1NJIP

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1njiP00
1M90P 1QVFN 1KQSN 3CCRO 3CC7L 1VQLL 1VQ7L 1YJ9L 1M1KP 3OW2K 3CPWK 3CCQO 1JJ2K 3CCLL 3CD6O 3CCLO 1VQOL 1N8RM 1YJWL 1KD1P 3CMAO 3CCMO 1YHQO 1QVGN 1VQMO 1K8AM 3CXCN 3G4SO 3CCRL 1W2BK 1VQ5O 3CCSO 1KC8M 1NJIP 1K73P 1K9MM 1Q86M 3CCQL 1YI2O 1Q7YP 3CD6L 2QEXO 1M90M 3CCEO 1Q81P 1VQ9L 3CMAL 3CCML 2OTLO 1YHQL 1VQ9O 1VQML 1QVFK 1KQSK 1VQNO 3CMEO 1VQKO 1NJIM 1M1KM 1VQ8O 3G4SL 1YIJO 1VQ5L 3G6EO 3CCSL 3CCVO 2QA4L 1YJNO 1YITO 3I55O 2QA4O 1VQ4O 3I56O 1Q81M 1KD1M 3OW2N 1YI2L 3CPWN 1JJ2N 1VQ6O 3CCUL 2QEXL 3G71L 3CCEL 3CCUO 1QVGK 3G71O 2OTLL 1Q82P 1VQNL 3CMEL 3CXCK 3CCJL 1VQKL 1VQ8L 3CCJO 1N8RP 1YIJL 1K73M 3G6EL 3CCVL 3CC7O 1VQLO 1YJNL 1VQ7O 1YITL 1W2BN 1Q7YM 3I55L 1YJ9O 1K8AP 1VQ4L 3I56L 2OTJL 3CC4L 1Q82M 2OTJO 3CC4O 1VQPL 1S72L 1VQ6L 1KC8P 1VQPO 1S72O 1VQOO 1K9MP 1YJWO 1Q86P 3CC2L 3CC2O
chains in the Genus database with same CATH superfamily
1M90P 1QVFN 4XTKA 1KQSN 3CCRO 3CC7L 1VQLL 1VQ7L 1YJ9L 1M1KP 5DS6A 3OW2K 3CPWK 3CCQO 1JJ2K 3CCLL 3CD6O 4N06A 3CCLO 1VQOL 5DS5A 1N8RM 1YJWL 1KD1P 3CMAO 3CCMO 5FCLA 1YHQO 1QVGN 1VQMO 1K8AM 3CXCN 3G4SO 3CCRL 1W2BK 1VQ5O 3CCSO 1KC8M 1NJIP 1K73P 1K9MM 3GODA 1Q86M 3CCQL 5DQZA 1YI2O 1Q7YP 3CD6L 2QEXO 1M90M 3CCEO 1Q81P 1VQ9L 2YZSA 3CMAL 3CCML 2OTLO 1YHQL 1VQ9O 1VQML 1QVFK 1KQSK 1VQNO 3CMEO 1VQKO 1NJIM 1M1KM 1VQ8O 3G4SL 1YIJO 1VQ5L 3G6EO 3CCSL 3CCVO 2QA4L 1YJNO 1YITO 3I55O 2QA4O 1VQ4O 3I56O 1Q81M 1KD1M 5DS4A 3OW2N 5DLJA 1YI2L 3CPWN 1JJ2N 1VQ6O 3CCUL 2QEXL 3G71L 3CCEL 3CCUO 3NKDA 1QVGK 3G71O 2OTLL 1Q82P 1VQNL 3CMEL 3CXCK 3CCJL 1VQKL 4QDLA 1VQ8L 3CCJO 1N8RP 1YIJL 1K73M 3G6EL 4P6IC 3CC7O 3CCVL 1VQLO 1YJNL 1VQ7O 1YITL 1W2BN 4WJ0A 3I55L 1YJ9O 1Q7YM 1K8AP 1VQ4L 3I56L 4W8KA 2OTJL 3CC4L 1Q82M 2OTJO 3CC4O 1VQPL 1S72L 1VQ6L 5DQTA 1KC8P 1VQPO 1S72O 1VQOO 1K9MP 1YJWO 1Q86P 3CC2L 3CC2O
chains in the Genus database with same CATH topology
1M90P 1QVFN 4XTKA 1KQSN 3CCRO 3CC7L 1VQLL 1VQ7L 1YJ9L 1M1KP 5DS6A 3OW2K 3CPWK 3CCQO 1JJ2K 3CCLL 3CD6O 4N06A 3CCLO 1VQOL 5DS5A 1N8RM 1YJWL 1KD1P 3CMAO 3CCMO 5FCLA 1YHQO 1QVGN 1VQMO 1K8AM 3CXCN 3G4SO 3CCRL 1W2BK 1VQ5O 3CCSO 1KC8M 1NJIP 1K73P 1K9MM 3GODA 1Q86M 3CCQL 5DQZA 1YI2O 1Q7YP 3CD6L 2QEXO 1M90M 3CCEO 1Q81P 1VQ9L 2YZSA 3CMAL 3CCML 2OTLO 1YHQL 1VQ9O 1VQML 1QVFK 1KQSK 1VQNO 3CMEO 1VQKO 1NJIM 1M1KM 1VQ8O 3G4SL 1YIJO 1VQ5L 3G6EO 3CCSL 3CCVO 2QA4L 1YJNO 1YITO 3I55O 2QA4O 1VQ4O 3I56O 1Q81M 1KD1M 5DS4A 3OW2N 5DLJA 1YI2L 3CPWN 1JJ2N 1VQ6O 3CCUL 2QEXL 3G71L 3CCEL 3CCUO 3NKDA 1QVGK 3G71O 2OTLL 1Q82P 1VQNL 3CMEL 3CXCK 3CCJL 1VQKL 4QDLA 1VQ8L 3CCJO 1N8RP 1YIJL 1K73M 3G6EL 4P6IC 3CC7O 3CCVL 1VQLO 1YJNL 1VQ7O 1YITL 1W2BN 4WJ0A 3I55L 1YJ9O 1Q7YM 1K8AP 1VQ4L 3I56L 4W8KA 2OTJL 3CC4L 1Q82M 2OTJO 3CC4O 1VQPL 1S72L 1VQ6L 5DQTA 1KC8P 1VQPO 1S72O 1VQOO 1K9MP 1YJWO 1Q86P 3CC2L 3CC2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 P;  1QVF N;  1KQS N;  3CCR O;  3CC7 L;  1VQL L;  1VQ7 L;  1YJ9 L;  1M1K P;  3OW2 K;  3CPW K;  3CCQ O;  1JJ2 K;  3CCL L;  3CD6 O;  3CCL O;  1VQO L;  1N8R M;  1YJW L;  1KD1 P;  3CMA O;  3CCM O;  1YHQ O;  1QVG N;  1VQM O;  1K8A M;  3CXC N;  3G4S O;  3CCR L;  1W2B K;  1VQ5 O;  3CCS O;  1KC8 M;  1NJI P;  1K73 P;  1K9M M;  1Q86 M;  3CCQ L;  1YI2 O;  1Q7Y P;  3CD6 L;  2QEX O;  1M90 M;  3CCE O;  1Q81 P;  1VQ9 L;  3CMA L;  3CCM L;  2OTL O;  1YHQ L;  1VQ9 O;  1VQM L;  1QVF K;  1KQS K;  1VQN O;  3CME O;  1VQK O;  1NJI M;  1M1K M;  1VQ8 O;  3G4S L;  1YIJ O;  1VQ5 L;  3G6E O;  3CCS L;  3CCV O;  2QA4 L;  1YJN O;  1YIT O;  3I55 O;  2QA4 O;  1VQ4 O;  3I56 O;  1Q81 M;  1KD1 M;  3OW2 N;  1YI2 L;  3CPW N;  1JJ2 N;  1VQ6 O;  3CCU L;  2QEX L;  3G71 L;  3CCE L;  3CCU O;  1QVG K;  3G71 O;  2OTL L;  1Q82 P;  1VQN L;  3CME L;  3CXC K;  3CCJ L;  1VQK L;  1VQ8 L;  3CCJ O;  1N8R P;  1YIJ L;  1K73 M;  3G6E L;  3CCV L;  3CC7 O;  1VQL O;  1YJN L;  1VQ7 O;  1YIT L;  1W2B N;  1Q7Y M;  3I55 L;  1YJ9 O;  1K8A P;  1VQ4 L;  3I56 L;  2OTJ L;  3CC4 L;  1Q82 M;  2OTJ O;  3CC4 O;  1VQP L;  1S72 L;  1VQ6 L;  1KC8 P;  1VQP O;  1S72 O;  1VQO O;  1K9M P;  1YJW O;  1Q86 P;  3CC2 L;  3CC2 O; 
#chains in the Genus database with same CATH topology
 1M90 P;  1QVF N;  4XTK A;  1KQS N;  3CCR O;  3CC7 L;  1VQL L;  1VQ7 L;  1YJ9 L;  1M1K P;  5DS6 A;  3OW2 K;  3CPW K;  3CCQ O;  1JJ2 K;  3CCL L;  3CD6 O;  4N06 A;  3CCL O;  1VQO L;  5DS5 A;  1N8R M;  1YJW L;  1KD1 P;  3CMA O;  3CCM O;  5FCL A;  1YHQ O;  1QVG N;  1VQM O;  1K8A M;  3CXC N;  3G4S O;  3CCR L;  1W2B K;  1VQ5 O;  3CCS O;  1KC8 M;  1NJI P;  1K73 P;  1K9M M;  3GOD A;  1Q86 M;  3CCQ L;  5DQZ A;  1YI2 O;  1Q7Y P;  3CD6 L;  2QEX O;  1M90 M;  3CCE O;  1Q81 P;  1VQ9 L;  2YZS A;  3CMA L;  3CCM L;  2OTL O;  1YHQ L;  1VQ9 O;  1VQM L;  1QVF K;  1KQS K;  1VQN O;  3CME O;  1VQK O;  1NJI M;  1M1K M;  1VQ8 O;  3G4S L;  1YIJ O;  1VQ5 L;  3G6E O;  3CCS L;  3CCV O;  2QA4 L;  1YJN O;  1YIT O;  3I55 O;  2QA4 O;  1VQ4 O;  3I56 O;  1Q81 M;  1KD1 M;  5DS4 A;  3OW2 N;  5DLJ A;  1YI2 L;  3CPW N;  1JJ2 N;  1VQ6 O;  3CCU L;  2QEX L;  3G71 L;  3CCE L;  3CCU O;  3NKD A;  1QVG K;  3G71 O;  2OTL L;  1Q82 P;  1VQN L;  3CME L;  3CXC K;  3CCJ L;  1VQK L;  4QDL A;  1VQ8 L;  3CCJ O;  1N8R P;  1YIJ L;  1K73 M;  3G6E L;  4P6I C;  3CC7 O;  3CCV L;  1VQL O;  1YJN L;  1VQ7 O;  1YIT L;  1W2B N;  4WJ0 A;  3I55 L;  1YJ9 O;  1Q7Y M;  1K8A P;  1VQ4 L;  3I56 L;  4W8K A;  2OTJ L;  3CC4 L;  1Q82 M;  2OTJ O;  3CC4 O;  1VQP L;  1S72 L;  1VQ6 L;  5DQT A;  1KC8 P;  1VQP O;  1S72 O;  1VQO O;  1K9M P;  1YJW O;  1Q86 P;  3CC2 L;  3CC2 O; 
#chains in the Genus database with same CATH homology
 1M90 P;  1QVF N;  4XTK A;  1KQS N;  3CCR O;  3CC7 L;  1VQL L;  1VQ7 L;  1YJ9 L;  1M1K P;  5DS6 A;  3OW2 K;  3CPW K;  3CCQ O;  1JJ2 K;  3CCL L;  3CD6 O;  4N06 A;  3CCL O;  1VQO L;  5DS5 A;  1N8R M;  1YJW L;  1KD1 P;  3CMA O;  3CCM O;  5FCL A;  1YHQ O;  1QVG N;  1VQM O;  1K8A M;  3CXC N;  3G4S O;  3CCR L;  1W2B K;  1VQ5 O;  3CCS O;  1KC8 M;  1NJI P;  1K73 P;  1K9M M;  3GOD A;  1Q86 M;  3CCQ L;  5DQZ A;  1YI2 O;  1Q7Y P;  3CD6 L;  2QEX O;  1M90 M;  3CCE O;  1Q81 P;  1VQ9 L;  2YZS A;  3CMA L;  3CCM L;  2OTL O;  1YHQ L;  1VQ9 O;  1VQM L;  1QVF K;  1KQS K;  1VQN O;  3CME O;  1VQK O;  1NJI M;  1M1K M;  1VQ8 O;  3G4S L;  1YIJ O;  1VQ5 L;  3G6E O;  3CCS L;  3CCV O;  2QA4 L;  1YJN O;  1YIT O;  3I55 O;  2QA4 O;  1VQ4 O;  3I56 O;  1Q81 M;  1KD1 M;  5DS4 A;  3OW2 N;  5DLJ A;  1YI2 L;  3CPW N;  1JJ2 N;  1VQ6 O;  3CCU L;  2QEX L;  3G71 L;  3CCE L;  3CCU O;  3NKD A;  1QVG K;  3G71 O;  2OTL L;  1Q82 P;  1VQN L;  3CME L;  3CXC K;  3CCJ L;  1VQK L;  4QDL A;  1VQ8 L;  3CCJ O;  1N8R P;  1YIJ L;  1K73 M;  3G6E L;  4P6I C;  3CC7 O;  3CCV L;  1VQL O;  1YJN L;  1VQ7 O;  1YIT L;  1W2B N;  4WJ0 A;  3I55 L;  1YJ9 O;  1Q7Y M;  1K8A P;  1VQ4 L;  3I56 L;  4W8K A;  2OTJ L;  3CC4 L;  1Q82 M;  2OTJ O;  3CC4 O;  1VQP L;  1S72 L;  1VQ6 L;  5DQT A;  1KC8 P;  1VQP O;  1S72 O;  1VQO O;  1K9M P;  1YJW O;  1Q86 P;  3CC2 L;  3CC2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...