1Q82J

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 27
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1q82J00
4WCEJ 3CPWH 5AN9F 1VQPH 1YI2H 1VQ4H 2QEXH 3CCEH 5H1SO 1YJWH 1KD1J 1YJNH 1VQOH 4WF9J 3CMEH 1YJ9H 5GAGN 3CC7H 1WKIA 1YITH 4IOAJ 1VQ6H 3CC2H 1YHQH 3CMAH 1Q86J 2ZJRJ 5GAHN 3J7ZM 3CXCH 4WFAJ 3G4SH 1S72H 2ZJQJ 3CF5J 5GADN 1QVGH 1K9MJ 2QA4H 3CCSH 3CCUH 1JJ2H 5JVGJ 3CCLH 4IOCJ 1Q7YJ 3G6EH 2ZJPJ 3CCMH 3CCVH 4WFBJ 3CCQH 1NJIJ 1KQSH 3OW2H 1Q82J 1VQ5H 5HL7J 3I55H 2OTLH 1KC8J 4UY8M 3DLLJ 3G71H 1K73J 5JVHJ 1VQ7H 1VQKH 3CCJH 4U67J 1VQMH 2PA2A 5DM6J 3CD6H 2OTJH 1QVFH 3CCRH 1YIJH 1W2BH 1Q81J 5DM7J 1M90J 1VQ9H 4IO9J 1VQNH 1M1KJ 3I56H 1VQLH 5MLCO 1N8RJ 3PIPJ 4WFNJ 1Y69K 5GAEN 1VQ8H 3PIOJ 3CC4H 1K8AJ
chains in the Genus database with same CATH superfamily
4EAFA 4WCEJ 1QPQA 4I9AA 4KWWA 2W55B 5EY3A 1VDVA 3CPWH 5AN9F 3NRZC 1VQPH 1YI2H 3VMMA 1VQ4H 5HUPA 2QEXH 3CCEH 5H1SO 1YJWH 1KD1J 1N63B 1YJNH 1VQOH 4WF9J 3C2RA 3CMEH 1YJ9H 5GAGN 3CC7H 3AM9A 1WKIA 1YITH 4IOAJ 3NVVC 4GA6A 4YEKA 1VQ6H 3PAJA 3NVWC 1WYGA 3CC2H 1YHQH 4GA5A 3CMAH 1Q86J 3WO0A 1QPRA 2W54B 4XR5A 4C80A 2ZJRJ 3WNZA 4LHMA 5EP8A 4EADA 5GAHN 3J7ZM 3CXCH 4WFAJ 3G4SH 3C2EA 3NVZC 2W3RB 1S72H 2Q5WE 4GA4A 1FIQC 2ZJQJ 3CF5J 5GADN 3NS1C 5AYXA 1QVGH 1K9MJ 1SB3A 5HUOA 2QA4H 1RM6A 3CCSH 2I14A 3AMZA 2I1OA 2B7QA 4ZOHA 4C7ZA 3CCUH 1JJ2H 5JVGJ 3CCLH 3L4PA 1ZXIB 1N5XA 3H5QA 3AN1A 1QPNA 2QIEA 4IOCJ 1Q7YJ 3G6EH 2W3SB 2ZJPJ 3GNNA 3CCMH 1FFVB 2WP4A 3CCVH 1X1OA 2DSJA 1YTDA 3TQVA 5HULA 1SIJA 4WFBJ 3CCQH 3EUB4 1NJIJ 1KQSH 3OW2H 1Q82J 1OTPA 3C2OA 1VQ5H 5HL7J 3I55H 1V97A 3C2FA 2OTLH 1KC8J 4UY8M 2B7NA 3DLLJ 3G71H 1YTEA 1K73J 5JVHJ 1VQ7H 1N61B 2J0FA 3B9JC 1FFUB 3ETRC 3L0GA 1VQKH 3CCJH 4U67J 1VQMH 4USAA 1N5WB 1YTKA 2PA2A 5AYZA 5DM6J 3CD6H 2OTJH 1JROB 2JBMA 1QVFH 3SR6C 4US9A 3CCRH 4KWVA 1YIJH 1W2BH 1QPOA 1FMAE 1UOUA 2WK6A 1N62B 3NVYC 1Q81J 5DM7J 1M90J 1VQ9H 4IO9J 1VQNH 1NVJA 1M1KJ 5MPOC 3RPFA 3I56H 4X46A 1BRWA 1DGJA 3FAHA 1VQLH 4AP8A 2TPTA 5MLCO 3WO1A 1FM0E 2B7PA 1FO4A 1N60B 1N8RJ 4C7YA 4US8A 1JRPB 3PIPJ 1NVIE 2WK5A 1QAPA 4WFNJ 3FC4A 3C2VA 1AZYA 1Y69K 5GAEN 4YYYA 1VQ8H 1VLBA 3BIIE 5AYYA 2E3TA 2OMDA 3PIOJ 1O4UA 3CC4H 1K8AJ
chains in the Genus database with same CATH topology
4WCEJ 3CPWH 5AN9F 1VQPH 1YI2H 1VQ4H 2QEXH 3CCEH 5H1SO 1YJWH 1KD1J 1YJNH 1VQOH 4WF9J 3CMEH 1YJ9H 5GAGN 3CC7H 1WKIA 1YITH 4IOAJ 1VQ6H 3CC2H 1YHQH 3CMAH 1Q86J 2ZJRJ 5GAHN 3J7ZM 3CXCH 4WFAJ 3G4SH 1S72H 2ZJQJ 3CF5J 5GADN 1QVGH 1K9MJ 2QA4H 3CCSH 3CCUH 1JJ2H 5JVGJ 3CCLH 4IOCJ 1Q7YJ 3G6EH 2ZJPJ 3CCMH 3CCVH 4WFBJ 3CCQH 1NJIJ 1KQSH 3OW2H 1Q82J 1VQ5H 5HL7J 3I55H 2OTLH 1KC8J 4UY8M 3DLLJ 3G71H 1K73J 5JVHJ 1VQ7H 1VQKH 3CCJH 4U67J 1VQMH 2PA2A 5DM6J 3CD6H 2OTJH 1QVFH 3CCRH 1YIJH 1W2BH 1Q81J 5DM7J 1M90J 1VQ9H 4IO9J 1VQNH 1M1KJ 3I56H 1VQLH 5MLCO 1N8RJ 3PIPJ 4WFNJ 1Y69K 5GAEN 1VQ8H 3PIOJ 3CC4H 1K8AJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE J;  3CPW H;  5AN9 F;  1VQP H;  1YI2 H;  1VQ4 H;  2QEX H;  3CCE H;  5H1S O;  1YJW H;  1KD1 J;  1YJN H;  1VQO H;  4WF9 J;  3CME H;  1YJ9 H;  5GAG N;  3CC7 H;  1WKI A;  1YIT H;  4IOA J;  1VQ6 H;  3CC2 H;  1YHQ H;  3CMA H;  1Q86 J;  2ZJR J;  5GAH N;  3J7Z M;  3CXC H;  4WFA J;  3G4S H;  1S72 H;  2ZJQ J;  3CF5 J;  5GAD N;  1QVG H;  1K9M J;  2QA4 H;  3CCS H;  3CCU H;  1JJ2 H;  5JVG J;  3CCL H;  4IOC J;  1Q7Y J;  3G6E H;  2ZJP J;  3CCM H;  3CCV H;  4WFB J;  3CCQ H;  1NJI J;  1KQS H;  3OW2 H;  1Q82 J;  1VQ5 H;  5HL7 J;  3I55 H;  2OTL H;  1KC8 J;  4UY8 M;  3DLL J;  3G71 H;  1K73 J;  5JVH J;  1VQ7 H;  1VQK H;  3CCJ H;  4U67 J;  1VQM H;  2PA2 A;  5DM6 J;  3CD6 H;  2OTJ H;  1QVF H;  3CCR H;  1YIJ H;  1W2B H;  1Q81 J;  5DM7 J;  1M90 J;  1VQ9 H;  4IO9 J;  1VQN H;  1M1K J;  3I56 H;  1VQL H;  5MLC O;  1N8R J;  3PIP J;  4WFN J;  1Y69 K;  5GAE N;  1VQ8 H;  3PIO J;  3CC4 H;  1K8A J; 
#chains in the Genus database with same CATH topology
 4EAF A;  4WCE J;  1QPQ A;  4I9A A;  4KWW A;  2W55 B;  5EY3 A;  1VDV A;  3CPW H;  5AN9 F;  3NRZ C;  1VQP H;  1YI2 H;  3VMM A;  1VQ4 H;  5HUP A;  2QEX H;  3CCE H;  5H1S O;  1YJW H;  1KD1 J;  1N63 B;  1YJN H;  1VQO H;  4WF9 J;  3C2R A;  3CME H;  1YJ9 H;  5GAG N;  3CC7 H;  3AM9 A;  1WKI A;  1YIT H;  4IOA J;  3NVV C;  4GA6 A;  4YEK A;  1VQ6 H;  3PAJ A;  3NVW C;  1WYG A;  3CC2 H;  1YHQ H;  4GA5 A;  3CMA H;  1Q86 J;  3WO0 A;  1QPR A;  2W54 B;  4XR5 A;  4C80 A;  2ZJR J;  3WNZ A;  4LHM A;  5EP8 A;  4EAD A;  5GAH N;  3J7Z M;  3CXC H;  4WFA J;  3G4S H;  3C2E A;  3NVZ C;  2W3R B;  1S72 H;  2Q5W E;  4GA4 A;  1FIQ C;  2ZJQ J;  3CF5 J;  5GAD N;  3NS1 C;  5AYX A;  1QVG H;  1K9M J;  1SB3 A;  5HUO A;  2QA4 H;  1RM6 A;  3CCS H;  2I14 A;  3AMZ A;  2I1O A;  2B7Q A;  4ZOH A;  4C7Z A;  3CCU H;  1JJ2 H;  5JVG J;  3CCL H;  3L4P A;  1ZXI B;  1N5X A;  3H5Q A;  3AN1 A;  1QPN A;  2QIE A;  4IOC J;  1Q7Y J;  3G6E H;  2W3S B;  2ZJP J;  3GNN A;  3CCM H;  1FFV B;  2WP4 A;  3CCV H;  1X1O A;  2DSJ A;  1YTD A;  3TQV A;  5HUL A;  1SIJ A;  4WFB J;  3CCQ H;  3EUB 4;  1NJI J;  1KQS H;  3OW2 H;  1Q82 J;  1OTP A;  3C2O A;  1VQ5 H;  5HL7 J;  3I55 H;  1V97 A;  3C2F A;  2OTL H;  1KC8 J;  4UY8 M;  2B7N A;  3DLL J;  3G71 H;  1YTE A;  1K73 J;  5JVH J;  1VQ7 H;  1N61 B;  2J0F A;  3B9J C;  1FFU B;  3ETR C;  3L0G A;  1VQK H;  3CCJ H;  4U67 J;  1VQM H;  4USA A;  1N5W B;  1YTK A;  2PA2 A;  5AYZ A;  5DM6 J;  3CD6 H;  2OTJ H;  1JRO B;  2JBM A;  1QVF H;  3SR6 C;  4US9 A;  3CCR H;  4KWV A;  1YIJ H;  1W2B H;  1QPO A;  1FMA E;  1UOU A;  2WK6 A;  1N62 B;  3NVY C;  1Q81 J;  5DM7 J;  1M90 J;  1VQ9 H;  4IO9 J;  1VQN H;  1NVJ A;  1M1K J;  5MPO C;  3RPF A;  3I56 H;  4X46 A;  1BRW A;  1DGJ A;  3FAH A;  1VQL H;  4AP8 A;  2TPT A;  5MLC O;  3WO1 A;  1FM0 E;  2B7P A;  1FO4 A;  1N60 B;  1N8R J;  4C7Y A;  4US8 A;  1JRP B;  3PIP J;  1NVI E;  2WK5 A;  1QAP A;  4WFN J;  3FC4 A;  3C2V A;  1AZY A;  1Y69 K;  5GAE N;  4YYY A;  1VQ8 H;  1VLB A;  3BII E;  5AYY A;  2E3T A;  2OMD A;  3PIO J;  1O4U A;  3CC4 H;  1K8A J; 
#chains in the Genus database with same CATH homology
 4WCE J;  3CPW H;  5AN9 F;  1VQP H;  1YI2 H;  1VQ4 H;  2QEX H;  3CCE H;  5H1S O;  1YJW H;  1KD1 J;  1YJN H;  1VQO H;  4WF9 J;  3CME H;  1YJ9 H;  5GAG N;  3CC7 H;  1WKI A;  1YIT H;  4IOA J;  1VQ6 H;  3CC2 H;  1YHQ H;  3CMA H;  1Q86 J;  2ZJR J;  5GAH N;  3J7Z M;  3CXC H;  4WFA J;  3G4S H;  1S72 H;  2ZJQ J;  3CF5 J;  5GAD N;  1QVG H;  1K9M J;  2QA4 H;  3CCS H;  3CCU H;  1JJ2 H;  5JVG J;  3CCL H;  4IOC J;  1Q7Y J;  3G6E H;  2ZJP J;  3CCM H;  3CCV H;  4WFB J;  3CCQ H;  1NJI J;  1KQS H;  3OW2 H;  1Q82 J;  1VQ5 H;  5HL7 J;  3I55 H;  2OTL H;  1KC8 J;  4UY8 M;  3DLL J;  3G71 H;  1K73 J;  5JVH J;  1VQ7 H;  1VQK H;  3CCJ H;  4U67 J;  1VQM H;  2PA2 A;  5DM6 J;  3CD6 H;  2OTJ H;  1QVF H;  3CCR H;  1YIJ H;  1W2B H;  1Q81 J;  5DM7 J;  1M90 J;  1VQ9 H;  4IO9 J;  1VQN H;  1M1K J;  3I56 H;  1VQL H;  5MLC O;  1N8R J;  3PIP J;  4WFN J;  1Y69 K;  5GAE N;  1VQ8 H;  3PIO J;  3CC4 H;  1K8A J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...