1QN5A

Crystal structure of the g(-26) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn5A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn5A02
1CDWA 4WZSD 1QN9A 2G30A 3H1ZA 5IYCP 1W80A 1QN5A 1TGHA 2D0AA 1PCZA 1MP9A 1PZDA 1C9BB 1QN3A 1KYFA 1AISA 3HS9A 1QN4A 1QNBA 1TBPA 1KY7A 1B9KA 1QN8A 2MJ7A 4RODB 3OCIA 1VTOA 3HS8A 1TBAB 2IV8A 1NGMA 1YTFA 1QNAA 1RM1A 1QTSA 4B0AA 1YTBA 1VOLB 2Z8UA 1KYDA 2IV9A 2D0CA 3EIKA 4ROCB 1NVPA 3VN5A 1E42A 1KYUA 1QNCA 1R4XA 1VTLE 3OC3C 1D3UA 1VOKA 5IYBP 2VJ0A 1JFIC 1QN6A 1QTPA 1QN7A 2D0BA 4PY5A 3ASMA 4ROEB 5IYDP 1QNEA 1KY6A 1NH2A
chains in the Genus database with same CATH superfamily
1CDWA 3CWAA 3C04A 2NWVA 4WZSD 2DKAA 1K2YX 2V92A 2QR1A 1M3HA 1LWVA 5BMPA 2JHJA 2NLVA 3HS9A 1QNBA 1TBPA 5HSHA 5KL0A 4CFFA 3ENOC 3N89A 1P5DX 3OCIA 1YQMA 3CVTA 2DKCA 1QTSA 4QG5A 3RSMA 3OH6A 2Z8UA 1YTBA 1KYDA 2D0CA 2V9JA 1C4GA 1NVPA 3VN5A 1KYUA 2YH5A 4EAKA 1VOKA 5IYBP 2MZ8A 4EJYA 1QN7A 2NOIA 3EAYA 1M3QA 5AN4A 3ENCA 3I3WA 4EAJA 1N39A 3PDKA 1M5Q1 1V5SA 5JN5A 2NOFA 2G30A 3H1ZA 3NA5A 1W80A 3SNSA 1YQLA 4D7QA 1HU0A 1PCZA 1MP9A 4EAIA 3KTUA 1T6AA 3OH9A 3I0WA 4EJZA 3PMGA 3IH7A 2H4LX 2OOXA 2FGTA 2EHBD 3OGDA 2NOBA 2V8QA 3D4VA 1LWYA 1YTFA 2HL8A 1RM1A 1QNAA 1LWWA 3CWSA 5JMVD 2XHIA 2NOEA 2IV9A 3EIKA 1YQKA 2Z0FA 1QNCA 1VTLE 5F9CA 2R5XA 3CVSA 2F7LA 1UL7A 2HL9A 3DPUA 2Y8QA 1UT7A 2QRDA 4ROEB 4I8OA 1KY6A 2FKFA 1KFIA 4IL8A 1J3MA 1PVSA 1WJWA 2NOHA 3BKQX 2D0AA 2DKDA 4TPSA 3CWUA 1C9BB 1KFQA 2HZMA 1B9KA 2JPIA 3RPJA 2MJ7A 4Q11A 1KO9A 1TBAB 2IV8A 3I0XA 3F0ZA 1NGMA 1LXTA 1PCJX 2QRCA 1VOLB 2FUVA 1UT4A 3ULXA 1C47A 1TUOA 4HJHA 4ROCB 1E42A 3TDHA 1JDYA 1R4XA 2YA3A 4C7PA 3TE5A 1D3UA 2H5AX 4WX8A 1QN6A 1VKLA 1QTPA 2NOZA 2D0BA 1EBMA 3UW2A 3D7QA 1Q9UA 4PY5A 4EAGA 4MRQA 2FKMX 1P5GX 2I5WA 1PCMX 4D7RA 1MPGA 1EUVA 2OOYA 2HZSA 3DPTA 3CW7A 2NVMA 3OSMA 1QN9A 5IYCP 1YQRA 1TGHA 2PWWA 1FN7A 3OSEA 2NOLA 1PZDA 2O3OA 1QN3A 2QREA 2Y8LA 1KYFA 1WQAA 2HKPA 1AISA 3KRMA 3OSTA 1QN4A 4BJUA 1DIZA 1KY7A 1QN8A 4EALA 4RODB 1VTOA 3HS8A 2JHNA 2LAEA 5EPCA 4B0AA 1QN5A 3OLPA 3T4NA 5BMNA 3OC3C 2QLVA 1K35A 2VJ0A 3F10A 1N3AA 1N3CA 2JOIA 4DULA 1JFIC 3CWTA 1XSZA 2ZFDB 3ASMA 4WXAA 5IYDP 1QNEA 1NH2A
chains in the Genus database with same CATH topology
1CDWA 4WZSD 1M3HA 1LWVA 3HS9A 1QNBA 1TBPA 3N89A 3OCIA 1YQMA 1QTSA 1YTBA 2Z8UA 1KYDA 2D0CA 1NVPA 3VN5A 1KYUA 2YH5A 1VOKA 5IYBP 2MZ8A 4EJYA 1QN7A 2NOIA 1M3QA 5AN4A 1N39A 2NOFA 2G30A 3H1ZA 3SNSA 1W80A 1YQLA 1HU0A 1LWYA 1QN5A 1PCZA 1MP9A 4EJZA 3KTUA 3I0WA 3IH7A 2FGTA 2NOBA 1YTFA 1QNAA 1RM1A 1LWWA 2XHIA 2NOEA 2IV9A 3EIKA 1YQKA 1QNCA 1VTLE 3DPUA 1UT7A 4ROEB 4I8OA 1KY6A 2NOHA 2D0AA 1C9BB 4TPSA 2HZMA 1B9KA 3RPJA 2MJ7A 4Q11A 1KO9A 1TBAB 2IV8A 3I0XA 3F0ZA 1NGMA 1VOLB 1UT4A 3ULXA 4ROCB 1E42A 1R4XA 1D3UA 1QN6A 1QTPA 2NOZA 2D0BA 1EBMA 4PY5A 2I5WA 2HZSA 3DPTA 3OSMA 1QN9A 5IYCP 1YQRA 1TGHA 2NOLA 1FN7A 1PZDA 2O3OA 1QN3A 1KYFA 1AISA 3KRMA 3OSTA 1QN4A 1KY7A 1QN8A 4RODB 1VTOA 3HS8A 2LAEA 4B0AA 3OC3C 2VJ0A 1N3AA 3F10A 1N3CA 1JFIC 2JOIA 4DULA 3ASMA 5IYDP 1QNEA 1NH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDW A;  4WZS D;  1QN9 A;  2G30 A;  3H1Z A;  5IYC P;  1W80 A;  1QN5 A;  1TGH A;  2D0A A;  1PCZ A;  1MP9 A;  1PZD A;  1C9B B;  1QN3 A;  1KYF A;  1AIS A;  3HS9 A;  1QN4 A;  1QNB A;  1TBP A;  1KY7 A;  1B9K A;  1QN8 A;  2MJ7 A;  4ROD B;  3OCI A;  1VTO A;  3HS8 A;  1TBA B;  2IV8 A;  1NGM A;  1YTF A;  1QNA A;  1RM1 A;  1QTS A;  4B0A A;  1YTB A;  1VOL B;  2Z8U A;  1KYD A;  2IV9 A;  2D0C A;  3EIK A;  4ROC B;  1NVP A;  3VN5 A;  1E42 A;  1KYU A;  1QNC A;  1R4X A;  1VTL E;  3OC3 C;  1D3U A;  1VOK A;  5IYB P;  2VJ0 A;  1JFI C;  1QN6 A;  1QTP A;  1QN7 A;  2D0B A;  4PY5 A;  3ASM A;  4ROE B;  5IYD P;  1QNE A;  1KY6 A;  1NH2 A; 
#chains in the Genus database with same CATH topology
 1CDW A;  3CWA A;  3C04 A;  2NWV A;  4WZS D;  2DKA A;  1K2Y X;  2V92 A;  2QR1 A;  1M3H A;  1LWV A;  5BMP A;  2JHJ A;  2NLV A;  3HS9 A;  1QNB A;  1TBP A;  5HSH A;  5KL0 A;  4CFF A;  3ENO C;  3N89 A;  1P5D X;  3OCI A;  1YQM A;  3CVT A;  2DKC A;  1QTS A;  4QG5 A;  3RSM A;  3OH6 A;  2Z8U A;  1YTB A;  1KYD A;  2D0C A;  2V9J A;  1C4G A;  1NVP A;  3VN5 A;  1KYU A;  2YH5 A;  4EAK A;  1VOK A;  5IYB P;  2MZ8 A;  4EJY A;  1QN7 A;  2NOI A;  3EAY A;  1M3Q A;  5AN4 A;  3ENC A;  3I3W A;  4EAJ A;  1N39 A;  3PDK A;  1M5Q 1;  1V5S A;  5JN5 A;  2NOF A;  2G30 A;  3H1Z A;  3NA5 A;  1W80 A;  3SNS A;  1YQL A;  4D7Q A;  1HU0 A;  1PCZ A;  1MP9 A;  4EAI A;  3KTU A;  1T6A A;  3OH9 A;  3I0W A;  4EJZ A;  3PMG A;  3IH7 A;  2H4L X;  2OOX A;  2FGT A;  2EHB D;  3OGD A;  2NOB A;  2V8Q A;  3D4V A;  1LWY A;  1YTF A;  2HL8 A;  1RM1 A;  1QNA A;  1LWW A;  3CWS A;  5JMV D;  2XHI A;  2NOE A;  2IV9 A;  3EIK A;  1YQK A;  2Z0F A;  1QNC A;  1VTL E;  5F9C A;  2R5X A;  3CVS A;  2F7L A;  1UL7 A;  2HL9 A;  3DPU A;  2Y8Q A;  1UT7 A;  2QRD A;  4ROE B;  4I8O A;  1KY6 A;  2FKF A;  1KFI A;  4IL8 A;  1J3M A;  1PVS A;  1WJW A;  2NOH A;  3BKQ X;  2D0A A;  2DKD A;  4TPS A;  3CWU A;  1C9B B;  1KFQ A;  2HZM A;  1B9K A;  2JPI A;  3RPJ A;  2MJ7 A;  4Q11 A;  1KO9 A;  1TBA B;  2IV8 A;  3I0X A;  3F0Z A;  1NGM A;  1LXT A;  1PCJ X;  2QRC A;  1VOL B;  2FUV A;  1UT4 A;  3ULX A;  1C47 A;  1TUO A;  4HJH A;  4ROC B;  1E42 A;  3TDH A;  1JDY A;  1R4X A;  2YA3 A;  4C7P A;  3TE5 A;  1D3U A;  2H5A X;  4WX8 A;  1QN6 A;  1VKL A;  1QTP A;  2NOZ A;  2D0B A;  1EBM A;  3UW2 A;  3D7Q A;  1Q9U A;  4PY5 A;  4EAG A;  4MRQ A;  2FKM X;  1P5G X;  2I5W A;  1PCM X;  4D7R A;  1MPG A;  1EUV A;  2OOY A;  2HZS A;  3DPT A;  3CW7 A;  2NVM A;  3OSM A;  1QN9 A;  5IYC P;  1YQR A;  1TGH A;  2PWW A;  1FN7 A;  3OSE A;  2NOL A;  1PZD A;  2O3O A;  1QN3 A;  2QRE A;  2Y8L A;  1KYF A;  1WQA A;  2HKP A;  1AIS A;  3KRM A;  3OST A;  1QN4 A;  4BJU A;  1DIZ A;  1KY7 A;  1QN8 A;  4EAL A;  4ROD B;  1VTO A;  3HS8 A;  2JHN A;  2LAE A;  5EPC A;  4B0A A;  1QN5 A;  3OLP A;  3T4N A;  5BMN A;  3OC3 C;  2QLV A;  1K35 A;  2VJ0 A;  3F10 A;  1N3A A;  1N3C A;  2JOI A;  4DUL A;  1JFI C;  3CWT A;  1XSZ A;  2ZFD B;  3ASM A;  4WXA A;  5IYD P;  1QNE A;  1NH2 A; 
#chains in the Genus database with same CATH homology
 1CDW A;  4WZS D;  1M3H A;  1LWV A;  3HS9 A;  1QNB A;  1TBP A;  3N89 A;  3OCI A;  1YQM A;  1QTS A;  1YTB A;  2Z8U A;  1KYD A;  2D0C A;  1NVP A;  3VN5 A;  1KYU A;  2YH5 A;  1VOK A;  5IYB P;  2MZ8 A;  4EJY A;  1QN7 A;  2NOI A;  1M3Q A;  5AN4 A;  1N39 A;  2NOF A;  2G30 A;  3H1Z A;  3SNS A;  1W80 A;  1YQL A;  1HU0 A;  1LWY A;  1QN5 A;  1PCZ A;  1MP9 A;  4EJZ A;  3KTU A;  3I0W A;  3IH7 A;  2FGT A;  2NOB A;  1YTF A;  1QNA A;  1RM1 A;  1LWW A;  2XHI A;  2NOE A;  2IV9 A;  3EIK A;  1YQK A;  1QNC A;  1VTL E;  3DPU A;  1UT7 A;  4ROE B;  4I8O A;  1KY6 A;  2NOH A;  2D0A A;  1C9B B;  4TPS A;  2HZM A;  1B9K A;  3RPJ A;  2MJ7 A;  4Q11 A;  1KO9 A;  1TBA B;  2IV8 A;  3I0X A;  3F0Z A;  1NGM A;  1VOL B;  1UT4 A;  3ULX A;  4ROC B;  1E42 A;  1R4X A;  1D3U A;  1QN6 A;  1QTP A;  2NOZ A;  2D0B A;  1EBM A;  4PY5 A;  2I5W A;  2HZS A;  3DPT A;  3OSM A;  1QN9 A;  5IYC P;  1YQR A;  1TGH A;  2NOL A;  1FN7 A;  1PZD A;  2O3O A;  1QN3 A;  1KYF A;  1AIS A;  3KRM A;  3OST A;  1QN4 A;  1KY7 A;  1QN8 A;  4ROD B;  1VTO A;  3HS8 A;  2LAE A;  4B0A A;  3OC3 C;  2VJ0 A;  1N3A A;  3F10 A;  1N3C A;  1JFI C;  2JOI A;  4DUL A;  3ASM A;  5IYD P;  1QNE A;  1NH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...