1QN6A

Crystal structure of the t(-26) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
SKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 46
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn6A02
3H1ZA 1YTFA 4RODB 1QTSA 2D0BA 2G30A 3ASMA 1TBPA 1NH2A 1RM1A 3EIKA 1QN7A 1VOKA 2VJ0A 2D0CA 1KYFA 1QN6A 1TGHA 2IV9A 1W80A 1QNEA 1KYUA 1MP9A 1KY6A 1D3UA 1VTOA 1R4XA 2MJ7A 1QNAA 1NVPA 2D0AA 1QTPA 2Z8UA 4ROCB 1NGMA 1KY7A 1CDWA 1QN5A 1JFIC 1QN4A 1QN3A 1YTBA 1PZDA 1VTLE 2IV8A 4WZSD 1VOLB 3HS8A 3OCIA 1TBAB 1KYDA 5IYCP 3OC3C 1C9BB 5IYDP 5IYBP 1QN8A 1B9KA 1E42A 3HS9A 4B0AA 1QN9A 4ROEB 1QNBA 1QNCA 4PY5A 3VN5A 1AISA 1PCZA
chains in the Genus database with same CATH superfamily
2MZ8A 3CVSA 3IH7A 2NOFA 1NH2A 2HZMA 3DPUA 1RM1A 2NOBA 3UW2A 2H5AX 1QN7A 1V5SA 1TGHA 2NLVA 5JN5A 1YQRA 1D3UA 2PWWA 2YH5A 3D4VA 2DKAA 1T6AA 2NOEA 2NOIA 3OLPA 1FN7A 2EHBD 1QNAA 1NVPA 2D0AA 2Z8UA 3OSTA 1PVSA 1YTBA 2Z0FA 1PCJX 3OGDA 1VTLE 2QLVA 2O3OA 3RSMA 1K35A 4WZSD 1K2YX 1UT4A 3EAYA 1Q9UA 4EAIA 2FKFA 3NA5A 1N3AA 3HS9A 1QNBA 1QNCA 4I8OA 3N89A 1M3HA 1YQLA 3I3WA 3H1ZA 2JPIA 1YQKA 5BMPA 2I5WA 4HJHA 1LXTA 3EIKA 2NVMA 4EAGA 1WQAA 1QN6A 3TE5A 1KY6A 1R4XA 2MJ7A 3RPJA 3CVTA 3ENOC 5F9CA 4WXAA 4EAJA 5HSHA 2HL9A 1QTPA 1NGMA 2DKDA 4ROCB 1LWYA 1EBMA 2F7LA 2R5XA 1QN3A 4D7QA 3I0XA 2NOZA 2QR1A 1UT7A 4EJYA 3OCIA 1XSZA 1TBAB 1KYDA 5IYCP 1N3CA 1C9BB 2NOLA 2YA3A 2V8QA 3SNSA 4CFFA 1QN8A 1B9KA 4B0AA 1QN9A 1JDYA 2HL8A 1J3MA 5JMVD 2NOHA 2ZFDB 4TPSA 5KL0A 3VN5A 5IYBP 4RODB 1QTSA 2G30A 2NWVA 2QREA 3ASMA 3TDHA 3I0WA 4EJZA 3CW7A 4WX8A 1VOKA 1MPGA 1KYFA 3OSEA 1TUOA 1W80A 4DULA 1LWWA 1KO9A 1VTOA 1DIZA 2QRDA 3KRMA 2JHJA 1N39A 1CDWA 1QN5A 3BKQX 1UL7A 3F0ZA 4EALA 1JFIC 1QN4A 1PZDA 3CWTA 1P5DX 2V9JA 2JHNA 3CWAA 1VOLB 2FGTA 3HS8A 1P5GX 3PMGA 2Y8QA 5AN4A 3CWUA 5IYDP 1YQMA 3OH9A 1E42A 2FKMX 4PY5A 5EPCA 1YTFA 1C4GA 4IL8A 2D0BA 3ENCA 3F10A 1TBPA 2XHIA 4D7RA 3OH6A 2VJ0A 4MRQA 2OOYA 2D0CA 3C04A 2IV9A 2V92A 1QNEA 3D7QA 1KYUA 1MP9A 1VKLA 1M3QA 4Q11A 1EUVA 1LWVA 3KTUA 1KFQA 2QRCA 4EAKA 1WJWA 2HKPA 3ULXA 2Y8LA 3OSMA 1KY7A 3PDKA 5BMNA 4BJUA 1HU0A 2IV8A 1KFIA 2H4LX 2JOIA 2OOXA 1C47A 3T4NA 4C7PA 2LAEA 3DPTA 3CWSA 3OC3C 1PCMX 2HZSA 1M5Q1 4ROEB 4QG5A 2FUVA 2DKCA 1AISA 1PCZA
chains in the Genus database with same CATH topology
2MZ8A 3IH7A 2NOFA 1NH2A 2HZMA 3DPUA 1RM1A 2NOBA 1QN7A 1TGHA 1YQRA 1D3UA 2YH5A 2NOIA 2NOEA 1QNAA 1FN7A 1NVPA 2D0AA 2Z8UA 3OSTA 1YTBA 1VTLE 2O3OA 4WZSD 1UT4A 1N3AA 3HS9A 1QNBA 1QNCA 4I8OA 3N89A 1M3HA 1YQLA 3H1ZA 1YQKA 2I5WA 3EIKA 1QN6A 1KY6A 1R4XA 2MJ7A 3RPJA 1NGMA 1QTPA 1LWYA 4ROCB 1EBMA 1QN3A 2NOZA 3I0XA 1UT7A 4EJYA 3OCIA 2NOLA 1TBAB 1KYDA 5IYCP 1N3CA 1C9BB 3SNSA 1QN8A 1B9KA 1PCZA 4B0AA 1QN9A 2NOHA 4TPSA 5IYBP 3VN5A 4RODB 1QTSA 2G30A 3ASMA 4EJZA 1VOKA 1KYFA 4DULA 1W80A 1LWWA 1KO9A 1VTOA 3KRMA 1N39A 1CDWA 1QN5A 1JFIC 3F0ZA 1QN4A 1PZDA 1VOLB 2FGTA 3HS8A 5AN4A 5IYDP 1YQMA 1E42A 4PY5A 1YTFA 2D0BA 3F10A 1TBPA 2XHIA 2VJ0A 2D0CA 2IV9A 1QNEA 1M3QA 1KYUA 1MP9A 4Q11A 1LWVA 3KTUA 3ULXA 3OSMA 1KY7A 1HU0A 2IV8A 2JOIA 2LAEA 3DPTA 3OC3C 2HZSA 4ROEB 1AISA 3I0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1Z A;  1YTF A;  4ROD B;  1QTS A;  2D0B A;  2G30 A;  3ASM A;  1TBP A;  1NH2 A;  1RM1 A;  3EIK A;  1QN7 A;  1VOK A;  2VJ0 A;  2D0C A;  1KYF A;  1QN6 A;  1TGH A;  2IV9 A;  1W80 A;  1QNE A;  1KYU A;  1MP9 A;  1KY6 A;  1D3U A;  1VTO A;  1R4X A;  2MJ7 A;  1QNA A;  1NVP A;  2D0A A;  1QTP A;  2Z8U A;  4ROC B;  1NGM A;  1KY7 A;  1CDW A;  1QN5 A;  1JFI C;  1QN4 A;  1QN3 A;  1YTB A;  1PZD A;  1VTL E;  2IV8 A;  4WZS D;  1VOL B;  3HS8 A;  3OCI A;  1TBA B;  1KYD A;  5IYC P;  3OC3 C;  1C9B B;  5IYD P;  5IYB P;  1QN8 A;  1B9K A;  1E42 A;  3HS9 A;  4B0A A;  1QN9 A;  4ROE B;  1QNB A;  1QNC A;  4PY5 A;  3VN5 A;  1AIS A;  1PCZ A; 
#chains in the Genus database with same CATH topology
 2MZ8 A;  3CVS A;  3IH7 A;  2NOF A;  1NH2 A;  2HZM A;  3DPU A;  1RM1 A;  2NOB A;  3UW2 A;  2H5A X;  1QN7 A;  1V5S A;  1TGH A;  2NLV A;  5JN5 A;  1YQR A;  1D3U A;  2PWW A;  2YH5 A;  3D4V A;  2DKA A;  1T6A A;  2NOE A;  2NOI A;  3OLP A;  1FN7 A;  2EHB D;  1QNA A;  1NVP A;  2D0A A;  2Z8U A;  3OST A;  1PVS A;  1YTB A;  2Z0F A;  1PCJ X;  3OGD A;  1VTL E;  2QLV A;  2O3O A;  3RSM A;  1K35 A;  4WZS D;  1K2Y X;  1UT4 A;  3EAY A;  1Q9U A;  4EAI A;  2FKF A;  3NA5 A;  1N3A A;  3HS9 A;  1QNB A;  1QNC A;  4I8O A;  3N89 A;  1M3H A;  1YQL A;  3I3W A;  3H1Z A;  2JPI A;  1YQK A;  5BMP A;  2I5W A;  4HJH A;  1LXT A;  3EIK A;  2NVM A;  4EAG A;  1WQA A;  1QN6 A;  3TE5 A;  1KY6 A;  1R4X A;  2MJ7 A;  3RPJ A;  3CVT A;  3ENO C;  5F9C A;  4WXA A;  4EAJ A;  5HSH A;  2HL9 A;  1QTP A;  1NGM A;  2DKD A;  4ROC B;  1LWY A;  1EBM A;  2F7L A;  2R5X A;  1QN3 A;  4D7Q A;  3I0X A;  2NOZ A;  2QR1 A;  1UT7 A;  4EJY A;  3OCI A;  1XSZ A;  1TBA B;  1KYD A;  5IYC P;  1N3C A;  1C9B B;  2NOL A;  2YA3 A;  2V8Q A;  3SNS A;  4CFF A;  1QN8 A;  1B9K A;  4B0A A;  1QN9 A;  1JDY A;  2HL8 A;  1J3M A;  5JMV D;  2NOH A;  2ZFD B;  4TPS A;  5KL0 A;  3VN5 A;  5IYB P;  4ROD B;  1QTS A;  2G30 A;  2NWV A;  2QRE A;  3ASM A;  3TDH A;  3I0W A;  4EJZ A;  3CW7 A;  4WX8 A;  1VOK A;  1MPG A;  1KYF A;  3OSE A;  1TUO A;  1W80 A;  4DUL A;  1LWW A;  1KO9 A;  1VTO A;  1DIZ A;  2QRD A;  3KRM A;  2JHJ A;  1N39 A;  1CDW A;  1QN5 A;  3BKQ X;  1UL7 A;  3F0Z A;  4EAL A;  1JFI C;  1QN4 A;  1PZD A;  3CWT A;  1P5D X;  2V9J A;  2JHN A;  3CWA A;  1VOL B;  2FGT A;  3HS8 A;  1P5G X;  3PMG A;  2Y8Q A;  5AN4 A;  3CWU A;  5IYD P;  1YQM A;  3OH9 A;  1E42 A;  2FKM X;  4PY5 A;  5EPC A;  1YTF A;  1C4G A;  4IL8 A;  2D0B A;  3ENC A;  3F10 A;  1TBP A;  2XHI A;  4D7R A;  3OH6 A;  2VJ0 A;  4MRQ A;  2OOY A;  2D0C A;  3C04 A;  2IV9 A;  2V92 A;  1QNE A;  3D7Q A;  1KYU A;  1MP9 A;  1VKL A;  1M3Q A;  4Q11 A;  1EUV A;  1LWV A;  3KTU A;  1KFQ A;  2QRC A;  4EAK A;  1WJW A;  2HKP A;  3ULX A;  2Y8L A;  3OSM A;  1KY7 A;  3PDK A;  5BMN A;  4BJU A;  1HU0 A;  2IV8 A;  1KFI A;  2H4L X;  2JOI A;  2OOX A;  1C47 A;  3T4N A;  4C7P A;  2LAE A;  3DPT A;  3CWS A;  3OC3 C;  1PCM X;  2HZS A;  1M5Q 1;  4ROE B;  4QG5 A;  2FUV A;  2DKC A;  1AIS A;  1PCZ A; 
#chains in the Genus database with same CATH homology
 2MZ8 A;  3IH7 A;  2NOF A;  1NH2 A;  2HZM A;  3DPU A;  1RM1 A;  2NOB A;  1QN7 A;  1TGH A;  1YQR A;  1D3U A;  2YH5 A;  2NOI A;  2NOE A;  1QNA A;  1FN7 A;  1NVP A;  2D0A A;  2Z8U A;  3OST A;  1YTB A;  1VTL E;  2O3O A;  4WZS D;  1UT4 A;  1N3A A;  3HS9 A;  1QNB A;  1QNC A;  4I8O A;  3N89 A;  1M3H A;  1YQL A;  3H1Z A;  1YQK A;  2I5W A;  3EIK A;  1QN6 A;  1KY6 A;  1R4X A;  2MJ7 A;  3RPJ A;  1NGM A;  1QTP A;  1LWY A;  4ROC B;  1EBM A;  1QN3 A;  2NOZ A;  3I0X A;  1UT7 A;  4EJY A;  3OCI A;  2NOL A;  1TBA B;  1KYD A;  5IYC P;  1N3C A;  1C9B B;  3SNS A;  1QN8 A;  1B9K A;  1PCZ A;  4B0A A;  1QN9 A;  2NOH A;  4TPS A;  5IYB P;  3VN5 A;  4ROD B;  1QTS A;  2G30 A;  3ASM A;  4EJZ A;  1VOK A;  1KYF A;  4DUL A;  1W80 A;  1LWW A;  1KO9 A;  1VTO A;  3KRM A;  1N39 A;  1CDW A;  1QN5 A;  1JFI C;  3F0Z A;  1QN4 A;  1PZD A;  1VOL B;  2FGT A;  3HS8 A;  5AN4 A;  5IYD P;  1YQM A;  1E42 A;  4PY5 A;  1YTF A;  2D0B A;  3F10 A;  1TBP A;  2XHI A;  2VJ0 A;  2D0C A;  2IV9 A;  1QNE A;  1M3Q A;  1KYU A;  1MP9 A;  4Q11 A;  1LWV A;  3KTU A;  3ULX A;  3OSM A;  1KY7 A;  1HU0 A;  2IV8 A;  2JOI A;  2LAE A;  3DPT A;  3OC3 C;  2HZS A;  4ROE B;  1AIS A;  3I0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...