1Q86M

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1q86M02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1q86M01
1VQ7O 3CC7O 1M90M 1KD1M 1QVFK 2OTLL 1Q7YM 1Q82P 3CMEL 1YJWO 3CD6L 3CCJO 3G4SL 1Q81M 3CC2L 1YITL 1KQSK 3CC4L 1VQMO 1YJ9L 1KQSN 1K9MM 1M1KM 3CCVO 3CCLO 3CPWK 1YI2L 1VQLO 3I55O 3I56L 1VQ8L 1VQ7L 3CCUO 1YHQO 2OTJO 3G71O 1VQPO 3CCMO 1YJWL 3CCJL 1K8AP 1Q82M 1VQ5O 1VQ6O 3CCRO 2QA4O 1S72O 1KC8P 1VQNO 3CCVL 1M90P 1K73P 3CCLL 1N8RP 3CCQO 1VQKL 1VQLL 3I55L 1Q81P 3G6EO 3CMAO 3CC7L 2QEXO 2OTJL 1Q86P 3G71L 3CCML 1VQ9O 1VQ4O 1NJIP 1VQ5L 1W2BK 1VQML 1QVGN 1VQ6L 3CCSO 2QA4L 1YIJO 1W2BN 1S72L 1YJNO 1VQ8O 3OW2N 1VQNL 1KD1P 1VQOO 3CCEO 1Q7YP 1JJ2N 1KC8M 3CCQL 1K73M 2OTLO 3CMEO 3CD6O 3G6EL 1N8RM 3G4SO 1QVFN 3CMAL 3CC2O 1YITO 3CCUL 1YHQL 3CC4O 1K9MP 1YJ9O 1VQPL 2QEXL 1M1KP 1VQ9L 1QVGK 3CXCK 1Q86M 1VQ4L 3CXCN 3CCRL 1YI2O 3CCSL 1K8AM 3OW2K 1YIJL 1NJIM 1VQKO 3I56O 3CPWN 1JJ2K 1YJNL 1VQOL 3CCEL
chains in the Genus database with same CATH superfamily
1VQ7O 5DS4A 3CC7O 1M90M 1KD1M 1QVFK 2OTLL 1Q7YM 1Q82P 3CMEL 1YJWO 3CD6L 3CCJO 3G4SL 1Q81M 3CC2L 1YITL 4W8KA 1KQSK 3CC4L 1VQMO 1YJ9L 1KQSN 1K9MM 1M1KM 3CCVO 5DS6A 3CCLO 3CPWK 1YI2L 1VQLO 4WJ0A 3I55O 3I56L 1VQ8L 1VQ7L 4P6IC 3CCUO 5FCLA 1YHQO 2OTJO 3G71O 1VQPO 5DLJA 3CCMO 1YJWL 3CCJL 1K8AP 1Q82M 5DQZA 1VQ5O 1VQ6O 3CCRO 2QA4O 4QDLA 1S72O 5DQTA 2YZSA 1KC8P 1VQNO 3CCVL 1M90P 1K73P 3CCLL 1N8RP 3CCQO 1VQKL 1VQLL 3I55L 1Q81P 3G6EO 3CMAO 3CC7L 2QEXO 2OTJL 1Q86P 3G71L 4XTKA 3CCML 1VQ9O 1VQ4O 1NJIP 1VQ5L 1W2BK 1VQML 1QVGN 1VQ6L 3CCSO 2QA4L 1YIJO 1W2BN 1S72L 1YJNO 1VQ8O 3OW2N 1VQNL 1KD1P 1VQOO 3CCEO 3GODA 1Q7YP 1JJ2N 1KC8M 5DS5A 3NKDA 4N06A 3CCQL 1K73M 2OTLO 3CMEO 3CD6O 3G6EL 1N8RM 3G4SO 1QVFN 3CMAL 3CC2O 1YITO 3CCUL 1YHQL 3CC4O 1K9MP 1YJ9O 1VQPL 2QEXL 1M1KP 1VQ9L 1QVGK 3CXCK 1Q86M 1VQ4L 3CXCN 3CCRL 1YI2O 3CCSL 1K8AM 3OW2K 1YIJL 1NJIM 1VQKO 3I56O 3CPWN 1JJ2K 1YJNL 1VQOL 3CCEL
chains in the Genus database with same CATH topology
1VQ7O 5DS4A 3CC7O 1M90M 1KD1M 1QVFK 2OTLL 1Q7YM 1Q82P 3CMEL 1YJWO 3CD6L 3CCJO 3G4SL 1Q81M 3CC2L 1YITL 4W8KA 1KQSK 3CC4L 1VQMO 1YJ9L 1KQSN 1K9MM 1M1KM 3CCVO 5DS6A 3CCLO 3CPWK 1YI2L 1VQLO 4WJ0A 3I55O 3I56L 1VQ8L 1VQ7L 4P6IC 3CCUO 5FCLA 1YHQO 2OTJO 3G71O 1VQPO 5DLJA 3CCMO 1YJWL 3CCJL 1K8AP 1Q82M 5DQZA 1VQ5O 1VQ6O 3CCRO 2QA4O 4QDLA 1S72O 5DQTA 2YZSA 1KC8P 1VQNO 3CCVL 1M90P 1K73P 3CCLL 1N8RP 3CCQO 1VQKL 1VQLL 3I55L 1Q81P 3G6EO 3CMAO 3CC7L 2QEXO 2OTJL 1Q86P 3G71L 4XTKA 3CCML 1VQ9O 1VQ4O 1NJIP 1VQ5L 1W2BK 1VQML 1QVGN 1VQ6L 3CCSO 2QA4L 1YIJO 1W2BN 1S72L 1YJNO 1VQ8O 3OW2N 1VQNL 1KD1P 1VQOO 3CCEO 3GODA 1Q7YP 1JJ2N 1KC8M 5DS5A 3NKDA 4N06A 3CCQL 1K73M 2OTLO 3CMEO 3CD6O 3G6EL 1N8RM 3G4SO 1QVFN 3CMAL 3CC2O 1YITO 3CCUL 1YHQL 3CC4O 1K9MP 1YJ9O 1VQPL 2QEXL 1M1KP 1VQ9L 1QVGK 3CXCK 1Q86M 1VQ4L 3CXCN 3CCRL 1YI2O 3CCSL 1K8AM 3OW2K 1YIJL 1NJIM 1VQKO 3I56O 3CPWN 1JJ2K 1YJNL 1VQOL 3CCEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 O;  3CC7 O;  1M90 M;  1KD1 M;  1QVF K;  2OTL L;  1Q7Y M;  1Q82 P;  3CME L;  1YJW O;  3CD6 L;  3CCJ O;  3G4S L;  1Q81 M;  3CC2 L;  1YIT L;  1KQS K;  3CC4 L;  1VQM O;  1YJ9 L;  1KQS N;  1K9M M;  1M1K M;  3CCV O;  3CCL O;  3CPW K;  1YI2 L;  1VQL O;  3I55 O;  3I56 L;  1VQ8 L;  1VQ7 L;  3CCU O;  1YHQ O;  2OTJ O;  3G71 O;  1VQP O;  3CCM O;  1YJW L;  3CCJ L;  1K8A P;  1Q82 M;  1VQ5 O;  1VQ6 O;  3CCR O;  2QA4 O;  1S72 O;  1KC8 P;  1VQN O;  3CCV L;  1M90 P;  1K73 P;  3CCL L;  1N8R P;  3CCQ O;  1VQK L;  1VQL L;  3I55 L;  1Q81 P;  3G6E O;  3CMA O;  3CC7 L;  2QEX O;  2OTJ L;  1Q86 P;  3G71 L;  3CCM L;  1VQ9 O;  1VQ4 O;  1NJI P;  1VQ5 L;  1W2B K;  1VQM L;  1QVG N;  1VQ6 L;  3CCS O;  2QA4 L;  1YIJ O;  1W2B N;  1S72 L;  1YJN O;  1VQ8 O;  3OW2 N;  1VQN L;  1KD1 P;  1VQO O;  3CCE O;  1Q7Y P;  1JJ2 N;  1KC8 M;  3CCQ L;  1K73 M;  2OTL O;  3CME O;  3CD6 O;  3G6E L;  1N8R M;  3G4S O;  1QVF N;  3CMA L;  3CC2 O;  1YIT O;  3CCU L;  1YHQ L;  3CC4 O;  1K9M P;  1YJ9 O;  1VQP L;  2QEX L;  1M1K P;  1VQ9 L;  1QVG K;  3CXC K;  1Q86 M;  1VQ4 L;  3CXC N;  3CCR L;  1YI2 O;  3CCS L;  1K8A M;  3OW2 K;  1YIJ L;  1NJI M;  1VQK O;  3I56 O;  3CPW N;  1JJ2 K;  1YJN L;  1VQO L;  3CCE L; 
#chains in the Genus database with same CATH topology
 1VQ7 O;  5DS4 A;  3CC7 O;  1M90 M;  1KD1 M;  1QVF K;  2OTL L;  1Q7Y M;  1Q82 P;  3CME L;  1YJW O;  3CD6 L;  3CCJ O;  3G4S L;  1Q81 M;  3CC2 L;  1YIT L;  4W8K A;  1KQS K;  3CC4 L;  1VQM O;  1YJ9 L;  1KQS N;  1K9M M;  1M1K M;  3CCV O;  5DS6 A;  3CCL O;  3CPW K;  1YI2 L;  1VQL O;  4WJ0 A;  3I55 O;  3I56 L;  1VQ8 L;  1VQ7 L;  4P6I C;  3CCU O;  5FCL A;  1YHQ O;  2OTJ O;  3G71 O;  1VQP O;  5DLJ A;  3CCM O;  1YJW L;  3CCJ L;  1K8A P;  1Q82 M;  5DQZ A;  1VQ5 O;  1VQ6 O;  3CCR O;  2QA4 O;  4QDL A;  1S72 O;  5DQT A;  2YZS A;  1KC8 P;  1VQN O;  3CCV L;  1M90 P;  1K73 P;  3CCL L;  1N8R P;  3CCQ O;  1VQK L;  1VQL L;  3I55 L;  1Q81 P;  3G6E O;  3CMA O;  3CC7 L;  2QEX O;  2OTJ L;  1Q86 P;  3G71 L;  4XTK A;  3CCM L;  1VQ9 O;  1VQ4 O;  1NJI P;  1VQ5 L;  1W2B K;  1VQM L;  1QVG N;  1VQ6 L;  3CCS O;  2QA4 L;  1YIJ O;  1W2B N;  1S72 L;  1YJN O;  1VQ8 O;  3OW2 N;  1VQN L;  1KD1 P;  1VQO O;  3CCE O;  3GOD A;  1Q7Y P;  1JJ2 N;  1KC8 M;  5DS5 A;  3NKD A;  4N06 A;  3CCQ L;  1K73 M;  2OTL O;  3CME O;  3CD6 O;  3G6E L;  1N8R M;  3G4S O;  1QVF N;  3CMA L;  3CC2 O;  1YIT O;  3CCU L;  1YHQ L;  3CC4 O;  1K9M P;  1YJ9 O;  1VQP L;  2QEX L;  1M1K P;  1VQ9 L;  1QVG K;  3CXC K;  1Q86 M;  1VQ4 L;  3CXC N;  3CCR L;  1YI2 O;  3CCS L;  1K8A M;  3OW2 K;  1YIJ L;  1NJI M;  1VQK O;  3I56 O;  3CPW N;  1JJ2 K;  1YJN L;  1VQO L;  3CCE L; 
#chains in the Genus database with same CATH homology
 1VQ7 O;  5DS4 A;  3CC7 O;  1M90 M;  1KD1 M;  1QVF K;  2OTL L;  1Q7Y M;  1Q82 P;  3CME L;  1YJW O;  3CD6 L;  3CCJ O;  3G4S L;  1Q81 M;  3CC2 L;  1YIT L;  4W8K A;  1KQS K;  3CC4 L;  1VQM O;  1YJ9 L;  1KQS N;  1K9M M;  1M1K M;  3CCV O;  5DS6 A;  3CCL O;  3CPW K;  1YI2 L;  1VQL O;  4WJ0 A;  3I55 O;  3I56 L;  1VQ8 L;  1VQ7 L;  4P6I C;  3CCU O;  5FCL A;  1YHQ O;  2OTJ O;  3G71 O;  1VQP O;  5DLJ A;  3CCM O;  1YJW L;  3CCJ L;  1K8A P;  1Q82 M;  5DQZ A;  1VQ5 O;  1VQ6 O;  3CCR O;  2QA4 O;  4QDL A;  1S72 O;  5DQT A;  2YZS A;  1KC8 P;  1VQN O;  3CCV L;  1M90 P;  1K73 P;  3CCL L;  1N8R P;  3CCQ O;  1VQK L;  1VQL L;  3I55 L;  1Q81 P;  3G6E O;  3CMA O;  3CC7 L;  2QEX O;  2OTJ L;  1Q86 P;  3G71 L;  4XTK A;  3CCM L;  1VQ9 O;  1VQ4 O;  1NJI P;  1VQ5 L;  1W2B K;  1VQM L;  1QVG N;  1VQ6 L;  3CCS O;  2QA4 L;  1YIJ O;  1W2B N;  1S72 L;  1YJN O;  1VQ8 O;  3OW2 N;  1VQN L;  1KD1 P;  1VQO O;  3CCE O;  3GOD A;  1Q7Y P;  1JJ2 N;  1KC8 M;  5DS5 A;  3NKD A;  4N06 A;  3CCQ L;  1K73 M;  2OTL O;  3CME O;  3CD6 O;  3G6E L;  1N8R M;  3G4S O;  1QVF N;  3CMA L;  3CC2 O;  1YIT O;  3CCU L;  1YHQ L;  3CC4 O;  1K9M P;  1YJ9 O;  1VQP L;  2QEX L;  1M1K P;  1VQ9 L;  1QVG K;  3CXC K;  1Q86 M;  1VQ4 L;  3CXC N;  3CCR L;  1YI2 O;  3CCS L;  1K8A M;  3OW2 K;  1YIJ L;  1NJI M;  1VQK O;  3I56 O;  3CPW N;  1JJ2 K;  1YJN L;  1VQO L;  3CCE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...