1QFQB

Bacteriophage lambda n-protein-nutboxb-rna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
35
structure length
35
Chain Sequence
DAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna
molecule keywords 15-mer nutRboxB RNA hairpin
publication title Antitermination in bacteriophage lambda. The structure of the N36 peptide-boxB RNA complex
pubmed doi rcsb
source organism Enterobacteria phage lambda
total genus 8
structure length 35
sequence length 35
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11438 N36 36-mer N-terminal peptide of the N protein (N36)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...