1NS5A

X-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
Knots found
sequence length
153
structure length
153
Chain Sequence
b'MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ybeA
publication title Structure of YBEA from E. coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 50
structure length 153
sequence length 153
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1ns5A00
1UAJA 4YQ8A 4YQLA 4H3ZA 2O3AA 4YQ6A 1X7OA 4YQAA 4YQKA 4XBOA 1O6DA 1UAMA 5GMBA 1IPAA 2QMMA 4J3CA 2EGVA 4JAKA 1UALA 4YPYA 4YQDA 2V3JA 3OIJA 1UAKA 2EGWA 4YQJA 4YQQA 5FAIA 3OIIA 4YQ2A 2QWVA 3BBHA 3N4KA 3OINA 1NS5A 4YQRA 4X3MA 3N4JA 3KNUA 3AIAA 3DCMX 4YQPA 4JALA 4CNGA 4YQ9A 1X7PA 4YVIA 3O7BA 2YY8A 3AI9X 2I6DA 3NK6A 2CX8A 5D9FA 4YQCA 3ILKA 4H3YA 4YQGA 4CNDA 4KGNA 4YVKA 3BBEA 4YQ1A 1V2XA 3ONPA 4YQSA 1P9PA 3NK7A 2V3KA 4YQ0A 4YQBA 4YPZA 4FAKA 4YPXA 4CNEA 4X3LA 4IG6A 1MXIA 1ZJRA 4E8BA 4YQ4A 3E5YA 3IC6A 1V6ZA 4YQIA 1TO0A 3KTYA 4MCBA 1VHKA 3KW2A 4CNFA 1VH0A 4MCDA 1VHYA 5CO4A 5GMCA 2HA8A 4YVJA 4YQ7A 4MCCA 4PZKA 4YVHA 1GZ0A 4YQNA 4YQ5A 4YVGA 1NXZA 4YQ3A 3GYQA 4YQTA 3IEFA 3KY7A 3L8UA 5GM8A 1Z85A 3AXZA 4RG1A 4YQOA 4YPWA 4L69A 1J85A 3QUVA 1K3RA 4KDZA 2Z0YA 3BBDA 1OY5A
chains in the Genus database with same CATH superfamily
1UAJA 4JWFA 4YQ8A 4YQLA 4H3ZA 2O3AA 4YQ6A 1X7OA 4YQAA 4YQKA 4XBOA 1O6DA 1UAMA 5GMBA 1IPAA 2QMMA 4J3CA 4JWGA 2EGVA 4JAKA 1UALA 4YPYA 4YQDA 2V3JA 3OIJA 1UAKA 2EGWA 4YQJA 4YQQA 5FAIA 3OIIA 4YQ2A 2QWVA 3BBHA 3N4KA 3OINA 1NS5A 4YQRA 4X3MA 3N4JA 3KNUA 3AIAA 3DCMX 4YQPA 4JALA 4CNGA 4YQ9A 1X7PA 4YVIA 3O7BA 2YY8A 3AI9X 2I6DA 3NK6A 2CX8A 5D9FA 4YQCA 3ILKA 4H3YA 4YQGA 4CNDA 4KGNA 4YVKA 3BBEA 4YQ1A 1V2XA 3ONPA 4YQSA 1P9PA 3NK7A 4FMWA 2V3KA 4YQ0A 4YQBA 4YPZA 4FAKA 4YPXA 4CNEA 4JWJA 4X3LA 4IG6A 1MXIA 1ZJRA 4E8BA 4YQ4A 3E5YA 3IC6A 1V6ZA 4YQIA 1TO0A 3KTYA 4MCBA 1VHKA 3KW2A 4CNFA 1VH0A 4MCDA 1VHYA 5CO4A 5GMCA 2HA8A 4YVJA 4YQ7A 4MCCA 4PZKA 4YVHA 1GZ0A 4YQNA 4YQ5A 4YVGA 4JWHA 1NXZA 4YQ3A 3GYQA 4YQTA 3IEFA 3KY7A 3L8UA 5GM8A 1Z85A 3AXZA 4RG1A 4YQOA 4YPWA 4L69A 1J85A 3QUVA 1K3RA 4KDZA 2Z0YA 3BBDA 1OY5A
chains in the Genus database with same CATH topology
1UAJA 4JWFA 4YQ8A 4YQLA 4H3ZA 2O3AA 4YQ6A 1X7OA 4YQAA 4YQKA 4XBOA 1O6DA 1UAMA 5GMBA 1IPAA 2QMMA 4J3CA 4JWGA 2EGVA 4JAKA 1UALA 4YPYA 4YQDA 2V3JA 3OIJA 1UAKA 2EGWA 4YQJA 4YQQA 5FAIA 3OIIA 4YQ2A 2QWVA 3BBHA 3N4KA 3OINA 1NS5A 4YQRA 4X3MA 3N4JA 3KNUA 3AIAA 3DCMX 4YQPA 4JALA 4CNGA 4YQ9A 1X7PA 4YVIA 3O7BA 2YY8A 3AI9X 2I6DA 3NK6A 2CX8A 5D9FA 4YQCA 3ILKA 4H3YA 4YQGA 4CNDA 4KGNA 4YVKA 3BBEA 4YQ1A 1V2XA 3ONPA 4YQSA 1P9PA 3NK7A 4FMWA 2V3KA 4YQ0A 4YQBA 4YPZA 4FAKA 4YPXA 4CNEA 4JWJA 4X3LA 4IG6A 1MXIA 1ZJRA 4E8BA 4YQ4A 3E5YA 3IC6A 1V6ZA 4YQIA 1TO0A 3KTYA 4MCBA 1VHKA 3KW2A 4CNFA 1VH0A 4MCDA 1VHYA 5CO4A 5GMCA 2HA8A 4YVJA 4YQ7A 4MCCA 4PZKA 4YVHA 1GZ0A 4YQNA 4YQ5A 4YVGA 4JWHA 1NXZA 4YQ3A 3GYQA 4YQTA 3IEFA 3KY7A 3L8UA 5GM8A 1Z85A 3AXZA 4RG1A 4YQOA 4YPWA 4L69A 1J85A 3QUVA 1K3RA 4KDZA 2Z0YA 3BBDA 1OY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAJ A;  4YQ8 A;  4YQL A;  4H3Z A;  2O3A A;  4YQ6 A;  1X7O A;  4YQA A;  4YQK A;  4XBO A;  1O6D A;  1UAM A;  5GMB A;  1IPA A;  2QMM A;  4J3C A;  2EGV A;  4JAK A;  1UAL A;  4YPY A;  4YQD A;  2V3J A;  3OIJ A;  1UAK A;  2EGW A;  4YQJ A;  4YQQ A;  5FAI A;  3OII A;  4YQ2 A;  2QWV A;  3BBH A;  3N4K A;  3OIN A;  1NS5 A;  4YQR A;  4X3M A;  3N4J A;  3KNU A;  3AIA A;  3DCM X;  4YQP A;  4JAL A;  4CNG A;  4YQ9 A;  1X7P A;  4YVI A;  3O7B A;  2YY8 A;  3AI9 X;  2I6D A;  3NK6 A;  2CX8 A;  5D9F A;  4YQC A;  3ILK A;  4H3Y A;  4YQG A;  4CND A;  4KGN A;  4YVK A;  3BBE A;  4YQ1 A;  1V2X A;  3ONP A;  4YQS A;  1P9P A;  3NK7 A;  2V3K A;  4YQ0 A;  4YQB A;  4YPZ A;  4FAK A;  4YPX A;  4CNE A;  4X3L A;  4IG6 A;  1MXI A;  1ZJR A;  4E8B A;  4YQ4 A;  3E5Y A;  3IC6 A;  1V6Z A;  4YQI A;  1TO0 A;  3KTY A;  4MCB A;  1VHK A;  3KW2 A;  4CNF A;  1VH0 A;  4MCD A;  1VHY A;  5CO4 A;  5GMC A;  2HA8 A;  4YVJ A;  4YQ7 A;  4MCC A;  4PZK A;  4YVH A;  1GZ0 A;  4YQN A;  4YQ5 A;  4YVG A;  1NXZ A;  4YQ3 A;  3GYQ A;  4YQT A;  3IEF A;  3KY7 A;  3L8U A;  5GM8 A;  1Z85 A;  3AXZ A;  4RG1 A;  4YQO A;  4YPW A;  4L69 A;  1J85 A;  3QUV A;  1K3R A;  4KDZ A;  2Z0Y A;  3BBD A;  1OY5 A; 
#chains in the Genus database with same CATH topology
 1UAJ A;  4JWF A;  4YQ8 A;  4YQL A;  4H3Z A;  2O3A A;  4YQ6 A;  1X7O A;  4YQA A;  4YQK A;  4XBO A;  1O6D A;  1UAM A;  5GMB A;  1IPA A;  2QMM A;  4J3C A;  4JWG A;  2EGV A;  4JAK A;  1UAL A;  4YPY A;  4YQD A;  2V3J A;  3OIJ A;  1UAK A;  2EGW A;  4YQJ A;  4YQQ A;  5FAI A;  3OII A;  4YQ2 A;  2QWV A;  3BBH A;  3N4K A;  3OIN A;  1NS5 A;  4YQR A;  4X3M A;  3N4J A;  3KNU A;  3AIA A;  3DCM X;  4YQP A;  4JAL A;  4CNG A;  4YQ9 A;  1X7P A;  4YVI A;  3O7B A;  2YY8 A;  3AI9 X;  2I6D A;  3NK6 A;  2CX8 A;  5D9F A;  4YQC A;  3ILK A;  4H3Y A;  4YQG A;  4CND A;  4KGN A;  4YVK A;  3BBE A;  4YQ1 A;  1V2X A;  3ONP A;  4YQS A;  1P9P A;  3NK7 A;  4FMW A;  2V3K A;  4YQ0 A;  4YQB A;  4YPZ A;  4FAK A;  4YPX A;  4CNE A;  4JWJ A;  4X3L A;  4IG6 A;  1MXI A;  1ZJR A;  4E8B A;  4YQ4 A;  3E5Y A;  3IC6 A;  1V6Z A;  4YQI A;  1TO0 A;  3KTY A;  4MCB A;  1VHK A;  3KW2 A;  4CNF A;  1VH0 A;  4MCD A;  1VHY A;  5CO4 A;  5GMC A;  2HA8 A;  4YVJ A;  4YQ7 A;  4MCC A;  4PZK A;  4YVH A;  1GZ0 A;  4YQN A;  4YQ5 A;  4YVG A;  4JWH A;  1NXZ A;  4YQ3 A;  3GYQ A;  4YQT A;  3IEF A;  3KY7 A;  3L8U A;  5GM8 A;  1Z85 A;  3AXZ A;  4RG1 A;  4YQO A;  4YPW A;  4L69 A;  1J85 A;  3QUV A;  1K3R A;  4KDZ A;  2Z0Y A;  3BBD A;  1OY5 A; 
#chains in the Genus database with same CATH homology
 1UAJ A;  4JWF A;  4YQ8 A;  4YQL A;  4H3Z A;  2O3A A;  4YQ6 A;  1X7O A;  4YQA A;  4YQK A;  4XBO A;  1O6D A;  1UAM A;  5GMB A;  1IPA A;  2QMM A;  4J3C A;  4JWG A;  2EGV A;  4JAK A;  1UAL A;  4YPY A;  4YQD A;  2V3J A;  3OIJ A;  1UAK A;  2EGW A;  4YQJ A;  4YQQ A;  5FAI A;  3OII A;  4YQ2 A;  2QWV A;  3BBH A;  3N4K A;  3OIN A;  1NS5 A;  4YQR A;  4X3M A;  3N4J A;  3KNU A;  3AIA A;  3DCM X;  4YQP A;  4JAL A;  4CNG A;  4YQ9 A;  1X7P A;  4YVI A;  3O7B A;  2YY8 A;  3AI9 X;  2I6D A;  3NK6 A;  2CX8 A;  5D9F A;  4YQC A;  3ILK A;  4H3Y A;  4YQG A;  4CND A;  4KGN A;  4YVK A;  3BBE A;  4YQ1 A;  1V2X A;  3ONP A;  4YQS A;  1P9P A;  3NK7 A;  4FMW A;  2V3K A;  4YQ0 A;  4YQB A;  4YPZ A;  4FAK A;  4YPX A;  4CNE A;  4JWJ A;  4X3L A;  4IG6 A;  1MXI A;  1ZJR A;  4E8B A;  4YQ4 A;  3E5Y A;  3IC6 A;  1V6Z A;  4YQI A;  1TO0 A;  3KTY A;  4MCB A;  1VHK A;  3KW2 A;  4CNF A;  1VH0 A;  4MCD A;  1VHY A;  5CO4 A;  5GMC A;  2HA8 A;  4YVJ A;  4YQ7 A;  4MCC A;  4PZK A;  4YVH A;  1GZ0 A;  4YQN A;  4YQ5 A;  4YVG A;  4JWH A;  1NXZ A;  4YQ3 A;  3GYQ A;  4YQT A;  3IEF A;  3KY7 A;  3L8U A;  5GM8 A;  1Z85 A;  3AXZ A;  4RG1 A;  4YQO A;  4YPW A;  4L69 A;  1J85 A;  3QUV A;  1K3R A;  4KDZ A;  2Z0Y A;  3BBD A;  1OY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...