1QN4A

Crystal structure of the t(-24) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 48
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn4A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn4A02
3OC3C 2IV8A 3HS8A 3H1ZA 4PY5A 1QN7A 1QN6A 1B9KA 1TBPA 1D3UA 1PZDA 2G30A 5IYCP 3VN5A 5IYBP 2Z8UA 5IYDP 1VTOA 4WZSD 4B0AA 1NGMA 1C9BB 1QNEA 4ROCB 1QN5A 1TBAB 2IV9A 1NVPA 1QTPA 1MP9A 1KY6A 3HS9A 1KY7A 1KYUA 1JFIC 1QNAA 2MJ7A 3EIKA 1QNBA 1QN8A 1VOKA 1QN9A 4ROEB 1YTFA 4RODB 1QNCA 1KYFA 2D0BA 1W80A 2D0AA 3OCIA 1QN3A 3ASMA 1E42A 1AISA 1QN4A 1KYDA 1R4XA 1VTLE 2D0CA 1YTBA 1VOLB 1QTSA 1PCZA 2VJ0A 1CDWA 1NH2A 1TGHA 1RM1A
chains in the Genus database with same CATH superfamily
1K35A 3HS8A 1Q9UA 2H5AX 1YQLA 2QRCA 4PY5A 3NA5A 4EALA 1PZDA 3EAYA 1LWVA 5F9CA 4I8OA 5IYDP 3OSEA 3UW2A 1VTOA 1LWYA 4EJYA 1C47A 3CWAA 1C9BB 3KRMA 1UT7A 2Y8LA 4CFFA 1TBAB 1QN6A 2NOEA 1QNAA 5KL0A 1KY6A 1M5Q1 3HS9A 4EAJA 2NOIA 2Z0FA 3CWSA 3CWTA 3PDKA 4WXAA 1YTFA 4ROEB 4MRQA 3TE5A 1J3MA 1PCJX 1W80A 2HKPA 1E42A 1R4XA 2NOLA 2HL9A 2Y8QA 1DIZA 1VOLB 1PCZA 2DKCA 2VJ0A 1NH2A 1CDWA 2DKDA 3CVSA 2H4LX 2OOYA 3PMGA 3H1ZA 1KFQA 4TPSA 5BMNA 3IH7A 2HZSA 1B9KA 1M3HA 1JDYA 2EHBD 2G30A 4QG5A 1D3UA 5IYBP 2Z8UA 2NOHA 1WJWA 2JHJA 1M3QA 1NGMA 1EUVA 2ZFDB 2V8QA 1UL7A 2PWWA 2NVMA 4Q11A 1QTPA 4C7PA 3CW7A 3F10A 2FKFA 3D4VA 2YH5A 2NOBA 2JHNA 3OH6A 1QNBA 1VOKA 3ENOC 1QN9A 4RODB 2OOXA 5BMPA 2D0BA 2D0AA 1QN3A 1HU0A 2V9JA 4DULA 2XHIA 1LXTA 1TUOA 2D0CA 2FKMX 2HZMA 1YQMA 2DKAA 5HSHA 1QTSA 1V5SA 3ULXA 4D7RA 1RM1A 3OC3C 4D7QA 1K2YX 2F7LA 3T4NA 1XSZA 2R5XA 1TBPA 2QLVA 5IYCP 3VN5A 3DPTA 4IL8A 5AN4A 2MZ8A 3CVTA 2YA3A 4HJHA 1N39A 1QNEA 1FN7A 4ROCB 1QN5A 1NVPA 1PCMX 1MP9A 3N89A 3I0WA 5JN5A 3I3WA 1YQRA 1QN8A 1LWWA 3DPUA 2O3OA 1C4GA 1KYFA 3ASMA 1UT4A 2QREA 2FUVA 1AISA 3RPJA 1KYDA 3CWUA 1VTLE 4EAIA 3OSMA 1YTBA 4BJUA 3OSTA 1TGHA 2NWVA 4WX8A 3OH9A 2LAEA 2IV8A 3F0ZA 2QR1A 5EPCA 1WQAA 3OLPA 2FGTA 2JOIA 1T6AA 2HL8A 1P5DX 3SNSA 1QN7A 3KTUA 3C04A 1EBMA 2V92A 4WZSD 3RSMA 4B0AA 3ENCA 3TDHA 2NLVA 3BKQX 2IV9A 2NOZA 1N3AA 1JFIC 1KY7A 1KYUA 1MPGA 2I5WA 2MJ7A 2NOFA 2JPIA 3EIKA 4EAKA 3OGDA 2QRDA 4EAGA 1QNCA 3OCIA 1YQKA 1QN4A 5JMVD 1KO9A 4EJZA 1N3CA 1KFIA 3I0XA 3D7QA 1PVSA 1VKLA 1P5GX
chains in the Genus database with same CATH topology
3HS8A 1YQLA 4PY5A 1PZDA 1LWVA 4I8OA 5IYDP 1VTOA 1LWYA 4EJYA 1C9BB 2NOEA 3KRMA 1UT7A 1QN6A 1TBAB 1QNAA 1KY6A 3HS9A 2NOIA 1YTFA 4ROEB 1W80A 1E42A 1R4XA 2NOLA 1VOLB 1PCZA 2VJ0A 1CDWA 1NH2A 4TPSA 3H1ZA 3IH7A 2HZSA 1B9KA 1M3HA 1D3UA 2G30A 5IYBP 2Z8UA 2NOHA 1M3QA 1NGMA 4Q11A 1QTPA 3F10A 2YH5A 2NOBA 1QNBA 1VOKA 1QN9A 4RODB 2D0BA 2D0AA 1QN3A 1HU0A 4DULA 2XHIA 2D0CA 2HZMA 1YQMA 1QTSA 3ULXA 1RM1A 3OC3C 1TBPA 5IYCP 3VN5A 3DPTA 5AN4A 2MZ8A 1N39A 1QNEA 1FN7A 4ROCB 1QN5A 1NVPA 1MP9A 3N89A 3I0WA 1YQRA 1QN8A 1LWWA 3DPUA 2O3OA 1KYFA 3ASMA 1UT4A 1AISA 3RPJA 1KYDA 1VTLE 3OSMA 1YTBA 3OSTA 1TGHA 2LAEA 2IV8A 3F0ZA 2FGTA 2JOIA 1QN7A 3SNSA 3KTUA 1EBMA 4WZSD 4B0AA 2NOZA 2IV9A 1N3AA 1JFIC 1KY7A 1KYUA 2I5WA 2MJ7A 2NOFA 3EIKA 1QNCA 3OCIA 1YQKA 1QN4A 1KO9A 4EJZA 1N3CA 3I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OC3 C;  2IV8 A;  3HS8 A;  3H1Z A;  4PY5 A;  1QN7 A;  1QN6 A;  1B9K A;  1TBP A;  1D3U A;  1PZD A;  2G30 A;  5IYC P;  3VN5 A;  5IYB P;  2Z8U A;  5IYD P;  1VTO A;  4WZS D;  4B0A A;  1NGM A;  1C9B B;  1QNE A;  4ROC B;  1QN5 A;  1TBA B;  2IV9 A;  1NVP A;  1QTP A;  1MP9 A;  1KY6 A;  3HS9 A;  1KY7 A;  1KYU A;  1JFI C;  1QNA A;  2MJ7 A;  3EIK A;  1QNB A;  1QN8 A;  1VOK A;  1QN9 A;  4ROE B;  1YTF A;  4ROD B;  1QNC A;  1KYF A;  2D0B A;  1W80 A;  2D0A A;  3OCI A;  1QN3 A;  3ASM A;  1E42 A;  1AIS A;  1QN4 A;  1KYD A;  1R4X A;  1VTL E;  2D0C A;  1YTB A;  1VOL B;  1QTS A;  1PCZ A;  2VJ0 A;  1CDW A;  1NH2 A;  1TGH A;  1RM1 A; 
#chains in the Genus database with same CATH topology
 1K35 A;  3HS8 A;  1Q9U A;  2H5A X;  1YQL A;  2QRC A;  4PY5 A;  3NA5 A;  4EAL A;  1PZD A;  3EAY A;  1LWV A;  5F9C A;  4I8O A;  5IYD P;  3OSE A;  3UW2 A;  1VTO A;  1LWY A;  4EJY A;  1C47 A;  3CWA A;  1C9B B;  3KRM A;  1UT7 A;  2Y8L A;  4CFF A;  1TBA B;  1QN6 A;  2NOE A;  1QNA A;  5KL0 A;  1KY6 A;  1M5Q 1;  3HS9 A;  4EAJ A;  2NOI A;  2Z0F A;  3CWS A;  3CWT A;  3PDK A;  4WXA A;  1YTF A;  4ROE B;  4MRQ A;  3TE5 A;  1J3M A;  1PCJ X;  1W80 A;  2HKP A;  1E42 A;  1R4X A;  2NOL A;  2HL9 A;  2Y8Q A;  1DIZ A;  1VOL B;  1PCZ A;  2DKC A;  2VJ0 A;  1NH2 A;  1CDW A;  2DKD A;  3CVS A;  2H4L X;  2OOY A;  3PMG A;  3H1Z A;  1KFQ A;  4TPS A;  5BMN A;  3IH7 A;  2HZS A;  1B9K A;  1M3H A;  1JDY A;  2EHB D;  2G30 A;  4QG5 A;  1D3U A;  5IYB P;  2Z8U A;  2NOH A;  1WJW A;  2JHJ A;  1M3Q A;  1NGM A;  1EUV A;  2ZFD B;  2V8Q A;  1UL7 A;  2PWW A;  2NVM A;  4Q11 A;  1QTP A;  4C7P A;  3CW7 A;  3F10 A;  2FKF A;  3D4V A;  2YH5 A;  2NOB A;  2JHN A;  3OH6 A;  1QNB A;  1VOK A;  3ENO C;  1QN9 A;  4ROD B;  2OOX A;  5BMP A;  2D0B A;  2D0A A;  1QN3 A;  1HU0 A;  2V9J A;  4DUL A;  2XHI A;  1LXT A;  1TUO A;  2D0C A;  2FKM X;  2HZM A;  1YQM A;  2DKA A;  5HSH A;  1QTS A;  1V5S A;  3ULX A;  4D7R A;  1RM1 A;  3OC3 C;  4D7Q A;  1K2Y X;  2F7L A;  3T4N A;  1XSZ A;  2R5X A;  1TBP A;  2QLV A;  5IYC P;  3VN5 A;  3DPT A;  4IL8 A;  5AN4 A;  2MZ8 A;  3CVT A;  2YA3 A;  4HJH A;  1N39 A;  1QNE A;  1FN7 A;  4ROC B;  1QN5 A;  1NVP A;  1PCM X;  1MP9 A;  3N89 A;  3I0W A;  5JN5 A;  3I3W A;  1YQR A;  1QN8 A;  1LWW A;  3DPU A;  2O3O A;  1C4G A;  1KYF A;  3ASM A;  1UT4 A;  2QRE A;  2FUV A;  1AIS A;  3RPJ A;  1KYD A;  3CWU A;  1VTL E;  4EAI A;  3OSM A;  1YTB A;  4BJU A;  3OST A;  1TGH A;  2NWV A;  4WX8 A;  3OH9 A;  2LAE A;  2IV8 A;  3F0Z A;  2QR1 A;  5EPC A;  1WQA A;  3OLP A;  2FGT A;  2JOI A;  1T6A A;  2HL8 A;  1P5D X;  3SNS A;  1QN7 A;  3KTU A;  3C04 A;  1EBM A;  2V92 A;  4WZS D;  3RSM A;  4B0A A;  3ENC A;  3TDH A;  2NLV A;  3BKQ X;  2IV9 A;  2NOZ A;  1N3A A;  1JFI C;  1KY7 A;  1KYU A;  1MPG A;  2I5W A;  2MJ7 A;  2NOF A;  2JPI A;  3EIK A;  4EAK A;  3OGD A;  2QRD A;  4EAG A;  1QNC A;  3OCI A;  1YQK A;  1QN4 A;  5JMV D;  1KO9 A;  4EJZ A;  1N3C A;  1KFI A;  3I0X A;  3D7Q A;  1PVS A;  1VKL A;  1P5G X; 
#chains in the Genus database with same CATH homology
 3HS8 A;  1YQL A;  4PY5 A;  1PZD A;  1LWV A;  4I8O A;  5IYD P;  1VTO A;  1LWY A;  4EJY A;  1C9B B;  2NOE A;  3KRM A;  1UT7 A;  1QN6 A;  1TBA B;  1QNA A;  1KY6 A;  3HS9 A;  2NOI A;  1YTF A;  4ROE B;  1W80 A;  1E42 A;  1R4X A;  2NOL A;  1VOL B;  1PCZ A;  2VJ0 A;  1CDW A;  1NH2 A;  4TPS A;  3H1Z A;  3IH7 A;  2HZS A;  1B9K A;  1M3H A;  1D3U A;  2G30 A;  5IYB P;  2Z8U A;  2NOH A;  1M3Q A;  1NGM A;  4Q11 A;  1QTP A;  3F10 A;  2YH5 A;  2NOB A;  1QNB A;  1VOK A;  1QN9 A;  4ROD B;  2D0B A;  2D0A A;  1QN3 A;  1HU0 A;  4DUL A;  2XHI A;  2D0C A;  2HZM A;  1YQM A;  1QTS A;  3ULX A;  1RM1 A;  3OC3 C;  1TBP A;  5IYC P;  3VN5 A;  3DPT A;  5AN4 A;  2MZ8 A;  1N39 A;  1QNE A;  1FN7 A;  4ROC B;  1QN5 A;  1NVP A;  1MP9 A;  3N89 A;  3I0W A;  1YQR A;  1QN8 A;  1LWW A;  3DPU A;  2O3O A;  1KYF A;  3ASM A;  1UT4 A;  1AIS A;  3RPJ A;  1KYD A;  1VTL E;  3OSM A;  1YTB A;  3OST A;  1TGH A;  2LAE A;  2IV8 A;  3F0Z A;  2FGT A;  2JOI A;  1QN7 A;  3SNS A;  3KTU A;  1EBM A;  4WZS D;  4B0A A;  2NOZ A;  2IV9 A;  1N3A A;  1JFI C;  1KY7 A;  1KYU A;  2I5W A;  2MJ7 A;  2NOF A;  3EIK A;  1QNC A;  3OCI A;  1YQK A;  1QN4 A;  1KO9 A;  4EJZ A;  1N3C A;  3I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...