1QNBA

Crystal structure of the t(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qnbA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qnbA02
1KYFA 3HS9A 4B0AA 4RODB 1RM1A 1QN4A 2D0AA 1QNAA 1QN6A 2VJ0A 1KYUA 3HS8A 1QN5A 1TGHA 1PCZA 1PZDA 2IV8A 2IV9A 4ROEB 1TBAB 1NH2A 1QNBA 1QNCA 1QN3A 1MP9A 1NGMA 1QN7A 1YTBA 1QTSA 1C9BB 3EIKA 1KY6A 3ASMA 1KY7A 1YTFA 1D3UA 1E42A 5IYDP 1VTOA 1QTPA 1R4XA 4ROCB 2D0BA 2MJ7A 1VOKA 5IYCP 3OCIA 1CDWA 3H1ZA 4WZSD 1B9KA 1QNEA 4PY5A 1TBPA 1JFIC 1QN9A 1NVPA 1QN8A 2Z8UA 3OC3C 2G30A 3VN5A 1VTLE 1VOLB 1KYDA 5IYBP 1W80A 2D0CA 1AISA
chains in the Genus database with same CATH superfamily
3CWUA 1LWYA 1K2YX 1KFIA 2IV9A 3OSEA 3BKQX 3TDHA 2FKFA 2OOXA 4EAKA 4EALA 5BMNA 4ROEB 4C7PA 1NH2A 1QNBA 2NOZA 4EAGA 1NGMA 1HU0A 2QRDA 4DULA 1FN7A 4D7QA 1PCMX 1YQRA 4ROCB 3IH7A 1KFQA 2YA3A 5EPCA 2PWWA 2JPIA 2QR1A 2QLVA 2MZ8A 3OLPA 1TUOA 3DPUA 3OC3C 2G30A 4EAJA 4WX8A 1KYDA 2V92A 3ASMA 1EBMA 3ULXA 1YQLA 1N3CA 1AISA 1KYFA 1P5GX 4TPSA 4B0AA 1M3HA 3D4VA 1QN6A 1QNAA 2NOFA 2LAEA 2JHJA 2O3OA 1LXTA 2IV8A 4I8OA 2HL8A 1TBAB 2EHBD 1QNCA 5BMPA 3RSMA 1DIZA 4MRQA 4BJUA 5KL0A 2F7LA 3C04A 1JDYA 3ENOC 1UT4A 2DKDA 2QRCA 1M3QA 1D3UA 2OOYA 3N89A 1VTOA 1T6AA 3D7QA 4EJYA 2MJ7A 4EAIA 1PCJX 2NLVA 1WQAA 1CDWA 1M5Q1 2NOIA 1P5DX 2HKPA 3OH9A 1K35A 1Q9UA 3OGDA 3I3WA 3T4NA 1VOLB 2NVMA 3CWTA 5IYBP 3NA5A 1N3AA 3KTUA 2D0CA 2JHNA 2R5XA 3KRMA 3OH6A 1QN7A 3RPJA 3SNSA 1RM1A 4RODB 1QN4A 2H4LX 1PVSA 4Q11A 1QN5A 1TGHA 3CW7A 1EUVA 2V8QA 5AN4A 1QN3A 3PMGA 2HZSA 1MP9A 1YTBA 2FGTA 3I0WA 1QTSA 2NOLA 1C9BB 3TE5A 3F0ZA 2NOBA 1V5SA 4D7RA 1YTFA 2H5AX 2V9JA 1LWWA 1VKLA 5IYDP 1R4XA 4CFFA 3CVTA 2XHIA 5IYCP 1VOKA 4WZSD 1QNEA 4PY5A 3CVSA 1TBPA 1C47A 1JFIC 1NVPA 4EJZA 1QN8A 3VN5A 2ZFDB 1VTLE 2DKAA 2Z0FA 3F10A 1E42A 1KO9A 3HS9A 2D0AA 5F9CA 2VJ0A 3CWSA 3CWAA 1KYUA 1WJWA 3HS8A 3PDKA 1PCZA 1PZDA 2QREA 2NOHA 1N39A 3UW2A 4QG5A 2Y8QA 5HSHA 2FKMX 2DKCA 4WXAA 3EIKA 1KY6A 2Y8LA 1XSZA 1YQKA 1KY7A 1QTPA 2JOIA 1C4GA 3OSMA 2D0BA 1J3MA 2YH5A 5JN5A 3OCIA 1UT7A 3H1ZA 1LWVA 1B9KA 3ENCA 4HJHA 3DPTA 1MPGA 2FUVA 1YQMA 3EAYA 2HL9A 2NWVA 4IL8A 1UL7A 1QN9A 2Z8UA 2I5WA 1W80A 3OSTA 3I0XA 5JMVD 2HZMA 2NOEA
chains in the Genus database with same CATH topology
1LWYA 2IV9A 4ROEB 1NH2A 2NOZA 1QNBA 1NGMA 1HU0A 4DULA 1FN7A 1YQRA 4ROCB 3IH7A 2MZ8A 3DPUA 3OC3C 2G30A 1KYDA 3ASMA 1EBMA 3ULXA 1YQLA 1N3CA 1AISA 1KYFA 4TPSA 4B0AA 1M3HA 1QN6A 1QNAA 2NOFA 2LAEA 2O3OA 2IV8A 4I8OA 1TBAB 1QNCA 1UT4A 1M3QA 1D3UA 3N89A 1VTOA 4EJYA 2MJ7A 1CDWA 2NOIA 1VOLB 5IYBP 1N3AA 3KTUA 2D0CA 1QN7A 3KRMA 3RPJA 3SNSA 1RM1A 4RODB 1QN4A 4Q11A 1QN5A 1TGHA 5AN4A 1QN3A 2HZSA 1MP9A 1YTBA 2FGTA 3I0WA 1QTSA 2NOLA 1C9BB 2NOBA 3F0ZA 1YTFA 1LWWA 5IYDP 1R4XA 2XHIA 5IYCP 1VOKA 4WZSD 1QNEA 4PY5A 1TBPA 1JFIC 1NVPA 4EJZA 1QN8A 3VN5A 1VTLE 3F10A 1E42A 1KO9A 3HS9A 2D0AA 2VJ0A 1KYUA 3HS8A 1PCZA 1PZDA 2NOHA 1N39A 3EIKA 1KY6A 1YQKA 1KY7A 1QTPA 2JOIA 3OSMA 2D0BA 2YH5A 3OCIA 1UT7A 3H1ZA 1LWVA 1B9KA 3DPTA 1YQMA 1QN9A 2Z8UA 1W80A 3OSTA 3I0XA 2I5WA 2HZMA 2NOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYF A;  3HS9 A;  4B0A A;  4ROD B;  1RM1 A;  1QN4 A;  2D0A A;  1QNA A;  1QN6 A;  2VJ0 A;  1KYU A;  3HS8 A;  1QN5 A;  1TGH A;  1PCZ A;  1PZD A;  2IV8 A;  2IV9 A;  4ROE B;  1TBA B;  1NH2 A;  1QNB A;  1QNC A;  1QN3 A;  1MP9 A;  1NGM A;  1QN7 A;  1YTB A;  1QTS A;  1C9B B;  3EIK A;  1KY6 A;  3ASM A;  1KY7 A;  1YTF A;  1D3U A;  1E42 A;  5IYD P;  1VTO A;  1QTP A;  1R4X A;  4ROC B;  2D0B A;  2MJ7 A;  1VOK A;  5IYC P;  3OCI A;  1CDW A;  3H1Z A;  4WZS D;  1B9K A;  1QNE A;  4PY5 A;  1TBP A;  1JFI C;  1QN9 A;  1NVP A;  1QN8 A;  2Z8U A;  3OC3 C;  2G30 A;  3VN5 A;  1VTL E;  1VOL B;  1KYD A;  5IYB P;  1W80 A;  2D0C A;  1AIS A; 
#chains in the Genus database with same CATH topology
 3CWU A;  1LWY A;  1K2Y X;  1KFI A;  2IV9 A;  3OSE A;  3BKQ X;  3TDH A;  2FKF A;  2OOX A;  4EAK A;  4EAL A;  5BMN A;  4ROE B;  4C7P A;  1NH2 A;  1QNB A;  2NOZ A;  4EAG A;  1NGM A;  1HU0 A;  2QRD A;  4DUL A;  1FN7 A;  4D7Q A;  1PCM X;  1YQR A;  4ROC B;  3IH7 A;  1KFQ A;  2YA3 A;  5EPC A;  2PWW A;  2JPI A;  2QR1 A;  2QLV A;  2MZ8 A;  3OLP A;  1TUO A;  3DPU A;  3OC3 C;  2G30 A;  4EAJ A;  4WX8 A;  1KYD A;  2V92 A;  3ASM A;  1EBM A;  3ULX A;  1YQL A;  1N3C A;  1AIS A;  1KYF A;  1P5G X;  4TPS A;  4B0A A;  1M3H A;  3D4V A;  1QN6 A;  1QNA A;  2NOF A;  2LAE A;  2JHJ A;  2O3O A;  1LXT A;  2IV8 A;  4I8O A;  2HL8 A;  1TBA B;  2EHB D;  1QNC A;  5BMP A;  3RSM A;  1DIZ A;  4MRQ A;  4BJU A;  5KL0 A;  2F7L A;  3C04 A;  1JDY A;  3ENO C;  1UT4 A;  2DKD A;  2QRC A;  1M3Q A;  1D3U A;  2OOY A;  3N89 A;  1VTO A;  1T6A A;  3D7Q A;  4EJY A;  2MJ7 A;  4EAI A;  1PCJ X;  2NLV A;  1WQA A;  1CDW A;  1M5Q 1;  2NOI A;  1P5D X;  2HKP A;  3OH9 A;  1K35 A;  1Q9U A;  3OGD A;  3I3W A;  3T4N A;  1VOL B;  2NVM A;  3CWT A;  5IYB P;  3NA5 A;  1N3A A;  3KTU A;  2D0C A;  2JHN A;  2R5X A;  3KRM A;  3OH6 A;  1QN7 A;  3RPJ A;  3SNS A;  1RM1 A;  4ROD B;  1QN4 A;  2H4L X;  1PVS A;  4Q11 A;  1QN5 A;  1TGH A;  3CW7 A;  1EUV A;  2V8Q A;  5AN4 A;  1QN3 A;  3PMG A;  2HZS A;  1MP9 A;  1YTB A;  2FGT A;  3I0W A;  1QTS A;  2NOL A;  1C9B B;  3TE5 A;  3F0Z A;  2NOB A;  1V5S A;  4D7R A;  1YTF A;  2H5A X;  2V9J A;  1LWW A;  1VKL A;  5IYD P;  1R4X A;  4CFF A;  3CVT A;  2XHI A;  5IYC P;  1VOK A;  4WZS D;  1QNE A;  4PY5 A;  3CVS A;  1TBP A;  1C47 A;  1JFI C;  1NVP A;  4EJZ A;  1QN8 A;  3VN5 A;  2ZFD B;  1VTL E;  2DKA A;  2Z0F A;  3F10 A;  1E42 A;  1KO9 A;  3HS9 A;  2D0A A;  5F9C A;  2VJ0 A;  3CWS A;  3CWA A;  1KYU A;  1WJW A;  3HS8 A;  3PDK A;  1PCZ A;  1PZD A;  2QRE A;  2NOH A;  1N39 A;  3UW2 A;  4QG5 A;  2Y8Q A;  5HSH A;  2FKM X;  2DKC A;  4WXA A;  3EIK A;  1KY6 A;  2Y8L A;  1XSZ A;  1YQK A;  1KY7 A;  1QTP A;  2JOI A;  1C4G A;  3OSM A;  2D0B A;  1J3M A;  2YH5 A;  5JN5 A;  3OCI A;  1UT7 A;  3H1Z A;  1LWV A;  1B9K A;  3ENC A;  4HJH A;  3DPT A;  1MPG A;  2FUV A;  1YQM A;  3EAY A;  2HL9 A;  2NWV A;  4IL8 A;  1UL7 A;  1QN9 A;  2Z8U A;  2I5W A;  1W80 A;  3OST A;  3I0X A;  5JMV D;  2HZM A;  2NOE A; 
#chains in the Genus database with same CATH homology
 1LWY A;  2IV9 A;  4ROE B;  1NH2 A;  2NOZ A;  1QNB A;  1NGM A;  1HU0 A;  4DUL A;  1FN7 A;  1YQR A;  4ROC B;  3IH7 A;  2MZ8 A;  3DPU A;  3OC3 C;  2G30 A;  1KYD A;  3ASM A;  1EBM A;  3ULX A;  1YQL A;  1N3C A;  1AIS A;  1KYF A;  4TPS A;  4B0A A;  1M3H A;  1QN6 A;  1QNA A;  2NOF A;  2LAE A;  2O3O A;  2IV8 A;  4I8O A;  1TBA B;  1QNC A;  1UT4 A;  1M3Q A;  1D3U A;  3N89 A;  1VTO A;  4EJY A;  2MJ7 A;  1CDW A;  2NOI A;  1VOL B;  5IYB P;  1N3A A;  3KTU A;  2D0C A;  1QN7 A;  3KRM A;  3RPJ A;  3SNS A;  1RM1 A;  4ROD B;  1QN4 A;  4Q11 A;  1QN5 A;  1TGH A;  5AN4 A;  1QN3 A;  2HZS A;  1MP9 A;  1YTB A;  2FGT A;  3I0W A;  1QTS A;  2NOL A;  1C9B B;  2NOB A;  3F0Z A;  1YTF A;  1LWW A;  5IYD P;  1R4X A;  2XHI A;  5IYC P;  1VOK A;  4WZS D;  1QNE A;  4PY5 A;  1TBP A;  1JFI C;  1NVP A;  4EJZ A;  1QN8 A;  3VN5 A;  1VTL E;  3F10 A;  1E42 A;  1KO9 A;  3HS9 A;  2D0A A;  2VJ0 A;  1KYU A;  3HS8 A;  1PCZ A;  1PZD A;  2NOH A;  1N39 A;  3EIK A;  1KY6 A;  1YQK A;  1KY7 A;  1QTP A;  2JOI A;  3OSM A;  2D0B A;  2YH5 A;  3OCI A;  1UT7 A;  3H1Z A;  1LWV A;  1B9K A;  3DPT A;  1YQM A;  1QN9 A;  2Z8U A;  1W80 A;  3OST A;  3I0X A;  2I5W A;  2HZM A;  2NOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...