1QNCA

Crystal structure of the a(-31) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qncA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qncA02
1QN7A 4ROCB 3OCIA 1KYUA 4RODB 3VN5A 1MP9A 1QN8A 2VJ0A 1VOKA 4B0AA 1YTBA 5IYBP 2Z8UA 1B9KA 1W80A 2D0BA 1QTPA 2D0CA 4WZSD 1AISA 1C9BB 1QN6A 1RM1A 2IV9A 1TGHA 5IYDP 1JFIC 1PZDA 1QNCA 1QN3A 1NH2A 2G30A 1PCZA 4ROEB 1KY6A 3HS9A 5IYCP 1NGMA 2IV8A 1KYFA 2D0AA 1KY7A 1E42A 1QTSA 1VTOA 3OC3C 4PY5A 2MJ7A 1QN5A 1TBPA 1QNAA 3ASMA 1CDWA 1KYDA 1VTLE 3HS8A 1QNBA 3EIKA 1QN9A 1TBAB 3H1ZA 1D3UA 1QN4A 1QNEA 1YTFA 1NVPA 1R4XA 1VOLB
chains in the Genus database with same CATH superfamily
2V8QA 1M3QA 1QN7A 4EJYA 1UL7A 1MP9A 2FKFA 5EPCA 1VOKA 3D4VA 2Z8UA 3I0WA 1C9BB 3CVTA 1LXTA 5IYDP 3CWSA 2DKAA 1JFIC 1PZDA 1PVSA 1XSZA 1QNCA 2NVMA 1PCMX 2G30A 1PCZA 3UW2A 3HS9A 1T6AA 2H5AX 2D0AA 3CWAA 5JN5A 1YQMA 2DKDA 4EALA 3I0XA 1VTOA 1UT7A 5KL0A 2ZFDB 3KRMA 1K2YX 2JHNA 4D7RA 1KO9A 1YQRA 3ASMA 1FN7A 4PY5A 1TUOA 4HJHA 1QNBA 2NWVA 1QN9A 1KFQA 2JOIA 2JPIA 2MZ8A 5F9CA 2FUVA 3EAYA 3F0ZA 3ENOC 2QRDA 2F7LA 4D7QA 1NVPA 1K35A 5AN4A 1VOLB 4TPSA 3DPUA 2QLVA 3DPTA 3OCIA 1KYUA 2NOLA 2HZMA 4RODB 3OSMA 3VN5A 3IH7A 1QN8A 1VKLA 2NOIA 2OOYA 4Q11A 1M3HA 1YTBA 3ENCA 3SNSA 5IYBP 2D0BA 2D0CA 4QG5A 2NOHA 1PCJX 3BKQX 3CWUA 2EHBD 3I3WA 2Z0FA 1WJWA 1NH2A 3RPJA 1C4GA 1NGMA 2I5WA 2NLVA 1KYFA 2PWWA 3OSTA 2QREA 1KY7A 1E42A 1EUVA 4WXAA 5BMPA 4DULA 2HL9A 4EAJA 2NOFA 3RSMA 2MJ7A 1QN5A 1TBPA 1DIZA 1QNAA 4I8OA 2O3OA 4BJUA 3TE5A 1LWWA 2R5XA 1TBAB 3H1ZA 1D3UA 2YA3A 1QN4A 1V5SA 2QRCA 1JDYA 3PMGA 2FGTA 2OOXA 4ROCB 3CVSA 4C7PA 2HZSA 2VJ0A 4B0AA 1HU0A 4IL8A 1AISA 1W80A 1QTPA 2QR1A 1UT4A 3PDKA 2HKPA 2IV9A 3OSEA 3OGDA 1EBMA 3NA5A 1LWVA 1QN3A 1KY6A 4EAGA 4EAKA 2XHIA 2IV8A 4CFFA 5JMVD 2DKCA 1YQKA 1C47A 3C04A 1N3CA 1N39A 2LAEA 3KTUA 2Y8QA 1VTLE 2NOBA 1J3MA 3HS8A 2NOZA 1P5DX 1LWYA 2V9JA 2HL8A 1YTFA 3ULXA 5BMNA 3N89A 1KFIA 3CW7A 5HSHA 2V92A 3CWTA 1YQLA 2FKMX 3T4NA 1N3AA 4EAIA 1QN6A 1B9KA 1M5Q1 1WQAA 4WX8A 4WZSD 1TGHA 1RM1A 2NOEA 3TDHA 1P5GX 4MRQA 4ROEB 5IYCP 1Q9UA 1QTSA 2YH5A 3OH6A 3OC3C 3F10A 2H4LX 1KYDA 2JHJA 2Y8LA 3D7QA 3OH9A 1CDWA 4EJZA 3OLPA 1MPGA 3EIKA 1QNEA 1R4XA
chains in the Genus database with same CATH topology
1M3QA 1QN7A 4EJYA 1MP9A 1VOKA 2Z8UA 3I0WA 1C9BB 5IYDP 1JFIC 1PZDA 1QNCA 2G30A 1PCZA 3HS9A 2D0AA 1YQMA 3I0XA 1VTOA 1UT7A 3KRMA 4PY5A 1KO9A 1YQRA 3ASMA 1FN7A 1QNBA 1QN9A 2JOIA 2MZ8A 3F0ZA 1NVPA 5AN4A 1VOLB 4TPSA 3DPUA 3DPTA 3OCIA 1KYUA 2NOLA 2HZMA 4RODB 3OSMA 3VN5A 3IH7A 1QN8A 2NOIA 4Q11A 1M3HA 1YTBA 3SNSA 5IYBP 2D0BA 2D0CA 2NOHA 1NH2A 3RPJA 1NGMA 2I5WA 1KYFA 3OSTA 1KY7A 1E42A 4DULA 2NOFA 2MJ7A 1QN5A 1TBPA 1QNAA 4I8OA 2O3OA 1LWWA 1TBAB 3H1ZA 1D3UA 1QN4A 2FGTA 4ROCB 2HZSA 2VJ0A 4B0AA 1HU0A 1AISA 1W80A 1QTPA 1UT4A 2IV9A 1EBMA 1QN3A 1LWVA 1KY6A 2XHIA 2IV8A 1YQKA 1N3CA 1N39A 2LAEA 3KTUA 1VTLE 2NOBA 3HS8A 2NOZA 1LWYA 1YTFA 3ULXA 3N89A 1YQLA 1N3AA 1QN6A 1B9KA 4WZSD 1TGHA 2NOEA 1RM1A 4ROEB 5IYCP 1QTSA 2YH5A 3OC3C 3F10A 1CDWA 1KYDA 4EJZA 3EIKA 1QNEA 1R4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN7 A;  4ROC B;  3OCI A;  1KYU A;  4ROD B;  3VN5 A;  1MP9 A;  1QN8 A;  2VJ0 A;  1VOK A;  4B0A A;  1YTB A;  5IYB P;  2Z8U A;  1B9K A;  1W80 A;  2D0B A;  1QTP A;  2D0C A;  4WZS D;  1AIS A;  1C9B B;  1QN6 A;  1RM1 A;  2IV9 A;  1TGH A;  5IYD P;  1JFI C;  1PZD A;  1QNC A;  1QN3 A;  1NH2 A;  2G30 A;  1PCZ A;  4ROE B;  1KY6 A;  3HS9 A;  5IYC P;  1NGM A;  2IV8 A;  1KYF A;  2D0A A;  1KY7 A;  1E42 A;  1QTS A;  1VTO A;  3OC3 C;  4PY5 A;  2MJ7 A;  1QN5 A;  1TBP A;  1QNA A;  3ASM A;  1CDW A;  1KYD A;  1VTL E;  3HS8 A;  1QNB A;  3EIK A;  1QN9 A;  1TBA B;  3H1Z A;  1D3U A;  1QN4 A;  1QNE A;  1YTF A;  1NVP A;  1R4X A;  1VOL B; 
#chains in the Genus database with same CATH topology
 2V8Q A;  1M3Q A;  1QN7 A;  4EJY A;  1UL7 A;  1MP9 A;  2FKF A;  5EPC A;  1VOK A;  3D4V A;  2Z8U A;  3I0W A;  1C9B B;  3CVT A;  1LXT A;  5IYD P;  3CWS A;  2DKA A;  1JFI C;  1PZD A;  1PVS A;  1XSZ A;  1QNC A;  2NVM A;  1PCM X;  2G30 A;  1PCZ A;  3UW2 A;  3HS9 A;  1T6A A;  2H5A X;  2D0A A;  3CWA A;  5JN5 A;  1YQM A;  2DKD A;  4EAL A;  3I0X A;  1VTO A;  1UT7 A;  5KL0 A;  2ZFD B;  3KRM A;  1K2Y X;  2JHN A;  4D7R A;  1KO9 A;  1YQR A;  3ASM A;  1FN7 A;  4PY5 A;  1TUO A;  4HJH A;  1QNB A;  2NWV A;  1QN9 A;  1KFQ A;  2JOI A;  2JPI A;  2MZ8 A;  5F9C A;  2FUV A;  3EAY A;  3F0Z A;  3ENO C;  2QRD A;  2F7L A;  4D7Q A;  1NVP A;  1K35 A;  5AN4 A;  1VOL B;  4TPS A;  3DPU A;  2QLV A;  3DPT A;  3OCI A;  1KYU A;  2NOL A;  2HZM A;  4ROD B;  3OSM A;  3VN5 A;  3IH7 A;  1QN8 A;  1VKL A;  2NOI A;  2OOY A;  4Q11 A;  1M3H A;  1YTB A;  3ENC A;  3SNS A;  5IYB P;  2D0B A;  2D0C A;  4QG5 A;  2NOH A;  1PCJ X;  3BKQ X;  3CWU A;  2EHB D;  3I3W A;  2Z0F A;  1WJW A;  1NH2 A;  3RPJ A;  1C4G A;  1NGM A;  2I5W A;  2NLV A;  1KYF A;  2PWW A;  3OST A;  2QRE A;  1KY7 A;  1E42 A;  1EUV A;  4WXA A;  5BMP A;  4DUL A;  2HL9 A;  4EAJ A;  2NOF A;  3RSM A;  2MJ7 A;  1QN5 A;  1TBP A;  1DIZ A;  1QNA A;  4I8O A;  2O3O A;  4BJU A;  3TE5 A;  1LWW A;  2R5X A;  1TBA B;  3H1Z A;  1D3U A;  2YA3 A;  1QN4 A;  1V5S A;  2QRC A;  1JDY A;  3PMG A;  2FGT A;  2OOX A;  4ROC B;  3CVS A;  4C7P A;  2HZS A;  2VJ0 A;  4B0A A;  1HU0 A;  4IL8 A;  1AIS A;  1W80 A;  1QTP A;  2QR1 A;  1UT4 A;  3PDK A;  2HKP A;  2IV9 A;  3OSE A;  3OGD A;  1EBM A;  3NA5 A;  1LWV A;  1QN3 A;  1KY6 A;  4EAG A;  4EAK A;  2XHI A;  2IV8 A;  4CFF A;  5JMV D;  2DKC A;  1YQK A;  1C47 A;  3C04 A;  1N3C A;  1N39 A;  2LAE A;  3KTU A;  2Y8Q A;  1VTL E;  2NOB A;  1J3M A;  3HS8 A;  2NOZ A;  1P5D X;  1LWY A;  2V9J A;  2HL8 A;  1YTF A;  3ULX A;  5BMN A;  3N89 A;  1KFI A;  3CW7 A;  5HSH A;  2V92 A;  3CWT A;  1YQL A;  2FKM X;  3T4N A;  1N3A A;  4EAI A;  1QN6 A;  1B9K A;  1M5Q 1;  1WQA A;  4WX8 A;  4WZS D;  1TGH A;  1RM1 A;  2NOE A;  3TDH A;  1P5G X;  4MRQ A;  4ROE B;  5IYC P;  1Q9U A;  1QTS A;  2YH5 A;  3OH6 A;  3OC3 C;  3F10 A;  2H4L X;  1KYD A;  2JHJ A;  2Y8L A;  3D7Q A;  3OH9 A;  1CDW A;  4EJZ A;  3OLP A;  1MPG A;  3EIK A;  1QNE A;  1R4X A; 
#chains in the Genus database with same CATH homology
 1M3Q A;  1QN7 A;  4EJY A;  1MP9 A;  1VOK A;  2Z8U A;  3I0W A;  1C9B B;  5IYD P;  1JFI C;  1PZD A;  1QNC A;  2G30 A;  1PCZ A;  3HS9 A;  2D0A A;  1YQM A;  3I0X A;  1VTO A;  1UT7 A;  3KRM A;  4PY5 A;  1KO9 A;  1YQR A;  3ASM A;  1FN7 A;  1QNB A;  1QN9 A;  2JOI A;  2MZ8 A;  3F0Z A;  1NVP A;  5AN4 A;  1VOL B;  4TPS A;  3DPU A;  3DPT A;  3OCI A;  1KYU A;  2NOL A;  2HZM A;  4ROD B;  3OSM A;  3VN5 A;  3IH7 A;  1QN8 A;  2NOI A;  4Q11 A;  1M3H A;  1YTB A;  3SNS A;  5IYB P;  2D0B A;  2D0C A;  2NOH A;  1NH2 A;  3RPJ A;  1NGM A;  2I5W A;  1KYF A;  3OST A;  1KY7 A;  1E42 A;  4DUL A;  2NOF A;  2MJ7 A;  1QN5 A;  1TBP A;  1QNA A;  4I8O A;  2O3O A;  1LWW A;  1TBA B;  3H1Z A;  1D3U A;  1QN4 A;  2FGT A;  4ROC B;  2HZS A;  2VJ0 A;  4B0A A;  1HU0 A;  1AIS A;  1W80 A;  1QTP A;  1UT4 A;  2IV9 A;  1EBM A;  1QN3 A;  1LWV A;  1KY6 A;  2XHI A;  2IV8 A;  1YQK A;  1N3C A;  1N39 A;  2LAE A;  3KTU A;  1VTL E;  2NOB A;  3HS8 A;  2NOZ A;  1LWY A;  1YTF A;  3ULX A;  3N89 A;  1YQL A;  1N3A A;  1QN6 A;  1B9K A;  4WZS D;  1TGH A;  2NOE A;  1RM1 A;  4ROE B;  5IYC P;  1QTS A;  2YH5 A;  3OC3 C;  3F10 A;  1CDW A;  1KYD A;  4EJZ A;  3EIK A;  1QNE A;  1R4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...