1MXAA

S-adenosylmethionine synthetase with ppi
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
molecule tags Transferase
total genus 124
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA01
1XRAA 1MXCA 1P7LA 1O90A 1QM4A 4WS9A 1XRBA 5A1IA 2YWBA 5T8SA 1GPMA 2DPLA 2YWCA 4KTVA 4HPVA 1O92A 1O93A 3IMLA 3TDEA 5H9UA 3A4IA 4ODJA 2OBVA 4KTTA 4L7IA 2P02A 5A1GA 1RG9A 3S82A 1XRCA 4LE5A 1MXAA 3UOWA 1O9TA 4NDNA 3TQIA 5A19A 4L2ZA 1FUGA 5T8TA 4L4QA 3SO4A 4K0BA 3RV2A 1MXBA
chains in the Genus database with same CATH superfamily
3N2QA 1HNZC 4NOZA 4DG8A 1QM4A 2P2MA 5BSWA 1GPMA 3DLPX 4JYAC 4HPVA 4DCSA 3ETOA 3T1HC 3NI2A 4FTFA 5FLXD 2CY1A 1EGAA 2D1RA 4L7IA 4JI0C 1UKKA 4G37A 3OTOC 3IPLA 4DV3C 4B3TC 3LGXA 3UX3A 1FUGA 4LF8C 3ETCA 4DV0C 4LF5C 3RV2A 1LQLA 1XHJA 3TUFA 4DV2C 4DR6C 3VNSA 3GPCA 4DUZC 3IEUA 3KXWA 3N54B 2YWCA 4RM3A 3A9UA 1MDBA 4JI3C 4D4GA 3NYQA 1MD9A 1V25A 1ZB9A 1XMOC 4DV7C 2HJGA 1IBMC 3TQIA 1N34C 3J80D 1NY8A 4LF4C 3PBKA 4IR7A 3L8CA 4PUIA 2VZEA 4NXMC 4GKJC 2UUBC 1HR0C 2M5OA 3RG2A 3JAMD 1JOSA 1PG3A 2V7BA 4ISBA 3I07A 4WV3A 2PN2A 3GR1A 3S82A 5BUSA 4TPSB 3R9XA 1USPA 1ZB8A 2ONFA 2UUCC 1M6XC 3J81D 3EERA 1VEHA 4BCAA 3VNQA 2ZM6C 2P2QA 4DR7C 1HH2P 3CQ2A 1TH5A 1XRCA 2E5LC 5KEIA 4DR1C 4BC9A 4K0BA 4OXIA 1O90A 2D28C 1P4EC 5T8SA 4MTNA 2YX1A 5AE1A 3IMLA 4PROC 5BSTA 4OYCA 3E7XA 2P02A 3UEBA 2P2JA 5BSVA 1BA3A 5A19A 4LF6C 4L2ZA 4L4QA 4I9GA 4I9FA 2JMPA 4DCUA 1FJGC 5BR8C 2OPLA 5E7QA 2D27A 4LF7C 4ZJZA 5IWAC 4LFCC 3A4IA 5CZXA 4DUYC 4U5YD 4JI2C 3UOWA 2UXDC 4BBYA 5BSRA 5CZVA 4B3MC 2WD9A 1MDFA 4DCVA 4DV5C 4JM1A 4D4IA 4WS9A 2M5HA 1L2FA 5DV9A 1HNXC 4BSZA 4JI7C 1NYEA 1WH9A 2E8FA 2QVXX 3O2EA 1RY2A 4JI6C 4LFBC 2NCLA 1M6XA 5A1GA 4X65C 4DR2C 2CXCA 2Y27A 4G1IA 3GKUA 4RLFA 4LF9C 5A2QD 1XRBA 3T1YC 5A1IA 2KZFA 3FCCA 4PZPA 5BURA 5JRHA 3LNOA 1WCJA 2DHMA 3CW8X 4YY3C 4BC7A 3TDEA 4GXRA 4RLQA 4JI5C 4KTTA 4B3RC 4NDNA 1PU1A 2HHHC 1P4EA 5KYVA 2AYAA 1WF3A 1XRAA 1K0RA 3R9WA 2PROA 2YWBA 2DPLA 4X66C 1PG4A 4KTVA 4R1LA 1PA4A 4NXNC 3FCEA 1IB8A 1I94C 3DHVA 4PUGA 2CU6A 1USPB 3CQ3A 4GS5A 4DR4C 3CJEA 4LE5A 2F4VC 2Z51A 4FUQA 3C5EA 4RVNA 3CW9A 5BSMA 5KYTA 2BH1X 3EQ6A 4PHTA 5LMUC 2EGTA 1KKGA 1FLOA 1O92A 2E7GA 3AF5A 4MH4A 5H9UA 4DG9A 2UU9C 1RG9A 1IBKC 2KZ0A 1XNRC 4PUHA 3LNVA 2OO4A 3SO4A 1XMQC 3L95X 1MXBA 1N33C 1ML8A 2D1TA 3DAYA 4RM2A 4DV4C 4DR5C 4FUTA 4K0KC 3A25A 4AQYC 5LMNC 3UX2A 1VLAA 4DV1C 2VQEC 3LAXA 3B7WA 2E0GA 3K6RA 2VQFC 2OPLB 3A26A 3E7WA 1T5DX 3AY0A 4G36A 4XX2A 1V26A 4X62C 1T5HX 5AE2A 5BUQA 2D7VA 1UWDA 4GKKC 2MCQA 4KHPC 2XR1A 2QVYX 3TR3A 3AF6A 1LCIA 2Y4NA 4LFAC 2ZZMA 3G7SA 3VNRA 2DYJA 3GR0A 5LCIA 2ZZNA 2JNVA 3NYRA 2QVZX 1N36C 5IFIA 2UXBC 1ULTA 2ATWA 4JV5C 2UXCC 3UZ0A 2VSQA 4JI4C 1V60A 2P2FA 2Y4OA 4D56A 1J5EC 4JI8C 4DV6C 2WP0C 5BSUA 1HNWC 1N2FA 2D1QA 4X64C 4DR3C 2E8CA 1MXCA 3NPDA 5GTDA 2KDNA 2QW0X 4GXQA 4JI1C 4IZ6A 4ODJA 5AE3A 4EATA 4B3SC 4DCTA 1AMUA 5T8TA 1YJ7A 2D1SA 2ASBA 1XNQC 4RMNA 2BJOA 1QWIA 3CQ1A 3R44A 4R1MA 1O93A 4D57A 5IT9D 2PT7G 3PESA 1N32C 1MXAA 1O9TA 3LUSA 4R0MA 5K85A 1IBLC 2E8EA 1P7LA 2QL8A 5K8FA 4ZLPA 1MKYA 4YHHC 3I08A 2YCBA 3A9VA 3IEVA 2OBVA 1XS3A 2P2BA 3H2TA 2P20A 3PROC 2UUAC 2MM9A 4RVOA 5ADZA 4OX9C 2MMAB
chains in the Genus database with same CATH topology
3N2QA 1HNZC 4NOZA 4DG8A 1QM4A 2P2MA 5BSWA 1GPMA 3DLPX 4JYAC 4HPVA 4DCSA 3ETOA 3T1HC 3NI2A 4FTFA 5FLXD 2CY1A 1EGAA 2D1RA 4L7IA 4JI0C 1UKKA 4G37A 3OTOC 3IPLA 4DV3C 4B3TC 3LGXA 1FUGA 4LF8C 3ETCA 4DV0C 4LF5C 3RV2A 1LQLA 3TUFA 4DV2C 4DR6C 3VNSA 3GPCA 4DUZC 3IEUA 3KXWA 3N54B 2YWCA 4RM3A 3A9UA 1MDBA 4JI3C 4D4GA 3NYQA 1MD9A 1V25A 1ZB9A 1XMOC 4DV7C 2HJGA 1IBMC 3TQIA 1N34C 3J80D 4LF4C 3PBKA 4IR7A 3L8CA 2VZEA 4NXMC 4GKJC 2UUBC 1HR0C 3RG2A 3JAMD 1JOSA 1PG3A 2V7BA 4ISBA 3I07A 4WV3A 2PN2A 3GR1A 3S82A 5BUSA 4TPSB 3R9XA 1USPA 1ZB8A 2ONFA 2UUCC 3J81D 3EERA 4BCAA 3VNQA 2ZM6C 2P2QA 4DR7C 1HH2P 1XRCA 2E5LC 5KEIA 4DR1C 4BC9A 4K0BA 4OXIA 1O90A 2D28C 5T8SA 4MTNA 5AE1A 3IMLA 4PROC 5BSTA 4OYCA 3E7XA 2P02A 2P2JA 5BSVA 1BA3A 5A19A 4LF6C 4L2ZA 4L4QA 4I9GA 4I9FA 2JMPA 4DCUA 1FJGC 5BR8C 2OPLA 5E7QA 2D27A 4LF7C 4ZJZA 5IWAC 4LFCC 3A4IA 5CZXA 4DUYC 4U5YD 4JI2C 3UOWA 2UXDC 4BBYA 5BSRA 5CZVA 4B3MC 2WD9A 1MDFA 4DCVA 4DV5C 4JM1A 4D4IA 4WS9A 1L2FA 5DV9A 1HNXC 4BSZA 4JI7C 1NYEA 1WH9A 2E8FA 2QVXX 4JI6C 1RY2A 4LFBC 5A1GA 4X65C 4DR2C 2CXCA 2Y27A 4G1IA 3GKUA 4RLFA 4LF9C 5A2QD 1XRBA 3T1YC 5A1IA 2KZFA 3FCCA 4PZPA 5BURA 5JRHA 3CW8X 4YY3C 4BC7A 3TDEA 4GXRA 4RLQA 4JI5C 4KTTA 4B3RC 4NDNA 2HHHC 5KYVA 2AYAA 1WF3A 1XRAA 1K0RA 3R9WA 2PROA 2YWBA 2DPLA 4X66C 1PG4A 4KTVA 4R1LA 1PA4A 4NXNC 3FCEA 1I94C 3DHVA 1USPB 4GS5A 4DR4C 3CJEA 4LE5A 2F4VC 4FUQA 3C5EA 4RVNA 3CW9A 5BSMA 5KYTA 2BH1X 3EQ6A 4PHTA 5LMUC 2EGTA 1KKGA 1O92A 2E7GA 3AF5A 4MH4A 5H9UA 4DG9A 2UU9C 1RG9A 1IBKC 1XNRC 3LNVA 2OO4A 3SO4A 1XMQC 3L95X 1MXBA 1N33C 1ML8A 2D1TA 3DAYA 4RM2A 4DV4C 4DR5C 4FUTA 4K0KC 4AQYC 5LMNC 1VLAA 4DV1C 2VQEC 3LAXA 3B7WA 2E0GA 2VQFC 2OPLB 3E7WA 1T5DX 4G36A 4XX2A 1V26A 4X62C 1T5HX 5AE2A 5BUQA 2D7VA 4GKKC 4KHPC 2XR1A 2QVYX 3AF6A 1LCIA 2Y4NA 4LFAC 3G7SA 3VNRA 2DYJA 3GR0A 3NYRA 2QVZX 1N36C 5IFIA 2UXBC 1ULTA 2ATWA 4JV5C 2UXCC 3UZ0A 2VSQA 4JI4C 2P2FA 2Y4OA 4D56A 1J5EC 4JI8C 4DV6C 2WP0C 5BSUA 1HNWC 1N2FA 2D1QA 4X64C 4DR3C 2E8CA 1MXCA 3NPDA 5GTDA 2QW0X 4GXQA 4JI1C 4IZ6A 4ODJA 5AE3A 4EATA 4B3SC 4DCTA 1AMUA 5T8TA 1YJ7A 2D1SA 2ASBA 1XNQC 4RMNA 2BJOA 1QWIA 3R44A 4R1MA 1O93A 4D57A 5IT9D 2PT7G 3PESA 1N32C 1MXAA 1O9TA 3LUSA 4R0MA 5K85A 1IBLC 2E8EA 1P7LA 2QL8A 5K8FA 4ZLPA 1MKYA 4YHHC 3I08A 2YCBA 3A9VA 3IEVA 2OBVA 2P2BA 3H2TA 2P20A 3PROC 2UUAC 4RVOA 5ADZA 4OX9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRA A;  1MXC A;  1P7L A;  1O90 A;  1QM4 A;  4WS9 A;  1XRB A;  5A1I A;  2YWB A;  5T8S A;  1GPM A;  2DPL A;  2YWC A;  4KTV A;  4HPV A;  1O92 A;  1O93 A;  3IML A;  3TDE A;  5H9U A;  3A4I A;  4ODJ A;  2OBV A;  4KTT A;  4L7I A;  2P02 A;  5A1G A;  1RG9 A;  3S82 A;  1XRC A;  4LE5 A;  1MXA A;  3UOW A;  1O9T A;  4NDN A;  3TQI A;  5A19 A;  4L2Z A;  1FUG A;  5T8T A;  4L4Q A;  3SO4 A;  4K0B A;  3RV2 A;  1MXB A; 
#chains in the Genus database with same CATH topology
 3N2Q A;  1HNZ C;  4NOZ A;  4DG8 A;  1QM4 A;  2P2M A;  5BSW A;  1GPM A;  3DLP X;  4JYA C;  4HPV A;  4DCS A;  3ETO A;  3T1H C;  3NI2 A;  4FTF A;  5FLX D;  2CY1 A;  1EGA A;  2D1R A;  4L7I A;  4JI0 C;  1UKK A;  4G37 A;  3OTO C;  3IPL A;  4DV3 C;  4B3T C;  3LGX A;  3UX3 A;  1FUG A;  4LF8 C;  3ETC A;  4DV0 C;  4LF5 C;  3RV2 A;  1LQL A;  1XHJ A;  3TUF A;  4DV2 C;  4DR6 C;  3VNS A;  3GPC A;  4DUZ C;  3IEU A;  3KXW A;  3N54 B;  2YWC A;  4RM3 A;  3A9U A;  1MDB A;  4JI3 C;  4D4G A;  3NYQ A;  1MD9 A;  1V25 A;  1ZB9 A;  1XMO C;  4DV7 C;  2HJG A;  1IBM C;  3TQI A;  1N34 C;  3J80 D;  1NY8 A;  4LF4 C;  3PBK A;  4IR7 A;  3L8C A;  4PUI A;  2VZE A;  4NXM C;  4GKJ C;  2UUB C;  1HR0 C;  2M5O A;  3RG2 A;  3JAM D;  1JOS A;  1PG3 A;  2V7B A;  4ISB A;  3I07 A;  4WV3 A;  2PN2 A;  3GR1 A;  3S82 A;  5BUS A;  4TPS B;  3R9X A;  1USP A;  1ZB8 A;  2ONF A;  2UUC C;  1M6X C;  3J81 D;  3EER A;  1VEH A;  4BCA A;  3VNQ A;  2ZM6 C;  2P2Q A;  4DR7 C;  1HH2 P;  3CQ2 A;  1TH5 A;  1XRC A;  2E5L C;  5KEI A;  4DR1 C;  4BC9 A;  4K0B A;  4OXI A;  1O90 A;  2D28 C;  1P4E C;  5T8S A;  4MTN A;  2YX1 A;  5AE1 A;  3IML A;  4PRO C;  5BST A;  4OYC A;  3E7X A;  2P02 A;  3UEB A;  2P2J A;  5BSV A;  1BA3 A;  5A19 A;  4LF6 C;  4L2Z A;  4L4Q A;  4I9G A;  4I9F A;  2JMP A;  4DCU A;  1FJG C;  5BR8 C;  2OPL A;  5E7Q A;  2D27 A;  4LF7 C;  4ZJZ A;  5IWA C;  4LFC C;  3A4I A;  5CZX A;  4DUY C;  4U5Y D;  4JI2 C;  3UOW A;  2UXD C;  4BBY A;  5BSR A;  5CZV A;  4B3M C;  2WD9 A;  1MDF A;  4DCV A;  4DV5 C;  4JM1 A;  4D4I A;  4WS9 A;  2M5H A;  1L2F A;  5DV9 A;  1HNX C;  4BSZ A;  4JI7 C;  1NYE A;  1WH9 A;  2E8F A;  2QVX X;  3O2E A;  1RY2 A;  4JI6 C;  4LFB C;  2NCL A;  1M6X A;  5A1G A;  4X65 C;  4DR2 C;  2CXC A;  2Y27 A;  4G1I A;  3GKU A;  4RLF A;  4LF9 C;  5A2Q D;  1XRB A;  3T1Y C;  5A1I A;  2KZF A;  3FCC A;  4PZP A;  5BUR A;  5JRH A;  3LNO A;  1WCJ A;  2DHM A;  3CW8 X;  4YY3 C;  4BC7 A;  3TDE A;  4GXR A;  4RLQ A;  4JI5 C;  4KTT A;  4B3R C;  4NDN A;  1PU1 A;  2HHH C;  1P4E A;  5KYV A;  2AYA A;  1WF3 A;  1XRA A;  1K0R A;  3R9W A;  2PRO A;  2YWB A;  2DPL A;  4X66 C;  1PG4 A;  4KTV A;  4R1L A;  1PA4 A;  4NXN C;  3FCE A;  1IB8 A;  1I94 C;  3DHV A;  4PUG A;  2CU6 A;  1USP B;  3CQ3 A;  4GS5 A;  4DR4 C;  3CJE A;  4LE5 A;  2F4V C;  2Z51 A;  4FUQ A;  3C5E A;  4RVN A;  3CW9 A;  5BSM A;  5KYT A;  2BH1 X;  3EQ6 A;  4PHT A;  5LMU C;  2EGT A;  1KKG A;  1FLO A;  1O92 A;  2E7G A;  3AF5 A;  4MH4 A;  5H9U A;  4DG9 A;  2UU9 C;  1RG9 A;  1IBK C;  2KZ0 A;  1XNR C;  4PUH A;  3LNV A;  2OO4 A;  3SO4 A;  1XMQ C;  3L95 X;  1MXB A;  1N33 C;  1ML8 A;  2D1T A;  3DAY A;  4RM2 A;  4DV4 C;  4DR5 C;  4FUT A;  4K0K C;  3A25 A;  4AQY C;  5LMN C;  3UX2 A;  1VLA A;  4DV1 C;  2VQE C;  3LAX A;  3B7W A;  2E0G A;  3K6R A;  2VQF C;  2OPL B;  3A26 A;  3E7W A;  1T5D X;  3AY0 A;  4G36 A;  4XX2 A;  1V26 A;  4X62 C;  1T5H X;  5AE2 A;  5BUQ A;  2D7V A;  1UWD A;  4GKK C;  2MCQ A;  4KHP C;  2XR1 A;  2QVY X;  3TR3 A;  3AF6 A;  1LCI A;  2Y4N A;  4LFA C;  2ZZM A;  3G7S A;  3VNR A;  2DYJ A;  3GR0 A;  5LCI A;  2ZZN A;  2JNV A;  3NYR A;  2QVZ X;  1N36 C;  5IFI A;  2UXB C;  1ULT A;  2ATW A;  4JV5 C;  2UXC C;  3UZ0 A;  2VSQ A;  4JI4 C;  1V60 A;  2P2F A;  2Y4O A;  4D56 A;  1J5E C;  4JI8 C;  4DV6 C;  2WP0 C;  5BSU A;  1HNW C;  1N2F A;  2D1Q A;  4X64 C;  4DR3 C;  2E8C A;  1MXC A;  3NPD A;  5GTD A;  2KDN A;  2QW0 X;  4GXQ A;  4JI1 C;  4IZ6 A;  4ODJ A;  5AE3 A;  4EAT A;  4B3S C;  4DCT A;  1AMU A;  5T8T A;  1YJ7 A;  2D1S A;  2ASB A;  1XNQ C;  4RMN A;  2BJO A;  1QWI A;  3CQ1 A;  3R44 A;  4R1M A;  1O93 A;  4D57 A;  5IT9 D;  2PT7 G;  3PES A;  1N32 C;  1MXA A;  1O9T A;  3LUS A;  4R0M A;  5K85 A;  1IBL C;  2E8E A;  1P7L A;  2QL8 A;  5K8F A;  4ZLP A;  1MKY A;  4YHH C;  3I08 A;  2YCB A;  3A9V A;  3IEV A;  2OBV A;  1XS3 A;  2P2B A;  3H2T A;  2P20 A;  3PRO C;  2UUA C;  2MM9 A;  4RVO A;  5ADZ A;  4OX9 C;  2MMA B; 
#chains in the Genus database with same CATH homology
 3N2Q A;  1HNZ C;  4NOZ A;  4DG8 A;  1QM4 A;  2P2M A;  5BSW A;  1GPM A;  3DLP X;  4JYA C;  4HPV A;  4DCS A;  3ETO A;  3T1H C;  3NI2 A;  4FTF A;  5FLX D;  2CY1 A;  1EGA A;  2D1R A;  4L7I A;  4JI0 C;  1UKK A;  4G37 A;  3OTO C;  3IPL A;  4DV3 C;  4B3T C;  3LGX A;  1FUG A;  4LF8 C;  3ETC A;  4DV0 C;  4LF5 C;  3RV2 A;  1LQL A;  3TUF A;  4DV2 C;  4DR6 C;  3VNS A;  3GPC A;  4DUZ C;  3IEU A;  3KXW A;  3N54 B;  2YWC A;  4RM3 A;  3A9U A;  1MDB A;  4JI3 C;  4D4G A;  3NYQ A;  1MD9 A;  1V25 A;  1ZB9 A;  1XMO C;  4DV7 C;  2HJG A;  1IBM C;  3TQI A;  1N34 C;  3J80 D;  4LF4 C;  3PBK A;  4IR7 A;  3L8C A;  2VZE A;  4NXM C;  4GKJ C;  2UUB C;  1HR0 C;  3RG2 A;  3JAM D;  1JOS A;  1PG3 A;  2V7B A;  4ISB A;  3I07 A;  4WV3 A;  2PN2 A;  3GR1 A;  3S82 A;  5BUS A;  4TPS B;  3R9X A;  1USP A;  1ZB8 A;  2ONF A;  2UUC C;  3J81 D;  3EER A;  4BCA A;  3VNQ A;  2ZM6 C;  2P2Q A;  4DR7 C;  1HH2 P;  1XRC A;  2E5L C;  5KEI A;  4DR1 C;  4BC9 A;  4K0B A;  4OXI A;  1O90 A;  2D28 C;  5T8S A;  4MTN A;  5AE1 A;  3IML A;  4PRO C;  5BST A;  4OYC A;  3E7X A;  2P02 A;  2P2J A;  5BSV A;  1BA3 A;  5A19 A;  4LF6 C;  4L2Z A;  4L4Q A;  4I9G A;  4I9F A;  2JMP A;  4DCU A;  1FJG C;  5BR8 C;  2OPL A;  5E7Q A;  2D27 A;  4LF7 C;  4ZJZ A;  5IWA C;  4LFC C;  3A4I A;  5CZX A;  4DUY C;  4U5Y D;  4JI2 C;  3UOW A;  2UXD C;  4BBY A;  5BSR A;  5CZV A;  4B3M C;  2WD9 A;  1MDF A;  4DCV A;  4DV5 C;  4JM1 A;  4D4I A;  4WS9 A;  1L2F A;  5DV9 A;  1HNX C;  4BSZ A;  4JI7 C;  1NYE A;  1WH9 A;  2E8F A;  2QVX X;  4JI6 C;  1RY2 A;  4LFB C;  5A1G A;  4X65 C;  4DR2 C;  2CXC A;  2Y27 A;  4G1I A;  3GKU A;  4RLF A;  4LF9 C;  5A2Q D;  1XRB A;  3T1Y C;  5A1I A;  2KZF A;  3FCC A;  4PZP A;  5BUR A;  5JRH A;  3CW8 X;  4YY3 C;  4BC7 A;  3TDE A;  4GXR A;  4RLQ A;  4JI5 C;  4KTT A;  4B3R C;  4NDN A;  2HHH C;  5KYV A;  2AYA A;  1WF3 A;  1XRA A;  1K0R A;  3R9W A;  2PRO A;  2YWB A;  2DPL A;  4X66 C;  1PG4 A;  4KTV A;  4R1L A;  1PA4 A;  4NXN C;  3FCE A;  1I94 C;  3DHV A;  1USP B;  4GS5 A;  4DR4 C;  3CJE A;  4LE5 A;  2F4V C;  4FUQ A;  3C5E A;  4RVN A;  3CW9 A;  5BSM A;  5KYT A;  2BH1 X;  3EQ6 A;  4PHT A;  5LMU C;  2EGT A;  1KKG A;  1O92 A;  2E7G A;  3AF5 A;  4MH4 A;  5H9U A;  4DG9 A;  2UU9 C;  1RG9 A;  1IBK C;  1XNR C;  3LNV A;  2OO4 A;  3SO4 A;  1XMQ C;  3L95 X;  1MXB A;  1N33 C;  1ML8 A;  2D1T A;  3DAY A;  4RM2 A;  4DV4 C;  4DR5 C;  4FUT A;  4K0K C;  4AQY C;  5LMN C;  1VLA A;  4DV1 C;  2VQE C;  3LAX A;  3B7W A;  2E0G A;  2VQF C;  2OPL B;  3E7W A;  1T5D X;  4G36 A;  4XX2 A;  1V26 A;  4X62 C;  1T5H X;  5AE2 A;  5BUQ A;  2D7V A;  4GKK C;  4KHP C;  2XR1 A;  2QVY X;  3AF6 A;  1LCI A;  2Y4N A;  4LFA C;  3G7S A;  3VNR A;  2DYJ A;  3GR0 A;  3NYR A;  2QVZ X;  1N36 C;  5IFI A;  2UXB C;  1ULT A;  2ATW A;  4JV5 C;  2UXC C;  3UZ0 A;  2VSQ A;  4JI4 C;  2P2F A;  2Y4O A;  4D56 A;  1J5E C;  4JI8 C;  4DV6 C;  2WP0 C;  5BSU A;  1HNW C;  1N2F A;  2D1Q A;  4X64 C;  4DR3 C;  2E8C A;  1MXC A;  3NPD A;  5GTD A;  2QW0 X;  4GXQ A;  4JI1 C;  4IZ6 A;  4ODJ A;  5AE3 A;  4EAT A;  4B3S C;  4DCT A;  1AMU A;  5T8T A;  1YJ7 A;  2D1S A;  2ASB A;  1XNQ C;  4RMN A;  2BJO A;  1QWI A;  3R44 A;  4R1M A;  1O93 A;  4D57 A;  5IT9 D;  2PT7 G;  3PES A;  1N32 C;  1MXA A;  1O9T A;  3LUS A;  4R0M A;  5K85 A;  1IBL C;  2E8E A;  1P7L A;  2QL8 A;  5K8F A;  4ZLP A;  1MKY A;  4YHH C;  3I08 A;  2YCB A;  3A9V A;  3IEV A;  2OBV A;  2P2B A;  3H2T A;  2P20 A;  3PRO C;  2UUA C;  4RVO A;  5ADZ A;  4OX9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...