1Q86J

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 24
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1q86J00
4WFNJ 1WKIA 5H1SO 3G4SH 1VQ4H 5MLCO 3CCQH 1K9MJ 3CMEH 2PA2A 3CCVH 1KQSH 3CCEH 4U67J 5JVHJ 2ZJPJ 3CMAH 2ZJRJ 1NJIJ 3CCRH 1Y69K 1VQ6H 1YIJH 1VQMH 3PIOJ 2ZJQJ 2OTJH 3CPWH 1VQKH 1YJWH 4WFBJ 1VQNH 1Q86J 1VQ7H 2QA4H 3PIPJ 1KC8J 1VQOH 4WCEJ 3I55H 3I56H 1Q7YJ 1VQLH 5AN9F 2OTLH 3CCUH 1M90J 1VQPH 3CC7H 3CD6H 5DM7J 1VQ5H 1YJ9H 1Q82J 1YHQH 5GAGN 3CCMH 1QVGH 3G6EH 3CF5J 5GADN 5DM6J 1K73J 4UY8M 3CCLH 5JVGJ 5HL7J 1N8RJ 3CC4H 3CC2H 1Q81J 3G71H 4IOAJ 3DLLJ 1VQ8H 4WFAJ 4IO9J 1YITH 1K8AJ 5GAEN 2QEXH 4WF9J 1YJNH 1S72H 3CXCH 3CCJH 1M1KJ 4IOCJ 3J7ZM 5GAHN 1YI2H 1W2BH 1JJ2H 1VQ9H 3CCSH 1QVFH 3OW2H 1KD1J
chains in the Genus database with same CATH superfamily
3FAHA 1SB3A 3H5QA 2B7NA 4WFNJ 1WKIA 5H1SO 3G4SH 3ETRC 2TPTA 3L4PA 2WP4A 4GA5A 1VQ4H 5MLCO 1N63B 3CCQH 2Q5WE 3AMZA 1K9MJ 5AYYA 3CMEH 4C7YA 2PA2A 3CCVH 3L0GA 1KQSH 2WK6A 3NVYC 3PAJA 2W3SB 3B9JC 3CCEH 4U67J 5JVHJ 3EUB4 2OMDA 2ZJPJ 1BRWA 3CMAH 2ZJRJ 5HUPA 1NJIJ 4US9A 4YYYA 4YEKA 3CCRH 1Y69K 1VQ6H 3WO1A 1SIJA 1YIJH 1VQMH 3PIOJ 5EP8A 2ZJQJ 2B7PA 4AP8A 1QPOA 2OTJH 4C7ZA 3CPWH 1VQKH 1V97A 5AYZA 1YJWH 4I9AA 5AYXA 2WK5A 4WFBJ 1Q86J 1VQNH 4EADA 1VQ7H 2QA4H 4GA6A 2W55B 3BIIE 3PIPJ 4C80A 2DSJA 5HUOA 1FO4A 3WNZA 2I1OA 4KWVA 4WCEJ 3I55H 1VQOH 1KC8J 3I56H 1Q7YJ 4XR5A 1VQLH 5AN9F 2OTLH 3AM9A 1UOUA 1AZYA 3CCUH 1M90J 3TQVA 1VQPH 3NVWC 1FMAE 3AN1A 3C2RA 3CC7H 3NRZC 3CD6H 3NVZC 1YTDA 3GNNA 2W3RB 5EY3A 2W54B 5DM7J 1N60B 1FIQC 1QPRA 3C2OA 1YJ9H 3C2EA 1OTPA 1VQ5H 3SR6C 1Q82J 2JBMA 1YHQH 4LHMA 1X1OA 1VDVA 1FM0E 1ZXIB 1DGJA 2B7QA 5GAGN 4GA4A 3CCMH 1QVGH 3G6EH 3CF5J 3WO0A 1RM6A 5GADN 3FC4A 2J0FA 5DM6J 1K73J 4UY8M 3CCLH 1FFUB 5JVGJ 2I14A 2QIEA 4US8A 5HL7J 1FFVB 1N8RJ 3CC4H 1QAPA 4USAA 3CC2H 5HULA 1Q81J 5MPOC 3G71H 1YTEA 2E3TA 4IOAJ 1N61B 3DLLJ 1JRPB 4X46A 1VLBA 1VQ8H 1NVIE 1WYGA 4WFAJ 1N62B 4ZOHA 4IO9J 1YITH 1K8AJ 1NVJA 5GAEN 2QEXH 3NVVC 4WF9J 1QPQA 1YJNH 1O4UA 1YTKA 3C2FA 1S72H 3CXCH 3CCJH 1QPNA 1M1KJ 4IOCJ 3NS1C 1N5WB 3J7ZM 5GAHN 1YI2H 1N5XA 1W2BH 1JJ2H 4EAFA 1VQ9H 3CCSH 1QVFH 3RPFA 3OW2H 1KD1J 3C2VA 3VMMA 4KWWA 1JROB
chains in the Genus database with same CATH topology
4WFNJ 1WKIA 5H1SO 3G4SH 1VQ4H 5MLCO 3CCQH 1K9MJ 3CMEH 2PA2A 3CCVH 1KQSH 3CCEH 4U67J 5JVHJ 2ZJPJ 3CMAH 2ZJRJ 1NJIJ 3CCRH 1Y69K 1VQ6H 1YIJH 1VQMH 3PIOJ 2ZJQJ 2OTJH 3CPWH 1VQKH 1YJWH 4WFBJ 1VQNH 1Q86J 1VQ7H 2QA4H 3PIPJ 1KC8J 1VQOH 4WCEJ 3I55H 3I56H 1Q7YJ 1VQLH 5AN9F 2OTLH 3CCUH 1M90J 1VQPH 3CC7H 3CD6H 5DM7J 1VQ5H 1YJ9H 1Q82J 1YHQH 5GAGN 3CCMH 1QVGH 3G6EH 3CF5J 5GADN 5DM6J 1K73J 4UY8M 3CCLH 5JVGJ 5HL7J 1N8RJ 3CC4H 3CC2H 1Q81J 3G71H 4IOAJ 3DLLJ 1VQ8H 4WFAJ 4IO9J 1YITH 1K8AJ 5GAEN 2QEXH 4WF9J 1YJNH 1S72H 3CXCH 3CCJH 1M1KJ 4IOCJ 3J7ZM 5GAHN 1YI2H 1W2BH 1JJ2H 1VQ9H 3CCSH 1QVFH 3OW2H 1KD1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFN J;  1WKI A;  5H1S O;  3G4S H;  1VQ4 H;  5MLC O;  3CCQ H;  1K9M J;  3CME H;  2PA2 A;  3CCV H;  1KQS H;  3CCE H;  4U67 J;  5JVH J;  2ZJP J;  3CMA H;  2ZJR J;  1NJI J;  3CCR H;  1Y69 K;  1VQ6 H;  1YIJ H;  1VQM H;  3PIO J;  2ZJQ J;  2OTJ H;  3CPW H;  1VQK H;  1YJW H;  4WFB J;  1VQN H;  1Q86 J;  1VQ7 H;  2QA4 H;  3PIP J;  1KC8 J;  1VQO H;  4WCE J;  3I55 H;  3I56 H;  1Q7Y J;  1VQL H;  5AN9 F;  2OTL H;  3CCU H;  1M90 J;  1VQP H;  3CC7 H;  3CD6 H;  5DM7 J;  1VQ5 H;  1YJ9 H;  1Q82 J;  1YHQ H;  5GAG N;  3CCM H;  1QVG H;  3G6E H;  3CF5 J;  5GAD N;  5DM6 J;  1K73 J;  4UY8 M;  3CCL H;  5JVG J;  5HL7 J;  1N8R J;  3CC4 H;  3CC2 H;  1Q81 J;  3G71 H;  4IOA J;  3DLL J;  1VQ8 H;  4WFA J;  4IO9 J;  1YIT H;  1K8A J;  5GAE N;  2QEX H;  4WF9 J;  1YJN H;  1S72 H;  3CXC H;  3CCJ H;  1M1K J;  4IOC J;  3J7Z M;  5GAH N;  1YI2 H;  1W2B H;  1JJ2 H;  1VQ9 H;  3CCS H;  1QVF H;  3OW2 H;  1KD1 J; 
#chains in the Genus database with same CATH topology
 3FAH A;  1SB3 A;  3H5Q A;  2B7N A;  4WFN J;  1WKI A;  5H1S O;  3G4S H;  3ETR C;  2TPT A;  3L4P A;  2WP4 A;  4GA5 A;  1VQ4 H;  5MLC O;  1N63 B;  3CCQ H;  2Q5W E;  3AMZ A;  1K9M J;  5AYY A;  3CME H;  4C7Y A;  2PA2 A;  3CCV H;  3L0G A;  1KQS H;  2WK6 A;  3NVY C;  3PAJ A;  2W3S B;  3B9J C;  3CCE H;  4U67 J;  5JVH J;  3EUB 4;  2OMD A;  2ZJP J;  1BRW A;  3CMA H;  2ZJR J;  5HUP A;  1NJI J;  4US9 A;  4YYY A;  4YEK A;  3CCR H;  1Y69 K;  1VQ6 H;  3WO1 A;  1SIJ A;  1YIJ H;  1VQM H;  3PIO J;  5EP8 A;  2ZJQ J;  2B7P A;  4AP8 A;  1QPO A;  2OTJ H;  4C7Z A;  3CPW H;  1VQK H;  1V97 A;  5AYZ A;  1YJW H;  4I9A A;  5AYX A;  2WK5 A;  4WFB J;  1Q86 J;  1VQN H;  4EAD A;  1VQ7 H;  2QA4 H;  4GA6 A;  2W55 B;  3BII E;  3PIP J;  4C80 A;  2DSJ A;  5HUO A;  1FO4 A;  3WNZ A;  2I1O A;  4KWV A;  4WCE J;  3I55 H;  1VQO H;  1KC8 J;  3I56 H;  1Q7Y J;  4XR5 A;  1VQL H;  5AN9 F;  2OTL H;  3AM9 A;  1UOU A;  1AZY A;  3CCU H;  1M90 J;  3TQV A;  1VQP H;  3NVW C;  1FMA E;  3AN1 A;  3C2R A;  3CC7 H;  3NRZ C;  3CD6 H;  3NVZ C;  1YTD A;  3GNN A;  2W3R B;  5EY3 A;  2W54 B;  5DM7 J;  1N60 B;  1FIQ C;  1QPR A;  3C2O A;  1YJ9 H;  3C2E A;  1OTP A;  1VQ5 H;  3SR6 C;  1Q82 J;  2JBM A;  1YHQ H;  4LHM A;  1X1O A;  1VDV A;  1FM0 E;  1ZXI B;  1DGJ A;  2B7Q A;  5GAG N;  4GA4 A;  3CCM H;  1QVG H;  3G6E H;  3CF5 J;  3WO0 A;  1RM6 A;  5GAD N;  3FC4 A;  2J0F A;  5DM6 J;  1K73 J;  4UY8 M;  3CCL H;  1FFU B;  5JVG J;  2I14 A;  2QIE A;  4US8 A;  5HL7 J;  1FFV B;  1N8R J;  3CC4 H;  1QAP A;  4USA A;  3CC2 H;  5HUL A;  1Q81 J;  5MPO C;  3G71 H;  1YTE A;  2E3T A;  4IOA J;  1N61 B;  3DLL J;  1JRP B;  4X46 A;  1VLB A;  1VQ8 H;  1NVI E;  1WYG A;  4WFA J;  1N62 B;  4ZOH A;  4IO9 J;  1YIT H;  1K8A J;  1NVJ A;  5GAE N;  2QEX H;  3NVV C;  4WF9 J;  1QPQ A;  1YJN H;  1O4U A;  1YTK A;  3C2F A;  1S72 H;  3CXC H;  3CCJ H;  1QPN A;  1M1K J;  4IOC J;  3NS1 C;  1N5W B;  3J7Z M;  5GAH N;  1YI2 H;  1N5X A;  1W2B H;  1JJ2 H;  4EAF A;  1VQ9 H;  3CCS H;  1QVF H;  3RPF A;  3OW2 H;  1KD1 J;  3C2V A;  3VMM A;  4KWW A;  1JRO B; 
#chains in the Genus database with same CATH homology
 4WFN J;  1WKI A;  5H1S O;  3G4S H;  1VQ4 H;  5MLC O;  3CCQ H;  1K9M J;  3CME H;  2PA2 A;  3CCV H;  1KQS H;  3CCE H;  4U67 J;  5JVH J;  2ZJP J;  3CMA H;  2ZJR J;  1NJI J;  3CCR H;  1Y69 K;  1VQ6 H;  1YIJ H;  1VQM H;  3PIO J;  2ZJQ J;  2OTJ H;  3CPW H;  1VQK H;  1YJW H;  4WFB J;  1VQN H;  1Q86 J;  1VQ7 H;  2QA4 H;  3PIP J;  1KC8 J;  1VQO H;  4WCE J;  3I55 H;  3I56 H;  1Q7Y J;  1VQL H;  5AN9 F;  2OTL H;  3CCU H;  1M90 J;  1VQP H;  3CC7 H;  3CD6 H;  5DM7 J;  1VQ5 H;  1YJ9 H;  1Q82 J;  1YHQ H;  5GAG N;  3CCM H;  1QVG H;  3G6E H;  3CF5 J;  5GAD N;  5DM6 J;  1K73 J;  4UY8 M;  3CCL H;  5JVG J;  5HL7 J;  1N8R J;  3CC4 H;  3CC2 H;  1Q81 J;  3G71 H;  4IOA J;  3DLL J;  1VQ8 H;  4WFA J;  4IO9 J;  1YIT H;  1K8A J;  5GAE N;  2QEX H;  4WF9 J;  1YJN H;  1S72 H;  3CXC H;  3CCJ H;  1M1K J;  4IOC J;  3J7Z M;  5GAH N;  1YI2 H;  1W2B H;  1JJ2 H;  1VQ9 H;  3CCS H;  1QVF H;  3OW2 H;  1KD1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...