1Q7YH

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q7yH00
1VQ7F 1VQOF 1NJIH 2BO1A 2KTVA 3CMEF 5G4VC 1YI2F 5DCVA 1CN7A 2QI2A 2OTJF 2KG4A 3OW2F 1JJ2F 3OBYA 1VQKF 3CPWF 3CCJF 2OHWA 2ALEA 1VQNF 1M90H 1K8AH 3CC7F 1GO0A 1Q7YH 3NVIB 3IR9A 3CG6A 2VGMA 1K73H 1DT9A 1W42A 1YJWF 3VI6A 2AIFA 4X3MA 4BY9D 3LWRC 3CMAF 1XBIA 3MCAB 3G71F 2QA4F 3RA6A 5GINC 1RLGA 3V7QA 4TZZA 3LWPC 1VQ8F 2CZWA 1H7MA 1N8RH 1YITF 5FLXM 3GYQA 2LBXA 3CC4F 3LFOA 3CCRF 1YJ9F 1VQ6F 1Q81H 3OBWA 3SIVA 1VQLF 3N4ZA 5GANK 5GIPC 3CCQF 1W40A 1QVGF 3CCEF 3SIUA 1X7PA 1Q82H 1YHQF 2HVYD 5EO3A 2VGNA 1T0KB 2FC3A 1VQPF 4X3LA 1KQSF 3CCLF 3NK6A 1GZ0A 1M1KH 3CCVF 3G6EF 3JAMM 3CC2F 3CCUF 3PLAC 3E20B 3LWQC 1VQMF 3CD6F 4NUTA 3J7AR 3AGKA 1SDSA 3LWOC 3CCMF 3HAXD 1W2BF 1W41A 2I6DA 2KTUA 2WALA 2LBWA 1X52A 1ZWZA 3I55F 1S72F 3G4SF 3VMFB 1W3EX 3ON1A 3NK7A 3WXMB 2JNBA 3CPQA 1VQ4F 1VQ5F 2QEXF 1VQ9F 3NMUC 4C4WC 1KD1H 4LCKA 1CK2A 3E1YA 1X7OA 3J80M 1YIJF 1RA4A 3CXCF 3V7EA 3LWVC 1E7KA 1KC8H 1IPAA 2OTLF 5GAPK 1Q86H 5IT9M 1GO1A 1PXWA 4BW0B 3NVKE 3O85A 3CCSF 1NMUB 3JCMM 3N4YA 5G4UC 3FFMA 5A2QM 1YJNF 5EWRA 1K9MH 3PAFA 3RA5A 5FJ4C 3J81M 3I56F 3HJWC 2OZBA 5GIOC 1QVFF
chains in the Genus database with same CATH superfamily
3S02A 5JQGA 1H48A 5KX5B 5GONB 1JFFB 1U3PA 3LYBA 1YI2F 3RYCA 5DCVA 3C9RA 5HXUA 3OW2F 2ZVZA 1Q8RA 3M4SA 4XCQA 5HP8A 3CPWF 5IJ0A 3CCJF 5BMVB 2BTUA 4F6RB 1VQNF 2CW4A 1M90H 1YQNA 2ZODA 1Q7YH 1OAPA 5KMGB 2HRUA 4TUYA 5IYZA 3VI6A 2AIFA 2H6LA 4FFBB 2Z1EA 4I55B 5LA6A 4BY9D 4X1IB 1QU9A 3F0DA 3RE3A 2CWJA 4DRXA 3E22B 1XBIA 3VCZA 5EYPB 2QA4F 3F0EA 4TV8B 5LP6A 1GX1A 4TZZA 3IEWA 1VQ8F 1H7MA 5MN5A 2LBXA 4NWOB 1X25A 3P4EA 2LBTA 4C81A 1Z5WA 3WGMA 5KX5A 1VH8A 5GONA 1JFFA 1YJ9F 4X1YB 5LXTA 1FFXB 2ZVYA 3RYFB 3VOAA 1VQLF 5HY2A 3CCQF 3LDTA 2PHNA 5BMVA 1W5BA 4F6RA 4G4YA 2K1SA 3CCVF 3M1XA 4BT4A 5KMGA 2AIZP 3TD3A 4TV9B 2HS0A 4I55A 2DYYA 1SZQA 2MQEA 1Z5VA 3AGKA 4X1IA 1SDSA 3LWOC 3CCMF 3WJPA 3E22A 3MBMA 3QUWA 2WALA 5EYPA 3HKBA 4TV8A 1SA0B 4X20A 3CYPB 3WXMB 2QEXF 3KJJA 5JVDB 5FNVB 3J80M 1IV1A 4B45A 4O4IB 4X1YA 1KC8H 2ZF8A 5GAPK 1U40A 3FBAA 3RYFA 3NVKE 5HWEA 3KIZA 2Z1TA 1NMUB 3JCMM 2GZLA 1YJNF 3GHZA 2UYNA 3D01A 1K9MH 3J81M 1T0AA 4ZOLB 5GIOC 5EZYB 3S0HA 2UYJA 5C8YB 1W5FA 3VIUA 5CB4B 5LOVB 3IEQA 4TV9A 5JCOC 1JY8A 2RHJA 1KNJA 4WBNB 3TD5A 3ELCA 3JARA 2FGYA 4LNUB 2KG4A 1JJ2F 3OBYA 3P0ZA 1DBFA 4O4JA 2NMUA 3RYIB 2G9IA 3HKEB 5JVDA 4BVSA 2DT4A 2OHWA 5FNVA 4ZHWA 3B6NA 3NVIB 1COMA 3CG6A 3VYUC 1K73H 4YJ3B 4EI9A 1YGYA 4O4LB 3V3TA 4NQ3A 3WPXA 1VK3A 4I4TB 5IJ9B 3FD6A 3QHDA 3KHNA 3S06A 3ZOPA 5GINC 3V7QA 5HP7A 4ZOLA 2CZWA 5FLXM 5EZYA 3CC4F 5CB4A 4DXDA 5LOVA 3C8LA 2BTQB 4O4HA 3CCRF 1UFYA 3D54A 4WBNA 3WJQA 4C82A 4LNUA 5GIPC 5EB1B 3SIUA 4HNAB 3P10A 1Q82H 4O2BB 1YHQF 1TVKB 5EO3A 1XV2A 4EI8A 5EIBD 3RYIA 4BT7A 4X3LA 3JAKA 1M1KH 3GTZA 2AMTA 5EAZA 3G6EF 5JH7B 3HKCB 4B62A 3E20B 3F0GA 4YJ3A 1FNJA 2R6R1 3C9UA 4ZI7B 4NUTA 1IV2A 4O4LA 2LCAA 5J2UB 4I4TA 5IJ9A 2HS4A 2I6DA 3KJKA 2KTUA 3JALB 2LBWA 1X52A 3I7TA 3FPIA 3IMPA 5MN6A 2BTOA 5CA1B 3I55F 1U43A 2Z1FA 1R1MA 1JD1A 3ON1A 4B5CA 1JN1A 1VQ4F 5MN4A 4LCKA 3F6MA 3R0PA 4U39A 4KWEA 4YJ2B 5CA0B 3LWVC 2YXZA 3M84A 2P6YA 1OFUA 1W581 2I6RA 2RHLA 2UZHA 4BW0B 3LMEA 4BVQA 3CCSF 2F9ZC 2RHOA 3N4YA 4FFBA 4HNAA 3FFMA 5A2QM 4O2BA 3JASB 1TVKA 2Q1XA 1IV3A 4IIJB 3RA5A 3VOBA 4BT3A 5HY4A 3WPWA 1VQ7F 3VYSC 5JH7A 1VQOF 4ZI7A 3Q8HA 2BO1A 2KTVA 1UI9A 1RQ2A 3CMEF 5G4VC 5J2UA 2IAFA 3JAWB 4IHJB 1FSZA 2OTJF 3JALA 1FFXA 1VQKF 5CA1A 3DC2A 3K0TA 2CHTA 3S0YA 1K8AH 3CC7F 2RB9A 3KE1A 4YJ2A 3ESJA 1DT9A 5EB0A 1NQ3A 1W55A 3K14A 3LWRC 2HP3A 3WGJA 5LYJB 4PWTA 3CMAF 3L7QA 2RHHA 3MCAB 3JASA 3G71F 3RA6A 1U3LA 3VYTC 4G4WA 3LWPC 1N8RH 3WGKA 4ZK7A 1YITF 3FD5A 3GYQA 1SA0A 3I3FA 3OONA 5HXZA 3QTYA 3RYCB 4BT6A 3CYQA 4X1KB 1J7HA 2IG8A 1H47A 1VQ6F 2V9YA 2Z1UA 3MQWA 1Q81H 3SIVA 2HP0B 2CHSA 4RQOA 5J2TB 3VTIC 3N4ZA 4O4IA 1W40A 1RQ7A 4BVRA 3CCEF 3V4DA 2Q1YA 3ZO8A 1T0KB 4O2AB 4ERHA 2IQQA 3NK6A 1GZ0A 3TD4A 4ZHVA 3CC2F 3JAMM 3PLAC 3JATB 3LWQC 3CD6F 5C8YA 4R40B 3HAXD 1W5EA 4BT5A 1W41A 1RLUA 1XHOA 4M8IA 2R751 3S0WA 1W3EX 3NK7A 2JNBA 1VQ9F 3NMUC 2QTPA 5LXTB 1CK2A 3E1YA 1X7OA 1YIJF 4X1KA 3V7EA 3WGLA 5LP6C 3HKEA 3K2XA 1W57A 3MDOA 3D00A 5IT9M 2VXYA 2HP0A 5J2TA 2H8CA 1PXWA 4B46A 3O85A 5G4UC 3ERNA 3DDNA 4BT2A 5EWRA 3PAFA 2VAMA 5FJ4C 4O2AA 3U0OA 4C8GA 4I50B 3UT5B 3JATA 2KGWA 1NJIH 1QD9A 3S03A 3HKBB 4ZHQB 3RYHB 4X20B 2CSLA 1CN7A 2QI2A 2VAWA 3CB2A 2UYKA 4G4ZA 3HTNA 2ALEA 4G4XA 1GO0A 4BVTA 3ZP4A 3IR9A 2VGMA 2HS3A 1W42A 1YJWF 3K12A 4X3MA 1W5AA 2HX0A 3HKCA 2Z01A 5ITZB 3IKFA 2UYNB 3IKEA 1CLIA 1RLGA 3WJRA 1FNKA 3BYQA 3ZP7A 3HKDB 4EB6B 4I50A 2HQSC 2HRYA 3UT5A 3C9SA 3F0FA 3C9TA 5HY1A 3LFOA 3JARB 1ONIA 3N2GB 4ZHQA 4G88A 1TUBB 3OBWA 3RYHA 5CA0A 2L26A 3MCQA 5EIBC 3VO8A 4RHAA 4O4JB 2GVIA 5GANK 1QVGF 3WGNA 1X7PA 1KNKA 2GLZA 3N2KB 3T80A 5AVMA 2HVYD 2VGNA 4U3JB 2W8BC 2FC3A 1VQPF 1KQSF 5B8FA 3CCLF 1IV4A 4IIJA 3CCUF 1VQVA 2H8EA 4EI7A 2UYPA 5JQGB 1VQMF 3HWUA 3J7AR 3EORA 5ITZA 2YYEA 2ZOVA 1ODEA 2B33A 1XRGA 1W2BF 1ZWZA 3HKDA 1S72F 3G4SF 4G4VA 3VMFB 3JAWA 4IHJA 4O4HB 4EB6A 5IJ0B 3CPQA 1VQ5F 4C4WC 1W59A 4E6EA 1KD1H 4C8EA 5JCOA 1RA4A 3CXCF 1VHAA 1E7KA 2OTMA 4TUYB 5IYZB 1IPAA 2OTLF 1Q86H 3N2GA 1TUBA 1GO1A 1PF5A 2VAPA 3JVHA 5HY0A 5LA6B 2PMPA 4DRXB 1QAHA 4ZHYB 2ZAUA 3JAKB 3N2KA 4U3JA 5LP6B 2N48A 5LYJA 2EWCA 3I56F 2CVLA 4C8IA 3HJWC 2OZBA 1QVFF
chains in the Genus database with same CATH topology
1VQ7F 1VQOF 1NJIH 2BO1A 2KTVA 3CMEF 5G4VC 1YI2F 5DCVA 1CN7A 2QI2A 2FGYA 2OTJF 5HXUA 2KG4A 3OW2F 1JJ2F 3OBYA 1VQKF 4XCQA 3CPWF 3CCJF 4BVSA 2OHWA 2ALEA 1VQNF 1M90H 1K8AH 3CC7F 1GO0A 4BVTA 1Q7YH 3NVIB 3IR9A 3CG6A 2VGMA 1K73H 1DT9A 4EI9A 1W42A 1YJWF 3VI6A 2AIFA 4X3MA 4BY9D 3LWRC 3V3TA 4NQ3A 3CMAF 1XBIA 3MCAB 3G71F 2QA4F 3RA6A 5GINC 1RLGA 3V7QA 4TZZA 3LWPC 1VQ8F 2CZWA 1H7MA 1N8RH 1YITF 5FLXM 3GYQA 2LBXA 3CC4F 5HXZA 5HY1A 3LFOA 3CCRF 1YJ9F 1VQ6F 1Q81H 3OBWA 3SIVA 1VQLF 3N4ZA 5HY2A 5GANK 5GIPC 3CCQF 1W40A 1QVGF 4BVRA 3CCEF 3SIUA 1X7PA 1Q82H 1YHQF 2GLZA 2HVYD 5EO3A 2VGNA 4EI8A 1T0KB 2FC3A 1VQPF 4X3LA 1KQSF 3CCLF 3NK6A 1GZ0A 1M1KH 3CCVF 3G6EF 3JAMM 3CC2F 3CCUF 3PLAC 3E20B 3LWQC 4EI7A 1VQMF 3CD6F 4NUTA 3J7AR 3AGKA 1SDSA 3LWOC 3CCMF 3HAXD 1W2BF 1W41A 2I6DA 2KTUA 2WALA 2LBWA 1X52A 1ZWZA 3I55F 1S72F 3G4SF 3VMFB 1W3EX 3ON1A 3NK7A 3WXMB 2JNBA 3CPQA 1VQ4F 1VQ5F 2QEXF 1VQ9F 3NMUC 4C4WC 1KD1H 4LCKA 1CK2A 3E1YA 1X7OA 3J80M 1YIJF 1RA4A 3CXCF 3V7EA 3LWVC 1E7KA 1KC8H 1IPAA 2OTLF 5GAPK 1Q86H 3D00A 5IT9M 1GO1A 5HY0A 1PXWA 4BW0B 3NVKE 3O85A 5HWEA 4BVQA 3CCSF 1NMUB 2F9ZC 3JCMM 3N4YA 5G4UC 3FFMA 5A2QM 1YJNF 5EWRA 1K9MH 3PAFA 3RA5A 5FJ4C 3J81M 3I56F 3HJWC 2OZBA 5GIOC 1QVFF 5HY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 F;  1VQO F;  1NJI H;  2BO1 A;  2KTV A;  3CME F;  5G4V C;  1YI2 F;  5DCV A;  1CN7 A;  2QI2 A;  2OTJ F;  2KG4 A;  3OW2 F;  1JJ2 F;  3OBY A;  1VQK F;  3CPW F;  3CCJ F;  2OHW A;  2ALE A;  1VQN F;  1M90 H;  1K8A H;  3CC7 F;  1GO0 A;  1Q7Y H;  3NVI B;  3IR9 A;  3CG6 A;  2VGM A;  1K73 H;  1DT9 A;  1W42 A;  1YJW F;  3VI6 A;  2AIF A;  4X3M A;  4BY9 D;  3LWR C;  3CMA F;  1XBI A;  3MCA B;  3G71 F;  2QA4 F;  3RA6 A;  5GIN C;  1RLG A;  3V7Q A;  4TZZ A;  3LWP C;  1VQ8 F;  2CZW A;  1H7M A;  1N8R H;  1YIT F;  5FLX M;  3GYQ A;  2LBX A;  3CC4 F;  3LFO A;  3CCR F;  1YJ9 F;  1VQ6 F;  1Q81 H;  3OBW A;  3SIV A;  1VQL F;  3N4Z A;  5GAN K;  5GIP C;  3CCQ F;  1W40 A;  1QVG F;  3CCE F;  3SIU A;  1X7P A;  1Q82 H;  1YHQ F;  2HVY D;  5EO3 A;  2VGN A;  1T0K B;  2FC3 A;  1VQP F;  4X3L A;  1KQS F;  3CCL F;  3NK6 A;  1GZ0 A;  1M1K H;  3CCV F;  3G6E F;  3JAM M;  3CC2 F;  3CCU F;  3PLA C;  3E20 B;  3LWQ C;  1VQM F;  3CD6 F;  4NUT A;  3J7A R;  3AGK A;  1SDS A;  3LWO C;  3CCM F;  3HAX D;  1W2B F;  1W41 A;  2I6D A;  2KTU A;  2WAL A;  2LBW A;  1X52 A;  1ZWZ A;  3I55 F;  1S72 F;  3G4S F;  3VMF B;  1W3E X;  3ON1 A;  3NK7 A;  3WXM B;  2JNB A;  3CPQ A;  1VQ4 F;  1VQ5 F;  2QEX F;  1VQ9 F;  3NMU C;  4C4W C;  1KD1 H;  4LCK A;  1CK2 A;  3E1Y A;  1X7O A;  3J80 M;  1YIJ F;  1RA4 A;  3CXC F;  3V7E A;  3LWV C;  1E7K A;  1KC8 H;  1IPA A;  2OTL F;  5GAP K;  1Q86 H;  5IT9 M;  1GO1 A;  1PXW A;  4BW0 B;  3NVK E;  3O85 A;  3CCS F;  1NMU B;  3JCM M;  3N4Y A;  5G4U C;  3FFM A;  5A2Q M;  1YJN F;  5EWR A;  1K9M H;  3PAF A;  3RA5 A;  5FJ4 C;  3J81 M;  3I56 F;  3HJW C;  2OZB A;  5GIO C;  1QVF F; 
#chains in the Genus database with same CATH topology
 3S02 A;  5JQG A;  1H48 A;  5KX5 B;  5GON B;  1JFF B;  1U3P A;  3LYB A;  1YI2 F;  3RYC A;  5DCV A;  3C9R A;  5HXU A;  3OW2 F;  2ZVZ A;  1Q8R A;  3M4S A;  4XCQ A;  5HP8 A;  3CPW F;  5IJ0 A;  3CCJ F;  5BMV B;  2BTU A;  4F6R B;  1VQN F;  2CW4 A;  1M90 H;  1YQN A;  2ZOD A;  1Q7Y H;  1OAP A;  5KMG B;  2HRU A;  4TUY A;  5IYZ A;  3VI6 A;  2AIF A;  2H6L A;  4FFB B;  2Z1E A;  4I55 B;  5LA6 A;  4BY9 D;  4X1I B;  1QU9 A;  3F0D A;  3RE3 A;  2CWJ A;  4DRX A;  3E22 B;  1XBI A;  3VCZ A;  5EYP B;  2QA4 F;  3F0E A;  4TV8 B;  5LP6 A;  1GX1 A;  4TZZ A;  3IEW A;  1VQ8 F;  1H7M A;  5MN5 A;  2LBX A;  4NWO B;  1X25 A;  3P4E A;  2LBT A;  4C81 A;  1Z5W A;  3WGM A;  5KX5 A;  1VH8 A;  5GON A;  1JFF A;  1YJ9 F;  4X1Y B;  5LXT A;  1FFX B;  2ZVY A;  3RYF B;  3VOA A;  1VQL F;  5HY2 A;  3CCQ F;  3LDT A;  2PHN A;  5BMV A;  1W5B A;  4F6R A;  4G4Y A;  2K1S A;  3CCV F;  3M1X A;  4BT4 A;  5KMG A;  2AIZ P;  3TD3 A;  4TV9 B;  2HS0 A;  4I55 A;  2DYY A;  1SZQ A;  2MQE A;  1Z5V A;  3AGK A;  4X1I A;  1SDS A;  3LWO C;  3CCM F;  3WJP A;  3E22 A;  3MBM A;  3QUW A;  2WAL A;  5EYP A;  3HKB A;  4TV8 A;  1SA0 B;  4X20 A;  3CYP B;  3WXM B;  2QEX F;  3KJJ A;  5JVD B;  5FNV B;  3J80 M;  1IV1 A;  4B45 A;  4O4I B;  4X1Y A;  1KC8 H;  2ZF8 A;  5GAP K;  1U40 A;  3FBA A;  3RYF A;  3NVK E;  5HWE A;  3KIZ A;  2Z1T A;  1NMU B;  3JCM M;  2GZL A;  1YJN F;  3GHZ A;  2UYN A;  3D01 A;  1K9M H;  3J81 M;  1T0A A;  4ZOL B;  5GIO C;  5EZY B;  3S0H A;  2UYJ A;  5C8Y B;  1W5F A;  3VIU A;  5CB4 B;  5LOV B;  3IEQ A;  4TV9 A;  5JCO C;  1JY8 A;  2RHJ A;  1KNJ A;  4WBN B;  3TD5 A;  3ELC A;  3JAR A;  2FGY A;  4LNU B;  2KG4 A;  1JJ2 F;  3OBY A;  3P0Z A;  1DBF A;  4O4J A;  2NMU A;  3RYI B;  2G9I A;  3HKE B;  5JVD A;  4BVS A;  2DT4 A;  2OHW A;  5FNV A;  4ZHW A;  3B6N A;  3NVI B;  1COM A;  3CG6 A;  3VYU C;  1K73 H;  4YJ3 B;  4EI9 A;  1YGY A;  4O4L B;  3V3T A;  4NQ3 A;  3WPX A;  1VK3 A;  4I4T B;  5IJ9 B;  3FD6 A;  3QHD A;  3KHN A;  3S06 A;  3ZOP A;  5GIN C;  3V7Q A;  5HP7 A;  4ZOL A;  2CZW A;  5FLX M;  5EZY A;  3CC4 F;  5CB4 A;  4DXD A;  5LOV A;  3C8L A;  2BTQ B;  4O4H A;  3CCR F;  1UFY A;  3D54 A;  4WBN A;  3WJQ A;  4C82 A;  4LNU A;  5GIP C;  5EB1 B;  3SIU A;  4HNA B;  3P10 A;  1Q82 H;  4O2B B;  1YHQ F;  1TVK B;  5EO3 A;  1XV2 A;  4EI8 A;  5EIB D;  3RYI A;  4BT7 A;  4X3L A;  3JAK A;  1M1K H;  3GTZ A;  2AMT A;  5EAZ A;  3G6E F;  5JH7 B;  3HKC B;  4B62 A;  3E20 B;  3F0G A;  4YJ3 A;  1FNJ A;  2R6R 1;  3C9U A;  4ZI7 B;  4NUT A;  1IV2 A;  4O4L A;  2LCA A;  5J2U B;  4I4T A;  5IJ9 A;  2HS4 A;  2I6D A;  3KJK A;  2KTU A;  3JAL B;  2LBW A;  1X52 A;  3I7T A;  3FPI A;  3IMP A;  5MN6 A;  2BTO A;  5CA1 B;  3I55 F;  1U43 A;  2Z1F A;  1R1M A;  1JD1 A;  3ON1 A;  4B5C A;  1JN1 A;  1VQ4 F;  5MN4 A;  4LCK A;  3F6M A;  3R0P A;  4U39 A;  4KWE A;  4YJ2 B;  5CA0 B;  3LWV C;  2YXZ A;  3M84 A;  2P6Y A;  1OFU A;  1W58 1;  2I6R A;  2RHL A;  2UZH A;  4BW0 B;  3LME A;  4BVQ A;  3CCS F;  2F9Z C;  2RHO A;  3N4Y A;  4FFB A;  4HNA A;  3FFM A;  5A2Q M;  4O2B A;  3JAS B;  1TVK A;  2Q1X A;  1IV3 A;  4IIJ B;  3RA5 A;  3VOB A;  4BT3 A;  5HY4 A;  3WPW A;  1VQ7 F;  3VYS C;  5JH7 A;  1VQO F;  4ZI7 A;  3Q8H A;  2BO1 A;  2KTV A;  1UI9 A;  1RQ2 A;  3CME F;  5G4V C;  5J2U A;  2IAF A;  3JAW B;  4IHJ B;  1FSZ A;  2OTJ F;  3JAL A;  1FFX A;  1VQK F;  5CA1 A;  3DC2 A;  3K0T A;  2CHT A;  3S0Y A;  1K8A H;  3CC7 F;  2RB9 A;  3KE1 A;  4YJ2 A;  3ESJ A;  1DT9 A;  5EB0 A;  1NQ3 A;  1W55 A;  3K14 A;  3LWR C;  2HP3 A;  3WGJ A;  5LYJ B;  4PWT A;  3CMA F;  3L7Q A;  2RHH A;  3MCA B;  3JAS A;  3G71 F;  3RA6 A;  1U3L A;  3VYT C;  4G4W A;  3LWP C;  1N8R H;  3WGK A;  4ZK7 A;  1YIT F;  3FD5 A;  3GYQ A;  1SA0 A;  3I3F A;  3OON A;  5HXZ A;  3QTY A;  3RYC B;  4BT6 A;  3CYQ A;  4X1K B;  1J7H A;  2IG8 A;  1H47 A;  1VQ6 F;  2V9Y A;  2Z1U A;  3MQW A;  1Q81 H;  3SIV A;  2HP0 B;  2CHS A;  4RQO A;  5J2T B;  3VTI C;  3N4Z A;  4O4I A;  1W40 A;  1RQ7 A;  4BVR A;  3CCE F;  3V4D A;  2Q1Y A;  3ZO8 A;  1T0K B;  4O2A B;  4ERH A;  2IQQ A;  3NK6 A;  1GZ0 A;  3TD4 A;  4ZHV A;  3CC2 F;  3JAM M;  3PLA C;  3JAT B;  3LWQ C;  3CD6 F;  5C8Y A;  4R40 B;  3HAX D;  1W5E A;  4BT5 A;  1W41 A;  1RLU A;  1XHO A;  4M8I A;  2R75 1;  3S0W A;  1W3E X;  3NK7 A;  2JNB A;  1VQ9 F;  3NMU C;  2QTP A;  5LXT B;  1CK2 A;  3E1Y A;  1X7O A;  1YIJ F;  4X1K A;  3V7E A;  3WGL A;  5LP6 C;  3HKE A;  3K2X A;  1W57 A;  3MDO A;  3D00 A;  5IT9 M;  2VXY A;  2HP0 A;  5J2T A;  2H8C A;  1PXW A;  4B46 A;  3O85 A;  5G4U C;  3ERN A;  3DDN A;  4BT2 A;  5EWR A;  3PAF A;  2VAM A;  5FJ4 C;  4O2A A;  3U0O A;  4C8G A;  4I50 B;  3UT5 B;  3JAT A;  2KGW A;  1NJI H;  1QD9 A;  3S03 A;  3HKB B;  4ZHQ B;  3RYH B;  4X20 B;  2CSL A;  1CN7 A;  2QI2 A;  2VAW A;  3CB2 A;  2UYK A;  4G4Z A;  3HTN A;  2ALE A;  4G4X A;  1GO0 A;  4BVT A;  3ZP4 A;  3IR9 A;  2VGM A;  2HS3 A;  1W42 A;  1YJW F;  3K12 A;  4X3M A;  1W5A A;  2HX0 A;  3HKC A;  2Z01 A;  5ITZ B;  3IKF A;  2UYN B;  3IKE A;  1CLI A;  1RLG A;  3WJR A;  1FNK A;  3BYQ A;  3ZP7 A;  3HKD B;  4EB6 B;  4I50 A;  2HQS C;  2HRY A;  3UT5 A;  3C9S A;  3F0F A;  3C9T A;  5HY1 A;  3LFO A;  3JAR B;  1ONI A;  3N2G B;  4ZHQ A;  4G88 A;  1TUB B;  3OBW A;  3RYH A;  5CA0 A;  2L26 A;  3MCQ A;  5EIB C;  3VO8 A;  4RHA A;  4O4J B;  2GVI A;  5GAN K;  1QVG F;  3WGN A;  1X7P A;  1KNK A;  2GLZ A;  3N2K B;  3T80 A;  5AVM A;  2HVY D;  2VGN A;  4U3J B;  2W8B C;  2FC3 A;  1VQP F;  1KQS F;  5B8F A;  3CCL F;  1IV4 A;  4IIJ A;  3CCU F;  1VQV A;  2H8E A;  4EI7 A;  2UYP A;  5JQG B;  1VQM F;  3HWU A;  3J7A R;  3EOR A;  5ITZ A;  2YYE A;  2ZOV A;  1ODE A;  2B33 A;  1XRG A;  1W2B F;  1ZWZ A;  3HKD A;  1S72 F;  3G4S F;  4G4V A;  3VMF B;  3JAW A;  4IHJ A;  4O4H B;  4EB6 A;  5IJ0 B;  3CPQ A;  1VQ5 F;  4C4W C;  1W59 A;  4E6E A;  1KD1 H;  4C8E A;  5JCO A;  1RA4 A;  3CXC F;  1VHA A;  1E7K A;  2OTM A;  4TUY B;  5IYZ B;  1IPA A;  2OTL F;  1Q86 H;  3N2G A;  1TUB A;  1GO1 A;  1PF5 A;  2VAP A;  3JVH A;  5HY0 A;  5LA6 B;  2PMP A;  4DRX B;  1QAH A;  4ZHY B;  2ZAU A;  3JAK B;  3N2K A;  4U3J A;  5LP6 B;  2N48 A;  5LYJ A;  2EWC A;  3I56 F;  2CVL A;  4C8I A;  3HJW C;  2OZB A;  1QVF F; 
#chains in the Genus database with same CATH homology
 1VQ7 F;  1VQO F;  1NJI H;  2BO1 A;  2KTV A;  3CME F;  5G4V C;  1YI2 F;  5DCV A;  1CN7 A;  2QI2 A;  2FGY A;  2OTJ F;  5HXU A;  2KG4 A;  3OW2 F;  1JJ2 F;  3OBY A;  1VQK F;  4XCQ A;  3CPW F;  3CCJ F;  4BVS A;  2OHW A;  2ALE A;  1VQN F;  1M90 H;  1K8A H;  3CC7 F;  1GO0 A;  4BVT A;  1Q7Y H;  3NVI B;  3IR9 A;  3CG6 A;  2VGM A;  1K73 H;  1DT9 A;  4EI9 A;  1W42 A;  1YJW F;  3VI6 A;  2AIF A;  4X3M A;  4BY9 D;  3LWR C;  3V3T A;  4NQ3 A;  3CMA F;  1XBI A;  3MCA B;  3G71 F;  2QA4 F;  3RA6 A;  5GIN C;  1RLG A;  3V7Q A;  4TZZ A;  3LWP C;  1VQ8 F;  2CZW A;  1H7M A;  1N8R H;  1YIT F;  5FLX M;  3GYQ A;  2LBX A;  3CC4 F;  5HXZ A;  5HY1 A;  3LFO A;  3CCR F;  1YJ9 F;  1VQ6 F;  1Q81 H;  3OBW A;  3SIV A;  1VQL F;  3N4Z A;  5HY2 A;  5GAN K;  5GIP C;  3CCQ F;  1W40 A;  1QVG F;  4BVR A;  3CCE F;  3SIU A;  1X7P A;  1Q82 H;  1YHQ F;  2GLZ A;  2HVY D;  5EO3 A;  2VGN A;  4EI8 A;  1T0K B;  2FC3 A;  1VQP F;  4X3L A;  1KQS F;  3CCL F;  3NK6 A;  1GZ0 A;  1M1K H;  3CCV F;  3G6E F;  3JAM M;  3CC2 F;  3CCU F;  3PLA C;  3E20 B;  3LWQ C;  4EI7 A;  1VQM F;  3CD6 F;  4NUT A;  3J7A R;  3AGK A;  1SDS A;  3LWO C;  3CCM F;  3HAX D;  1W2B F;  1W41 A;  2I6D A;  2KTU A;  2WAL A;  2LBW A;  1X52 A;  1ZWZ A;  3I55 F;  1S72 F;  3G4S F;  3VMF B;  1W3E X;  3ON1 A;  3NK7 A;  3WXM B;  2JNB A;  3CPQ A;  1VQ4 F;  1VQ5 F;  2QEX F;  1VQ9 F;  3NMU C;  4C4W C;  1KD1 H;  4LCK A;  1CK2 A;  3E1Y A;  1X7O A;  3J80 M;  1YIJ F;  1RA4 A;  3CXC F;  3V7E A;  3LWV C;  1E7K A;  1KC8 H;  1IPA A;  2OTL F;  5GAP K;  1Q86 H;  3D00 A;  5IT9 M;  1GO1 A;  5HY0 A;  1PXW A;  4BW0 B;  3NVK E;  3O85 A;  5HWE A;  4BVQ A;  3CCS F;  1NMU B;  2F9Z C;  3JCM M;  3N4Y A;  5G4U C;  3FFM A;  5A2Q M;  1YJN F;  5EWR A;  1K9M H;  3PAF A;  3RA5 A;  5FJ4 C;  3J81 M;  3I56 F;  3HJW C;  2OZB A;  5GIO C;  1QVF F;  5HY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...