;  3OW2 K;  3CCM L;  2QEX O;  4N06 A;  1Q7Y M;  1Q7Y P;  1YJN L;  5DS6 A;  2QA4 L;  3GOD A;  3G71 L;  5DS5 A;  1KC8 M;  1M90 M;  1KC8 P;  1M90 P;  1Q81 M;  1Q81 P;  1VQM O;  1YIJ L;  3I55 O;  4WJ0 A;  1YJW L;  3CMA L;  2OTJ O; 
#chains in the Genus database with same CATH homology
 5DQT A;  3CCL O;  3OW2 N;  3CCQ O;  2OTL L;  3CC7 O;  3CCR L;  1VQP L;  3CCE O;  3CPW K;  3CCS L;  1NJI M;  1NJI P;  1KQS K;  1K9M M;  1VQ7 L;  1K9M P;  1VQ5 L;  1VQL L;  1VQK L;  3G4S L;  1KD1 M;  1VQ9 L;  1KD1 P;  2YZS A;  3CCJ L;  1YI2 L;  1K73 M;  1K73 P;  4XTK A;  3G71 O;  3CC4 O;  1QVG K;  1VQO L;  3CD6 L;  3CME O;  1JJ2 K;  1QVF K;  1YJW O;  3CMA O;  1VQ4 L;  3I56 O;  3CCU L;  1VQ8 L;  3CPW N;  1KQS N;  3CC2 L;  1K8A M;  1K8A P;  3CCR O;  1VQP O;  3CXC K;  3CCS O;  1Q82 P;  3CCM O;  1S72 L;  1VQL O;  1YIT L;  4W8K A;  1YJN O;  1VQN L;  1YI2 O;  2QA4 O;  1QVG N;  4QDL A;  1JJ2 N;  1YJ9 L;  1VQM L;  1QVF N;  3I55 L;  4P6I C;  1YHQ L;  1M1K P;  1VQO O;  3CD6 O;  1YIJ O;  5DS4 A;  1VQ4 O;  5DLJ A;  1VQ8 O;  3CCQ L;  3CXC N;  3CCV L;  3CC7 L;  1Q86 M;  1Q86 P;  3G6E L;  1W2B K;  2OTL O;  1VQ6 L;  2QEX L;  3NKD A;  1Q82 M;  1S72 O;  1N8R M;  1VQ7 O;  1VQ5 O;  1N8R P;  1VQK O;  3G4S O;  1VQ9 O;  1YIT O;  1VQN O;  3CCJ O;  5FCL A;  3CC4 L;  1YJ9 O;  3CME L;  1YHQ O;  1M1K M;  3I56 L;  2OTJ L;  1W2B N;  3CCL L;  3CCU O;  3CCV O;  3G6E O;  3CCE L;  5DQZ A;  3CC2 O;  1VQ6 O;  3OW2 K;  3CCM L;  2QEX O;  4N06 A;  1Q7Y M;  1Q7Y P;  1YJN L;  5DS6 A;  2QA4 L;  3GOD A;  3G71 L;  5DS5 A;  1KC8 M;  1M90 M;  1KC8 P;  1M90 P;  1Q81 M;  1Q81 P;  1VQM O;  1YIJ L;  3I55 O;  4WJ0 A;  1YJW L;  3CMA L;  2OTJ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...