1QN3A

Crystal structure of the c(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn3A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn3A02
1KY6A 1TGHA 1KYFA 1QN5A 1TBAB 4RODB 1YTFA 1MP9A 2IV8A 1QN3A 4WZSD 1AISA 1YTBA 1QNAA 2G30A 3H1ZA 2MJ7A 1QTSA 3EIKA 5IYBP 1B9KA 1NH2A 1PZDA 1TBPA 2D0CA 3OCIA 5IYCP 1RM1A 1PCZA 4ROEB 1VTOA 2IV9A 5IYDP 1QNCA 1QN6A 2D0AA 4ROCB 3VN5A 2VJ0A 3HS9A 2D0BA 3OC3C 1D3UA 1QN4A 4PY5A 1JFIC 3HS8A 1NVPA 1W80A 1VOKA 1KYDA 2Z8UA 1KY7A 1QN7A 1E42A 1QN9A 4B0AA 1R4XA 1QNBA 1QNEA 1VTLE 1CDWA 1KYUA 1VOLB 1QN8A 3ASMA 1QTPA 1C9BB 1NGMA
chains in the Genus database with same CATH superfamily
3RSMA 1LWVA 3EAYA 3D7QA 1MPGA 1MP9A 1YTBA 4EJYA 2HKPA 2G30A 3H1ZA 2XHIA 1KFQA 2QR1A 1XSZA 1PZDA 2HL8A 3ENCA 2H4LX 3TE5A 1LWWA 3I0XA 3OH6A 1QN6A 2D0AA 3CWUA 2VJ0A 2D0BA 3OGDA 3CVTA 2JHNA 3CWSA 4I8OA 1KYDA 1VOKA 3ULXA 1QNEA 2O3OA 4EAKA 3CW7A 1CDWA 1VOLB 1HU0A 2LAEA 1NGMA 1LWYA 1C4GA 1UT4A 3T4NA 2QREA 1YTFA 2IV8A 2Z0FA 3KTUA 2HZSA 4WZSD 1DIZA 2FUVA 4CFFA 1KO9A 3EIKA 5IYBP 1B9KA 2EHBD 2YA3A 3I0WA 2NOBA 3N89A 3OCIA 3OSEA 2QRCA 5IYCP 1YQLA 1M3HA 3F0ZA 3RPJA 1YQRA 4EJZA 3OLPA 4BJUA 1EBMA 5AN4A 1QNCA 4EAJA 3VN5A 3OSMA 4DULA 3OH9A 3HS8A 1NVPA 1W80A 2DKDA 3D4VA 2NOIA 4MRQA 2FKMX 1WJWA 4D7RA 2JPIA 1VTLE 1T6AA 1QN8A 3ASMA 1QTPA 1NH2A 1C9BB 1EUVA 2NOFA 1TGHA 2NLVA 1V5SA 1TBAB 2QRDA 1VKLA 4IL8A 1N3AA 3PDKA 1AISA 2NOHA 1QNAA 3DPUA 3I3WA 3C04A 3CWTA 1PVSA 4C7PA 4D7QA 1LXTA 1FN7A 3F10A 2I5WA 4Q11A 4EALA 3BKQX 2HZMA 2QLVA 1PCZA 4WX8A 2ZFDB 1KFIA 2R5XA 4QG5A 3UW2A 4ROEB 3IH7A 1VTOA 2NOEA 5IYDP 2H5AX 2PWWA 5JMVD 2YH5A 5HSHA 3SNSA 5JN5A 3HS9A 3ENOC 1D3UA 1QN4A 2F7LA 2Y8QA 2DKAA 2V8QA 3TDHA 2NWVA 1E42A 1QN7A 2FGTA 2OOXA 2OOYA 1P5DX 5KL0A 1R4XA 3CVSA 1M3QA 1QN9A 1KYUA 3DPTA 1C47A 3NA5A 1PCMX 1QN3A 1KY6A 5F9CA 2JHJA 1KYFA 1QN5A 2MZ8A 4RODB 5EPCA 4HJHA 1UT7A 2MJ7A 1QTSA 5BMNA 1M5Q1 2V9JA 1P5GX 1TBPA 2D0CA 2HL9A 1JDYA 1UL7A 2NVMA 1RM1A 1YQMA 4EAIA 2FKFA 2IV9A 1K35A 5BMPA 4EAGA 1TUOA 2NOLA 1K2YX 4ROCB 3KRMA 3OC3C 1YQKA 2V92A 3PMGA 2NOZA 4PY5A 2JOIA 1JFIC 1N3CA 1WQAA 1N39A 2DKCA 2Z8UA 1KY7A 1Q9UA 1J3MA 4TPSA 4B0AA 1QNBA 1PCJX 4WXAA 3OSTA 2Y8LA 3CWAA
chains in the Genus database with same CATH topology
1LWVA 1MP9A 1YTBA 4EJYA 2G30A 3H1ZA 2XHIA 1PZDA 1LWWA 3I0XA 1QN6A 2D0AA 2VJ0A 2D0BA 4I8OA 1VOKA 1KYDA 3ULXA 1QNEA 2O3OA 1CDWA 1VOLB 1HU0A 2LAEA 1NGMA 1LWYA 1UT4A 1YTFA 2IV8A 3KTUA 2HZSA 4WZSD 1KO9A 3EIKA 5IYBP 1B9KA 3I0WA 2NOBA 3N89A 3OCIA 1YQLA 5IYCP 1M3HA 3F0ZA 3RPJA 1YQRA 4EJZA 1EBMA 5AN4A 1QNCA 3VN5A 3OSMA 4DULA 3HS8A 1NVPA 1W80A 2NOIA 1VTLE 1QN8A 3ASMA 1QTPA 1NH2A 1C9BB 2NOFA 1TGHA 1N3AA 1TBAB 1AISA 2NOHA 1QNAA 3DPUA 2I5WA 1FN7A 3F10A 4Q11A 2HZMA 1PCZA 3IH7A 4ROEB 1VTOA 5IYDP 2NOEA 2YH5A 3SNSA 3HS9A 1D3UA 1QN4A 1QN7A 1E42A 2FGTA 1M3QA 1QN9A 1R4XA 1KYUA 3DPTA 1QN3A 1KY6A 1KYFA 1QN5A 2MZ8A 4RODB 1UT7A 2MJ7A 1QTSA 1TBPA 2D0CA 1RM1A 1YQMA 2IV9A 2NOLA 4ROCB 3KRMA 3OC3C 1YQKA 2NOZA 4PY5A 2JOIA 1JFIC 1N3CA 1N39A 2Z8UA 1KY7A 4TPSA 4B0AA 1QNBA 3OSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KY6 A;  1TGH A;  1KYF A;  1QN5 A;  1TBA B;  4ROD B;  1YTF A;  1MP9 A;  2IV8 A;  1QN3 A;  4WZS D;  1AIS A;  1YTB A;  1QNA A;  2G30 A;  3H1Z A;  2MJ7 A;  1QTS A;  3EIK A;  5IYB P;  1B9K A;  1NH2 A;  1PZD A;  1TBP A;  2D0C A;  3OCI A;  5IYC P;  1RM1 A;  1PCZ A;  4ROE B;  1VTO A;  2IV9 A;  5IYD P;  1QNC A;  1QN6 A;  2D0A A;  4ROC B;  3VN5 A;  2VJ0 A;  3HS9 A;  2D0B A;  3OC3 C;  1D3U A;  1QN4 A;  4PY5 A;  1JFI C;  3HS8 A;  1NVP A;  1W80 A;  1VOK A;  1KYD A;  2Z8U A;  1KY7 A;  1QN7 A;  1E42 A;  1QN9 A;  4B0A A;  1R4X A;  1QNB A;  1QNE A;  1VTL E;  1CDW A;  1KYU A;  1VOL B;  1QN8 A;  3ASM A;  1QTP A;  1C9B B;  1NGM A; 
#chains in the Genus database with same CATH topology
 3RSM A;  1LWV A;  3EAY A;  3D7Q A;  1MPG A;  1MP9 A;  1YTB A;  4EJY A;  2HKP A;  2G30 A;  3H1Z A;  2XHI A;  1KFQ A;  2QR1 A;  1XSZ A;  1PZD A;  2HL8 A;  3ENC A;  2H4L X;  3TE5 A;  1LWW A;  3I0X A;  3OH6 A;  1QN6 A;  2D0A A;  3CWU A;  2VJ0 A;  2D0B A;  3OGD A;  3CVT A;  2JHN A;  3CWS A;  4I8O A;  1KYD A;  1VOK A;  3ULX A;  1QNE A;  2O3O A;  4EAK A;  3CW7 A;  1CDW A;  1VOL B;  1HU0 A;  2LAE A;  1NGM A;  1LWY A;  1C4G A;  1UT4 A;  3T4N A;  2QRE A;  1YTF A;  2IV8 A;  2Z0F A;  3KTU A;  2HZS A;  4WZS D;  1DIZ A;  2FUV A;  4CFF A;  1KO9 A;  3EIK A;  5IYB P;  1B9K A;  2EHB D;  2YA3 A;  3I0W A;  2NOB A;  3N89 A;  3OCI A;  3OSE A;  2QRC A;  5IYC P;  1YQL A;  1M3H A;  3F0Z A;  3RPJ A;  1YQR A;  4EJZ A;  3OLP A;  4BJU A;  1EBM A;  5AN4 A;  1QNC A;  4EAJ A;  3VN5 A;  3OSM A;  4DUL A;  3OH9 A;  3HS8 A;  1NVP A;  1W80 A;  2DKD A;  3D4V A;  2NOI A;  4MRQ A;  2FKM X;  1WJW A;  4D7R A;  2JPI A;  1VTL E;  1T6A A;  1QN8 A;  3ASM A;  1QTP A;  1NH2 A;  1C9B B;  1EUV A;  2NOF A;  1TGH A;  2NLV A;  1V5S A;  1TBA B;  2QRD A;  1VKL A;  4IL8 A;  1N3A A;  3PDK A;  1AIS A;  2NOH A;  1QNA A;  3DPU A;  3I3W A;  3C04 A;  3CWT A;  1PVS A;  4C7P A;  4D7Q A;  1LXT A;  1FN7 A;  3F10 A;  2I5W A;  4Q11 A;  4EAL A;  3BKQ X;  2HZM A;  2QLV A;  1PCZ A;  4WX8 A;  2ZFD B;  1KFI A;  2R5X A;  4QG5 A;  3UW2 A;  4ROE B;  3IH7 A;  1VTO A;  2NOE A;  5IYD P;  2H5A X;  2PWW A;  5JMV D;  2YH5 A;  5HSH A;  3SNS A;  5JN5 A;  3HS9 A;  3ENO C;  1D3U A;  1QN4 A;  2F7L A;  2Y8Q A;  2DKA A;  2V8Q A;  3TDH A;  2NWV A;  1E42 A;  1QN7 A;  2FGT A;  2OOX A;  2OOY A;  1P5D X;  5KL0 A;  1R4X A;  3CVS A;  1M3Q A;  1QN9 A;  1KYU A;  3DPT A;  1C47 A;  3NA5 A;  1PCM X;  1QN3 A;  1KY6 A;  5F9C A;  2JHJ A;  1KYF A;  1QN5 A;  2MZ8 A;  4ROD B;  5EPC A;  4HJH A;  1UT7 A;  2MJ7 A;  1QTS A;  5BMN A;  1M5Q 1;  2V9J A;  1P5G X;  1TBP A;  2D0C A;  2HL9 A;  1JDY A;  1UL7 A;  2NVM A;  1RM1 A;  1YQM A;  4EAI A;  2FKF A;  2IV9 A;  1K35 A;  5BMP A;  4EAG A;  1TUO A;  2NOL A;  1K2Y X;  4ROC B;  3KRM A;  3OC3 C;  1YQK A;  2V92 A;  3PMG A;  2NOZ A;  4PY5 A;  2JOI A;  1JFI C;  1N3C A;  1WQA A;  1N39 A;  2DKC A;  2Z8U A;  1KY7 A;  1Q9U A;  1J3M A;  4TPS A;  4B0A A;  1QNB A;  1PCJ X;  4WXA A;  3OST A;  2Y8L A;  3CWA A; 
#chains in the Genus database with same CATH homology
 1LWV A;  1MP9 A;  1YTB A;  4EJY A;  2G30 A;  3H1Z A;  2XHI A;  1PZD A;  1LWW A;  3I0X A;  1QN6 A;  2D0A A;  2VJ0 A;  2D0B A;  4I8O A;  1VOK A;  1KYD A;  3ULX A;  1QNE A;  2O3O A;  1CDW A;  1VOL B;  1HU0 A;  2LAE A;  1NGM A;  1LWY A;  1UT4 A;  1YTF A;  2IV8 A;  3KTU A;  2HZS A;  4WZS D;  1KO9 A;  3EIK A;  5IYB P;  1B9K A;  3I0W A;  2NOB A;  3N89 A;  3OCI A;  1YQL A;  5IYC P;  1M3H A;  3F0Z A;  3RPJ A;  1YQR A;  4EJZ A;  1EBM A;  5AN4 A;  1QNC A;  3VN5 A;  3OSM A;  4DUL A;  3HS8 A;  1NVP A;  1W80 A;  2NOI A;  1VTL E;  1QN8 A;  3ASM A;  1QTP A;  1NH2 A;  1C9B B;  2NOF A;  1TGH A;  1N3A A;  1TBA B;  1AIS A;  2NOH A;  1QNA A;  3DPU A;  2I5W A;  1FN7 A;  3F10 A;  4Q11 A;  2HZM A;  1PCZ A;  3IH7 A;  4ROE B;  1VTO A;  5IYD P;  2NOE A;  2YH5 A;  3SNS A;  3HS9 A;  1D3U A;  1QN4 A;  1QN7 A;  1E42 A;  2FGT A;  1M3Q A;  1QN9 A;  1R4X A;  1KYU A;  3DPT A;  1QN3 A;  1KY6 A;  1KYF A;  1QN5 A;  2MZ8 A;  4ROD B;  1UT7 A;  2MJ7 A;  1QTS A;  1TBP A;  2D0C A;  1RM1 A;  1YQM A;  2IV9 A;  2NOL A;  4ROC B;  3KRM A;  3OC3 C;  1YQK A;  2NOZ A;  4PY5 A;  2JOI A;  1JFI C;  1N3C A;  1N39 A;  2Z8U A;  1KY7 A;  4TPS A;  4B0A A;  1QNB A;  3OST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...