1QVFP

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvfP00
3CMEQ 1YI2Q 1M1KR 3CC4Q 1VQOQ 1KD1R 3CCUQ 1Q82R 3G4SQ 1VQMQ 1VQ5Q 1YJNQ 1VQLQ 3CCEQ 3CMAQ 3CXCP 1QVFP 3I56Q 3CCRQ 2OTLQ 3CCJQ 1VQ4Q 1VQNQ 1S72Q 1M90R 1KQSP 1VQ9Q 3CCLQ 3CCQQ 1YIJQ 1K73R 1KC8R 3CPWP 3CCSQ 3G6EQ 3CC7Q 1Q7YR 1K9MR 2QEXQ 3CCVQ 1VQPQ 1Q86R 1JJ2P 1K8AR 3I55Q 1YHQQ 1VQ6Q 1N8RR 1VQKQ 1NJIR 3CCMQ 2QA4Q 3OW2P 2OTJQ 1Q81R 3CC2Q 1YITQ 3G71Q 1QVGP 1YJWQ 1VQ8Q 1W2BP 3CD6Q 1VQ7Q 1YJ9Q
chains in the Genus database with same CATH superfamily
2XMFA 1K0XA 1XNIA 2AZSA 4HCKA 2K79A 3CCSQ 2BTTA 2KMTA 3CC7Q 1K9AA 3DLMA 3I55Q 1H3HA 3EH2A 2FB7A 4QT7A 3VYHB 3CCMA 3OYJA 1UGQB 3OYCA 3CCUQ 3CC4A 1LCKA 1WFWA 4N0AC 3M56A 4ZGJB 2MK5A 5FU6C 5GANg 5L8RE 1YI2T 3A8LB 5KYWA 2DTOA 2NLUA 4C92C 3MEWA 3L42A 4CC3A 3UF4A 2YSQA 2LCSA 3TSWA 1SHFA 4LDVA 3A8HB 1FMKA 4DA4A 1T0JA 2YLCA 2F5KA 4ZN3A 4JRKA 4OMOA 1D0XA 3PIPA 1V1CA 1WI7A 2EWNA 4HKEA 2M51A 1EZZB 2WSCE 2K9GA 1B7TA 2X4YA 2MF2A 1AZGB 5AT1B 3PGGA 3PMIA 3JCMV 5IN1A 1TU0B 1K4US 1SRLA 1MMNA 1TSFA 3L2QA 3EGDA 1OEBA 4OMQA 1Q82R 1BB9A 1H641 4WF2A 3CC2T 4UC4A 3QUIA 2L0AA 4E7IA 2DYIA 3VS5A 4PFOA 4N4HA 1U8RA 2VASA 2CSQA 4F7UE 3QO3A 1VOMA 1LOJA 3JB9H 4E7ZA 2YLBA 1X6OA 3A5ZB 5GAN8 1Y7XA 1VQ7A 4AG2C 4M77C 2C06A 2RMOA 2CH4A 3OMCA 4M7DC 3SWNC 1VQNA 1BU1A 1YFNA 2NUTA 4JLIA 2E41A 1ZBJA 2VV5A 3OS2A 2XD0A 2DFUA 5KYYA 1TS9A 4OMPA 1N8RU 1NEBA 1NM7A 1Q86C 3EG2A 3REAB 1UGPB 4M7AD 5GAN7 1YI2Q 1KQ2A 2DL7A 1PHTA 1RAHB 2CP5A 3EHQA 4BE2A 2DE0X 2L2PA 3O8VA 2V26A 2EIFA 2XG8D 1TWBA 2E5KA 1PRMC 3GF5A 1BI0A 3OYEA 4PFZA 2M1HA 4F7UA 3OY9A 5FLXE 5GANe 3G71A 5CKFA 1YJWA 2FZCB 3BFMA 2KI7A 3X25B 3NMZC 3IQLA 2P4RA 5CIUA 2LCCA 3CCEA 3CCJA 2D0NA 3S3NA 4ELYC 2CREA 2BUDA 2YUQA 1QCFA 2QGGA 1NBEB 5GAOl 1Q7YU 5GJWB 3HRSA 2EQMA 1W4SA 4FCYA 1X6GA 2E6NA 2E10A 3H0HA 2O2OA 3CC2Q 4DEXA 4C0FA 1AOJA 2ROTA 4NL3A 2V8KA 1VQKT 1VQOQ 2K3YA 3UPUA 1M2VB 3DLLA 2L3QA 3UA7A 2HKQB 4J8OA 2A0FB 3OS1A 2W0ZA 1BI1A 1M2OA 5KYNA 4J5YA 1A0NB 2KEAA 2O9VA 3HL8A 2JT4A 5LJ5h 1AZEA 4MMKA 4F04B 2LQKA 2VXEA 1KJWA 1CSKA 3MP1A 4C8QG 3PIOA 1M90R 4C8QE 1KC8U 3RDVA 5IXFA 1JRIA 2LJ1A 2KXCA 3U23A 1VQNT 5HK0A 3OS0A 3VV0A 1G2BA 1Q81R 1SSFA 1WJSA 2ZPFB 1PKTA 3NTHA 1ABOA 1QVFA 1C0MA 2HNIA 4ZGEB 4LE9A 1EFNA 2RPNA 2PUOB 2AIRB 2KT8A 1D1BA 5GANj 1AWOA 5GAMh 4C92G 4OP0A 4KH1B 2LJ3A 3ASKA 1UHCA 2CUBA 5GAN2 3E1SA 4E47A 2RHZA 2DA9A 1BBZA 4E7SA 1RAFB 4Y91A 4K11A 1MUZA 2DLPA 1VQMA 5FRNA 2O4XA 1AWWA 2DMOA 5LJ3f 2X3WD 4C8QA 1YNZA 2F2WA 2CZ6B 1QCOA 5LJ3g 4MDXA 3KBGA 1G3YA 3CCJT 2DETA 2RI5A 1VQKQ 2E70A 3JAME 2E4HA 2VYTA 4RTWA 2V1QA 2PUKB 4PKCC 5CR2A 3X26B 1FYNA 3P8BB 5AYFA 1OX8A 1SRMA 3A98A 2DL4A 5GJVB 5LJ3d 2F2XA 4N4IA 1VQ5T 2E12A 2KBTA 3A8OB 2GNCA 3ZL7C 4F7UF 2L3RA 4BDYA 1VQ6A 1UGSB 5CK9A 4X9DA 4M7AC 3JB9J 1KQSS 4M75C 1NG2A 2RQTA 2EKOA 2RB6A 1VIFA 5I11A 4M77G 1S1NA 2L5QA 4M77E 4QQ6A 3M0UA 5LJ5j 1VQNQ 1SPKA 1WDXA 3CD6T 2GGRA 3QDRB 4JRQA 3CCQA 5KYXB 5GMKm 2K3XA 4KGZB 2PVGB 1PSFA 1T3LA 3MEVA 5DLQE 4M78A 5FU7C 2CZ1B 2D1XA 2HDAA 1OZ3A 2X51A 4OB3B 4R56A 1D3BA 2VKNA 4F16A 1WGSA 3MCAB 2K6DA 2QQBA 2KK4A 3RKWA 3I9QA 1YJ9T 3JCMJ 2MPXC 2I0NA 1PCXA 3M0RA 2RK2A 1RAIB 3I56T 3CCSA 1I0CA 2DKGA 3CC7A 1K8AR 2V8JA 3J7AF 1GL5A 3I55A 1AWXA 1M3CA 2RJFA 2PVDB 5A0DA 1R77A 5D6YA 1MMDA 2KY9A 2QQAA 1SHGA 4RTZA 4JRPA 2OTJT 3CCJQ 3RERA 2PVOB 3JCMf 1Q82C 2F2VA 1PM3A 4X1VA 2P0PA 3OYKA 2FZKB 2HZYA 1NJIU 5KCOA 3CCLT 1SF9A 2CP2A 2CZ7B 2HSPA 3CBOA 3PTAA 1JJ2S 1VQ5Q 5LJ3e 2E5QA 2HAXA 1PRLC 4E6RA 3JCMd 5KYWB 3OBYA 2FRWA 2EGEA 2DXUA 2CUDA 2E64A 2K5FA 1Q95G 1AEYA 4ELZC 2D8JA 2MYSA 3VJPA 2CT3A 3HFNA 3OYDA 1ZLMA 4BI8B 3EGUA 3CD6Q 4IKFA 4XAXB 4GY5A 1GCQC 4C8QF 1RAGB 3OQ5A 1B3QA 2DYBA 2X9HA 3S3OA 1D1AA 1IRXA 5EC7A 1PC0A 1E6GA 2XI9A 1N8RR 2KYBA 1PG5B 1YN8A 2Y4XA 3EGDB 1YJ9Q 1WHLA 2EKHA 3QJYA 2QGFB 3VS2A 3VS1A 1QQJA 1U5SA 5GAOn 1WXTA 4ZN1A 2HBWA 2KAFA 3A8MB 4ZTJA 2DVEA 2KGTA 3URGA 1NE8A 3G7ZA 4D8KA 2OTJQ 4E2FB 1K1ZA 3JB9G 1Y57A 1OOTA 2PU9B 4ATOA 5KH6A 2GQVA 2EVRA 3CXCA 5D6WA 4ORZA 2NUTB 2CP6A 3CCLQ 2QQSA 5KYYB 3M54A 4M7DD 1Q7YR 4M78F 4Y92A 2RK1A 4J9IA 2JOYA 1MMAA 1OI1A 1AT1B 2ENMA 3L2UA 2ZGWA 4E7JA 5GAOr 2QTXA 3X24B 1JEGA 3NTKA 3VRYA 1RLPC 2JJ9A 3QYHB 2DTHA 1NYGA 3H41A 3I35A 4VUBA 1IO6A 3MP8A 2NUPA 4OMNA 3S6WA 1K73R 1WHJA 2QQ9A 1I5OB 2M02A 1ABQA 1M90C 1VQ6Q 4F7UB 4KRTA 3NFCA 4M7AG 4M75G 1IHWA 4M7AE 1KG1A 1YCSB 2L8DA 2RD1A 3CC2A 1WPYA 3QXEB 1Q81C 4J9FA 2RNAA 1KC8R 3GBQA 4F17A 1QVPA 4BI3A 1HJDA 2O88A 1WHMA 4DOWA 4CI0C 4J9BA 3TEEA 1ZQ1A 4D6WA 1YIJT 4N4GA 4Z8AA 1VQPT 2HQXA 2FG0A 3OYHA 1BYMA 1VQ8T 1T3SA 3OYNA 2LX9A 2GF7A 2ABLA 4JZ3A 3MEAA 2LZ6B 3GOXA 4WTOB 2DM1A 3EGXA 4BI4A 1TXQA 3FDRA 4IUVA 2MOXA 3META 4PK4A 2XDBA 1TUCA 3HRUA 3WVEB 3OW2P 3N5BB 1NPRA 1WQWA 1WIEA 3JSCA 1ZSZC 2IG0A 3LH0A 3OYBA 4WCIA 2EYWA 1ARKA 3CEYA 1U1TA 2ZPBB 3PVLA 1AWJA 4RTUA 4EMKA 1YJNA 5GANf 3C0CA 4DBHA 2EJFA 1D0ZA 3INZA 2HQHA 3EG0A 3QWXX 1KIKA 2H8HA 1MNDA 2MIOA 5ECAA 4DBQA 3V8KA 3P8DA 5J26A 5M9OA 4KULA 2D8HA 2KRSA 2EYQA 1XOVA 1LVKA 3M4YA 4RTXA 5GMKl 5GANd 3OYIA 5GAN6 2A3LA 2KDSA 3CMET 1WHHA 1UG1A 1M8VA 3F70A 5KCHA 1VQKA 4FYXB 2RM4A 1QVGP 3CCVT 3TVTA 1R8OB 1TOVA 1TTHB 2O9SA 3QJ6A 3EG9A 3JB9D 2IVWA 2RF0A 2O4XB 3OW2S 1F1BB 1KQSA 4C8QB 3LYIA 4XTVA 1YIJQ 3BE3A 4OGEA 1N5ZA 1Q86U 1VQPQ 3PVQA 5KYUA 4AFSC 2AKKA 1D1CA 2KT1A 2DRMA 3BW1A 1VQ8Q 1W2BP 1K8AC 4PJOD 5LJ5f 4C0ZA 3GIBA 2VXFA 5LJ5g 1BIAA 3OYGA 2V8IA 1WLPB 5GAN5 1VQ9A 4JPBW 1AVZC 2LNHB 4FSXA 3PMTA 3JCMc 2A7YA 2LQNA 2RJEA 1VQ4T 2MMPA 4PLLA 4HVWA 3RNJA 1NPPA 2NYSA 3CBPA 3G6ET 1QKXA 2JVVA 4J9DA 3QSUA 1X75C 1BI3A 4TVRA 5LJ5d 3RKYA 1P92A 1M1KR 4DOVA 4M75D 2JXBA 3FRNA 4FM4B 1GCQA 2PTKA 4RG2A 5GMKi 4OB0B 1QVGS 4XU1A 1PD0A 2JN0A 1YJNT 2DIQA 2A37A 2RJCA 3EFSA 5GAMg 1I8FA 4M78B 4XTXA 1NJIR 1D3BB 2M0YA 1V29B 3CMEQ 2LCLA 1V76A 1G3SA 1PD1A 3EG1A 2RQRA 4PJMA 4JS4A 4RCBA 3GPLA 2LTOA 3EHRA 1W2BS 1JJ2A 2KQWA 2HL5C 2BZXA 3MP6A 3JCMP 1GCPA 2EW3A 4BY6C 2C0IA 3E2UA 3RKXA 2FZGB 3SB2A 3ULRB 3M57A 2DBMA 1VQ5A 3REBB 5J39A 3L2RA 1KQ1A 5DY9A 4AFUC 3TU4K 1OULA 3JCMb 4BB7A 2OJ2A 5CAIA 5A0LA 2E65A 2A36A 3M4GA 4FYWB 1Y71A 2X4WA 1ZUYA 6AT1B 4FW1A 1M9SA 5I21A 5KE3A 3CD6A 1UECA 3PNWC 3J81E 3X28B 1E7OA 4GBQA 3LW5E 4A53A 3EFOA 1VQ4Q 1JO8A 5GMKh 3CPWA 1TUDA 1QW1A 3MJXA 3JCMQ 3G6EQ 2RI2A 2J06A 1HXDA 2GFAA 1VQ9T 4PJJA 5LJ5e 1Q7YC 2VUBA 1OZ2A 2EFIA 2ZZDA 2DZ9A 1YJ9A 4A4KA 1YJNQ 2LDMA 4RG8A 2E3IA 1YITT 3I56A 3HPWA 3OYLA 1QP3A 1K9MU 3MPUB 4E7KA 4C92E 1K73C 1S72T 4C5EA 4LNPA 2VC8A 2Y4YA 5FRMA 3UATA 2OTJA 4EIKA 1UTIA 5D6XA 1QMCA 3WXMB 4XTWA 3FEOA 2QYZA 5GAMe 4OGCA 2DJZA 2FO0A 2RH2A 3QWYA 1NZ9A 1G3TA 2LQWA 3CCLA 4JRIA 2RHXA 2P0KA 1KC8C 4X34A 1E6HA 2JM8A 1T0HA 4PJOC 1WNLA 4AG1C 4LDWA 1VYVA 2DEQA 1ZSZA 1X2KA 2BZ8A 2X4JA 1M3AA 4KH0B 4FSSA 2RN8A 4RTYA 4HCBA 7AT1B 2QI2A 3D7SB 1X01A 1PSEA 5CVIA 4N0AA 2HKNA 1XJWB 3JV3A 4BE0A 2PQWA 4X9CA 2KRMA 4C92A 1Y96B 4HVVA 4DQ2A 2L3PA 4Q5WA 4IUPA 5I2MA 3AHUA 2NUPB 4L5GA 1VQ9Q 5HKCA 4M7DG 2FVUA 4M7DE 2MWPA 1VQLT 2HEQA 1M30A 3LX7A 2JS0A 1M8MA 5FWBA 1YITQ 1KFZA 1G83A 2P4TA 4LDUA 1R0CB 5HCKA 4FL6A 4OVAA 4RKUE 3OYMA 2QDLA 2RQVA 2XU8A 4J9EA 1S72Q 2JM9A 1ZX6A 4JS5A 4OF1A 2LT1A 4RCCA 5IAYA 2YHTA 2EGCA 4Y28E 3P8HA 4C0DB 2VB6A 2DAQA 5GAMj 2K2VA 4PJNA 1KSWA 4MZTA 4Z89A 1VYTA 3Q1JA 3OYAA 1LJOA 5CKHA 1I5LA 4XU0A 3QZ5B 2GBQA 4LUDA 4OB1B 1QWFA 4M77A 3LGLA 4QVZA 3EGXB 3T9NA 4M7DA 3SWNA 1IGUA 5LL6S 3CCRT 2GTJA 1RABB 3DB3A 4J9CA 2XHCA 1BIBA 1IXDA 1LNXA 1K0SA 4EMKB 2YXYA 4YTLA 3J80E 2RQUA 2DL3A 2DJQA 8ATCB 1ZUKA 4MZPA 3PT9A 5LJ3h 4EMGA 2EYYA 3G4ST 4BUGA 1J3TA 2ZAEA 5A0GA 2OI3A 3OW2A 3LLRA 2YT6A 1MV3A 5FU7B 2DO3A 1K76A 1N6AA 3HP9A 4R55A 2D9TA 4AFZC 2DIGA 2NWMA 1M27C 1VQLQ 3RMQA 4JJNK 1IZ6A 4GLKA 1M1KC 2ED1A 4LDXA 1G5VA 2F5TX 4PJLA 1YIJA 2OTLT 4KGXB 3JCMW 4JZ4A 1C6VX 1VQPA 1QLYA 3H9NA 1OPLA 4ESRA 1O75A 2K5LA 1OYXA 2COWA 4LDYA 3EG9B 1QCNA 1VQ8A 1WXBA 2CS7A 2L89A 3I56Q 4XU2A 2G6FX 1N9RA 1D09B 1UGRB 2ZPEB 5CCAA 2Z0WA 4C92F 1GFDA 1SG5A 5KYUB 2BE9B 5L23A 1C1AA 1SEMA 3NPFA 2CP0A 4M78D 4JDSA 3E9GA 5KE2A 4XQ3A 4FYVB 5CKDA 3QYGB 1OU9A 4CC4B 1QWEA 2LVMA 2R58A 3CCRQ 1M90U 1LPLA 2D6FA 2DRKA 4LN2A 3BDLA 3X20B 3DB4A 3JB9I 3V7RA 3C95A 2X35A 5IHIA 4CRIA 2K5IA 3VYGA 4ANJA 4FW2A 3OYYA 4PJOG 1Q81U 4C5GA 1G3WA 2DNUA 3MKDA 4J6YA 1W2BA 4PJOE 2AZVA 4A4HA 3THKA 3H8ZA 2HSEB 1X69A 2X3XD 2M16A 1MMGA 1KD1U 3RUXA 5FW9A 3G4SQ 3CMEA 2QA4T 2ROLA 2B8AA 3NTIA 3JCMh 1FMVA 2X4XA 3GNFB 2KYMA 5D7UA 1UJYA 2FYKA 3CCUT 2WSFE 1H92A 3CMAT 4R0KA 4P5NA 3CCVA 3S3MA 3PFSA 5CQXA 4M75E 1U06A 4ZTFA 2ZPIB 4M77F 2SEMA 3I5SA 2OTLQ 4M7DF 1U3OA 1BKBA 3RIRA 2BKDN 3CPFA 2QTVA 2GFUA 1KHIA 2FEIA 1Z9QA 2GQIA 2EQUA 2MCNA 4PLIA 3UT1A 2JZ2A 4PJOA 3QKJA 1WQ7A 2YWWA 2FL7A 2CGHA 1B34A 5GAN3 4HCCA 3EAEA 2EYXA 1FMWA 1W6XA 2KSSA 1VQ4A 3HSBA 4EMHA 5IHNA 1K9MR 3G6EA 2LQ8A 4MZMA 5CKBA 3RR6A 2QEXT 2A28A 2J6OA 4M7AA 4M75A 1SSHA 1EX4A 3EFOB 2YRVA 2HBPA 1QKWA 3TCJA 4C8QC 1N9SA 2D0QB 3VKIA 9ATCB 1IHVA 5GAOq 2CZ0B 4DBRA 1WXUA 1JB0E 1RAEB 2H3JA 1VIEA 2QA4Q 3OBWA 4B9WA 3O5ZA 5J3BA 2E3HA 2P0QA 1ZBXA 4PFPA 4CC7A 2V1RA 2JS2A 2F1LA 2JTMA 4D8DA 4Z02A 1BCMA 3CMAQ 2HL3A 1W70A 2CT4A 4E7LA 3M0SA 1OQKA 4EDUA 4PL6A 1PWTA 2XDDA 1OV3A 2JW4A 1K8AU 2ED0A 2GTOA 2DILA 2KRNA 1ZHIA 3TREA 3GLXA 4KUDK 2DL8A 4II1A 3SHWA 3L2WA 1RI9A 1YCYA 2K3BA 5HY6A 2PNIA 3C94A 2F69A 3QHSA 1WZOA 2CDTA 2BZYA 1MHNA 2IIMA 3LGFA 2RO0A 3SDZA 3BDUA 4A4GA 1QP2A 2LC4A 3R6OA 3AT1B 3I5RA 5FROA 3CBMA 4QKUA 2DTIA 3L2ZA 4ZNXA 4FT4A 4M78C 2J7IA 4C0GA 1IREB 2YUOA 4HA8A 2EGAA 1ZSZB 3LH5A 4V2SA 5CKEA 4KT0E 3CXCP 3ZBDA 2K57A 3PE0A 2OAWA 2JTFA 5FU6B 1KHCA 1VQOT 2EJGA 3QIIA 3HTRA 4FU6A 2QEXQ 4C92B 2KNBB 4F7UG 1CKBA 1JXOA 4NS5A 1VUBA 2ZPHB 3HKSA 3JB9F 4E7HA 1NLPC 3V7SA 1YITA 1NLOC 4LD9K 1UUEA 3LWHA 4HXJA 1M4ZA 1JXMA 4BACA 3CQTA 2FPDA 4RTVA 1WYXA 1S72A 1PKSA 5IHKA 2FHDA 1X2QA 3QBYA 5GAMf 1MNEA 1Y0MA 3RBBB 3RESA 4PJOF 4FIBA 1YHQA 2AT1B 4OMLA 1KK7A 1IGQA 3G1JA 1RADB 1WA7A 3CCMT 2QQRA 1H8KA 5GANh 3M55A 3NHNA 1UHFA 1WX6A 3VS3A 1M5Q1 2AK5A 2YUPA 3TSZA 1SKUB 3CC4T 2DK3A 1IB8A 4JJDA 5GAMd 2ATCB 4ZGDB 3CCVQ 3CXCS 4M7AF 4BD3A 2CP7A 4M75F 3FIFA 2A08A 1N8RC 3DKMA 2EYZA 4LXCA 4FYYB 4HCZA 4HVUA 4JJCA 4M77B 3HFOA 1AHJB 3QG1A 3SWNB 3VU3C 4M7DB 1UE9A 2KR3A 3VRZA 4A4EA 1VYUA 3VS4A 1TUGB 1ZA2B 4J83A 4QVDA 1M3BA 3H0FA 1CKAA 4XTYA 2YDLA 1G8XA 4PNOA 3R6NA 3UA6A 1VQLA 1K73U 2BIVA 1R0BG 2K7AA 2LNVA 1RAAB 1GBRA 2H3EB 2DERA 3TQ7P 5FWCA 2IPOB 2KE9A 2JTEA 4MMLA 1I1JA 5GMKe 2YRDA 4LUEA 2K2MA 4C5IA 2EAYA 1I07A 1VQ7T 2RA2A 4AT1B 2DZCA 2JNGA 2EJ9A 2L3SA 3CCMQ 4BY6B 1DJ7B 2RI3A 3OYFA 1YHQT 1GXIE 3CC4Q 1KD1R 3HHTB 3FC3A 2EBPA 2EPDA 2QASA 1WJQA 2COYA 4KGVB 1KQSP 5A2QE 3CCRA 2CP3A 2FPEA 2MAMA 3JRZA 2O31A 1XTDA 4FT2A 2XIDA 2RHYA 2EQJA 5IXBA 1D0YA 4IUTA 1TH7A 2ESWA 1X6BA 2KROA 5GAN4 1U1SA 1RI0A 3RMSA 4LD6A 2J05A 5DLOA 4J6XA 2J6FA 2AKLA 2JMAA 3LWIA 2LJ0A 3QZ9B 2R57A 1YBYA 3G4SA 3G71T 1YJWT 3MO8A 2QXFA 1MV0B 4OB2B 2MI6A 3GNGA 3M59A 3CCET 4M78G 1AD5A 4C0DC 2AHJB 4M78E 2DXTA 1JBMA 1K9MC 1HK9A 2VVKA 1N27A 3WVDB 4HT9A 4IUQA 2DBKA 1RACB 1GBQA 2NUZA 3FB9A 1Y07A 4O5VA 2OTLA 2QK0A 3MHXA 1UDLA 1Z9ZA 5I22A 2LT4A 5GMKj 8AT1B 5HK3A 4J9GA 2DD4A 2BE7D 4DEYA 1VQ7Q 4J6WA 2DL5A 4EMKC 1B07A 1GRIA 1WHKA 2CYZB 5IH2A 1Q82U 2O01E 3E19A 2XKOC 2RHUA 2RQWA 1H3ZA 3M0QA 3EG3A 4CC2A 4ME7A 3E9FA 4NL2A 3FLGA 1JJ2P 2FPFA 1FXXA 3OSVA 4F14A 1YHQQ 4PJOB 1BK2A 5C0MA 3OMGA 3OS5A 4A54A 3M58A 3M0PA 3KFVA 1B34B 2GCXA 1UJ0A 4DBFA 3H0IA 2VGNA 4IIOA 3EFRA 4KBMB 2CKKA 2XK0A 5GAOp 3ME9A 3QDFA 3OA6A 2ZCFB 3UWNA 3FJ5A 1YWPA 1WHGA 2ECZA 1XQHA 1NYFA 3V7CA 4XU3A 4M7AB 2RHIA 3G71Q 2QA4A 4M75B 1YJWQ 4JLGA 1FX7A 1I81A 1UGVA 1M1KU 2OX7A 2PZ1A 4AFQC 3CCEQ 3CCUA 2EQIA 2KXDA 1M2VA 3CMAA 2KVQG 3KUFA 2Y90A 4IUUA 2XDPA 3CPWP 4O6JA 3JCMg 3UDCA 4C8QD 2E6ZA 2JUFA 4XK8E 1VQMT 1X43A 3OB9A 1HYOA 1Q86R 3M53A 4NOYA 1UB4A 1OU8A 1PNJA 1NEGA 4RUGA 2WACA 4B6MA 2R5MA 2HMAA 2YRCA 1QVFP 2VGMA 2QAZA 2EQKA 1RLQC 1BCOA 4HT8A 2LMJA 4JJBA 4L59A 2M9UA 2J6KA 3KXTA 4C92D 4M4ZA 4RMOA 1RL2A 3VS7A 4J7FA 4BE1A 2E1HA 2LRQA 4XTUA 1VQ6T 3ER0A 1NJIC 1YP5A 3A1PA 2K4YA 4J9HA 2HQEA 4AMCA 4QW2A 2DF6A 4B9XA 5I2SA 4QQDA 2G3RA 4A63B 1ZSGA 4Z88A 2QEXA 3ZEHA 3CCQT 1UEBA 3NGPA 4MDWA 1X27A 1QVGA 3H6ZA 3CPWS 5GAOm 1JQQA 2I2LA 3VS0A 3C12A 1RUWA 2JMCA 3ZFJA 1YWOA 1M1FA 2XICA 4XTZA 3BY7A 2M0OA 2DD5A 3SEMA 3L2VA 5CO7A 1OPKA 4OMFB 2WSEE 1ZA1B 5CQYA 1EIFA 4EPCA 3VS6A 1OX9A 2W10A 2CSIA 3M0TA 4QQGA 2DX1A 4GLMA 1QVFS 1MGQA 3HRTA 2HCKA 3CCST 2MWOA 3SFMA 3CC7T 4OMMA 4J7IA 2DEUA 1TG0A 1VA7A 3I55T 3JCMX 1YI2A 1UFFA 1VQMQ 4RTTA 2SRCA 2LX7A 3V8JA 3L1AA 4M77D 3A8GB 4A4FA 1ACMB 3VUBA 2B86A 5LJ3j 3C4SA 4BDZA 1W1FA 5EG2A 3MEUA 1Y96A 1HD3A 2RJDA 5DM7R 2OAUA 2QDYB 2DXBA 1FWZA 4L6V5 3JCMe 1JU5C 3M5AA 2ZPGB 4QVCA 3EH1A 2P84A 3M9QA 4KUIA 2LP5A 1O9SA 2YUNA 3GP8A 5C6SA 5KYXA 2DPPB 2HD0A 4C5HA 5IT9E 2C0TA 1BI2A 2R5AA 1HSQA 2QG9B 1WJRA 1VQOA 2COZA 4IURA 3QPHA 1M1GA 1GFCA 2CH4W 1I4K1 3CCQQ 1ZUUA 1KD1C 2VWFA 2C0OA 2DXCA 3VUZA 2DVJA 4JUVA 3SD4A 2FRYA 3V8LA 3OSSC 4IIMA 3FJPA
chains in the Genus database with same CATH topology
3CMEQ 1YI2Q 1M1KR 3CC4Q 1VQOQ 1KD1R 3CCUQ 1Q82R 3G4SQ 1VQMQ 1VQ5Q 1YJNQ 1VQLQ 3CCEQ 3CMAQ 3CXCP 1QVFP 3I56Q 3CCRQ 2OTLQ 3CCJQ 1VQ4Q 1VQNQ 1S72Q 1M90R 1KQSP 1VQ9Q 3CCLQ 3CCQQ 1YIJQ 1K73R 1KC8R 3CPWP 3CCSQ 3G6EQ 3CC7Q 1Q7YR 1K9MR 2QEXQ 3CCVQ 1VQPQ 1Q86R 1JJ2P 1K8AR 3I55Q 1YHQQ 1VQ6Q 1N8RR 1VQKQ 1NJIR 3CCMQ 2QA4Q 3OW2P 2OTJQ 1Q81R 3CC2Q 1YITQ 3G71Q 1QVGP 1YJWQ 1VQ8Q 1W2BP 3CD6Q 1VQ7Q 1YJ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Q;  1YI2 Q;  1M1K R;  3CC4 Q;  1VQO Q;  1KD1 R;  3CCU Q;  1Q82 R;  3G4S Q;  1VQM Q;  1VQ5 Q;  1YJN Q;  1VQL Q;  3CCE Q;  3CMA Q;  3CXC P;  1QVF P;  3I56 Q;  3CCR Q;  2OTL Q;  3CCJ Q;  1VQ4 Q;  1VQN Q;  1S72 Q;  1M90 R;  1KQS P;  1VQ9 Q;  3CCL Q;  3CCQ Q;  1YIJ Q;  1K73 R;  1KC8 R;  3CPW P;  3CCS Q;  3G6E Q;  3CC7 Q;  1Q7Y R;  1K9M R;  2QEX Q;  3CCV Q;  1VQP Q;  1Q86 R;  1JJ2 P;  1K8A R;  3I55 Q;  1YHQ Q;  1VQ6 Q;  1N8R R;  1VQK Q;  1NJI R;  3CCM Q;  2QA4 Q;  3OW2 P;  2OTJ Q;  1Q81 R;  3CC2 Q;  1YIT Q;  3G71 Q;  1QVG P;  1YJW Q;  1VQ8 Q;  1W2B P;  3CD6 Q;  1VQ7 Q;  1YJ9 Q; 
#chains in the Genus database with same CATH topology
 2XMF A;  1K0X A;  1XNI A;  2AZS A;  4HCK A;  2K79 A;  3CCS Q;  2BTT A;  2KMT A;  3CC7 Q;  1K9A A;  3DLM A;  3I55 Q;  1H3H A;  3EH2 A;  2FB7 A;  4QT7 A;  3VYH B;  3CCM A;  3OYJ A;  1UGQ B;  3OYC A;  3CCU Q;  3CC4 A;  1LCK A;  1WFW A;  4N0A C;  3M56 A;  4ZGJ B;  2MK5 A;  5FU6 C;  5GAN g;  5L8R E;  1YI2 T;  3A8L B;  5KYW A;  2DTO A;  2NLU A;  4C92 C;  3MEW A;  3L42 A;  4CC3 A;  3UF4 A;  2YSQ A;  2LCS A;  3TSW A;  1SHF A;  4LDV A;  3A8H B;  1FMK A;  4DA4 A;  1T0J A;  2YLC A;  2F5K A;  4ZN3 A;  4JRK A;  4OMO A;  1D0X A;  3PIP A;  1V1C A;  1WI7 A;  2EWN A;  4HKE A;  2M51 A;  1EZZ B;  2WSC E;  2K9G A;  1B7T A;  2X4Y A;  2MF2 A;  1AZG B;  5AT1 B;  3PGG A;  3PMI A;  3JCM V;  5IN1 A;  1TU0 B;  1K4U S;  1SRL A;  1MMN A;  1TSF A;  3L2Q A;  3EGD A;  1OEB A;  4OMQ A;  1Q82 R;  1BB9 A;  1H64 1;  4WF2 A;  3CC2 T;  4UC4 A;  3QUI A;  2L0A A;  4E7I A;  2DYI A;  3VS5 A;  4PFO A;  4N4H A;  1U8R A;  2VAS A;  2CSQ A;  4F7U E;  3QO3 A;  1VOM A;  1LOJ A;  3JB9 H;  4E7Z A;  2YLB A;  1X6O A;  3A5Z B;  5GAN 8;  1Y7X A;  1VQ7 A;  4AG2 C;  4M77 C;  2C06 A;  2RMO A;  2CH4 A;  3OMC A;  4M7D C;  3SWN C;  1VQN A;  1BU1 A;  1YFN A;  2NUT A;  4JLI A;  2E41 A;  1ZBJ A;  2VV5 A;  3OS2 A;  2XD0 A;  2DFU A;  5KYY A;  1TS9 A;  4OMP A;  1N8R U;  1NEB A;  1NM7 A;  1Q86 C;  3EG2 A;  3REA B;  1UGP B;  4M7A D;  5GAN 7;  1YI2 Q;  1KQ2 A;  2DL7 A;  1PHT A;  1RAH B;  2CP5 A;  3EHQ A;  4BE2 A;  2DE0 X;  2L2P A;  3O8V A;  2V26 A;  2EIF A;  2XG8 D;  1TWB A;  2E5K A;  1PRM C;  3GF5 A;  1BI0 A;  3OYE A;  4PFZ A;  2M1H A;  4F7U A;  3OY9 A;  5FLX E;  5GAN e;  3G71 A;  5CKF A;  1YJW A;  2FZC B;  3BFM A;  2KI7 A;  3X25 B;  3NMZ C;  3IQL A;  2P4R A;  5CIU A;  2LCC A;  3CCE A;  3CCJ A;  2D0N A;  3S3N A;  4ELY C;  2CRE A;  2BUD A;  2YUQ A;  1QCF A;  2QGG A;  1NBE B;  5GAO l;  1Q7Y U;  5GJW B;  3HRS A;  2EQM A;  1W4S A;  4FCY A;  1X6G A;  2E6N A;  2E10 A;  3H0H A;  2O2O A;  3CC2 Q;  4DEX A;  4C0F A;  1AOJ A;  2ROT A;  4NL3 A;  2V8K A;  1VQK T;  1VQO Q;  2K3Y A;  3UPU A;  1M2V B;  3DLL A;  2L3Q A;  3UA7 A;  2HKQ B;  4J8O A;  2A0F B;  3OS1 A;  2W0Z A;  1BI1 A;  1M2O A;  5KYN A;  4J5Y A;  1A0N B;  2KEA A;  2O9V A;  3HL8 A;  2JT4 A;  5LJ5 h;  1AZE A;  4MMK A;  4F04 B;  2LQK A;  2VXE A;  1KJW A;  1CSK A;  3MP1 A;  4C8Q G;  3PIO A;  1M90 R;  4C8Q E;  1KC8 U;  3RDV A;  5IXF A;  1JRI A;  2LJ1 A;  2KXC A;  3U23 A;  1VQN T;  5HK0 A;  3OS0 A;  3VV0 A;  1G2B A;  1Q81 R;  1SSF A;  1WJS A;  2ZPF B;  1PKT A;  3NTH A;  1ABO A;  1QVF A;  1C0M A;  2HNI A;  4ZGE B;  4LE9 A;  1EFN A;  2RPN A;  2PUO B;  2AIR B;  2KT8 A;  1D1B A;  5GAN j;  1AWO A;  5GAM h;  4C92 G;  4OP0 A;  4KH1 B;  2LJ3 A;  3ASK A;  1UHC A;  2CUB A;  5GAN 2;  3E1S A;  4E47 A;  2RHZ A;  2DA9 A;  1BBZ A;  4E7S A;  1RAF B;  4Y91 A;  4K11 A;  1MUZ A;  2DLP A;  1VQM A;  5FRN A;  2O4X A;  1AWW A;  2DMO A;  5LJ3 f;  2X3W D;  4C8Q A;  1YNZ A;  2F2W A;  2CZ6 B;  1QCO A;  5LJ3 g;  4MDX A;  3KBG A;  1G3Y A;  3CCJ T;  2DET A;  2RI5 A;  1VQK Q;  2E70 A;  3JAM E;  2E4H A;  2VYT A;  4RTW A;  2V1Q A;  2PUK B;  4PKC C;  5CR2 A;  3X26 B;  1FYN A;  3P8B B;  5AYF A;  1OX8 A;  1SRM A;  3A98 A;  2DL4 A;  5GJV B;  5LJ3 d;  2F2X A;  4N4I A;  1VQ5 T;  2E12 A;  2KBT A;  3A8O B;  2GNC A;  3ZL7 C;  4F7U F;  2L3R A;  4BDY A;  1VQ6 A;  1UGS B;  5CK9 A;  4X9D A;  4M7A C;  3JB9 J;  1KQS S;  4M75 C;  1NG2 A;  2RQT A;  2EKO A;  2RB6 A;  1VIF A;  5I11 A;  4M77 G;  1S1N A;  2L5Q A;  4M77 E;  4QQ6 A;  3M0U A;  5LJ5 j;  1VQN Q;  1SPK A;  1WDX A;  3CD6 T;  2GGR A;  3QDR B;  4JRQ A;  3CCQ A;  5KYX B;  5GMK m;  2K3X A;  4KGZ B;  2PVG B;  1PSF A;  1T3L A;  3MEV A;  5DLQ E;  4M78 A;  5FU7 C;  2CZ1 B;  2D1X A;  2HDA A;  1OZ3 A;  2X51 A;  4OB3 B;  4R56 A;  1D3B A;  2VKN A;  4F16 A;  1WGS A;  3MCA B;  2K6D A;  2QQB A;  2KK4 A;  3RKW A;  3I9Q A;  1YJ9 T;  3JCM J;  2MPX C;  2I0N A;  1PCX A;  3M0R A;  2RK2 A;  1RAI B;  3I56 T;  3CCS A;  1I0C A;  2DKG A;  3CC7 A;  1K8A R;  2V8J A;  3J7A F;  1GL5 A;  3I55 A;  1AWX A;  1M3C A;  2RJF A;  2PVD B;  5A0D A;  1R77 A;  5D6Y A;  1MMD A;  2KY9 A;  2QQA A;  1SHG A;  4RTZ A;  4JRP A;  2OTJ T;  3CCJ Q;  3RER A;  2PVO B;  3JCM f;  1Q82 C;  2F2V A;  1PM3 A;  4X1V A;  2P0P A;  3OYK A;  2FZK B;  2HZY A;  1NJI U;  5KCO A;  3CCL T;  1SF9 A;  2CP2 A;  2CZ7 B;  2HSP A;  3CBO A;  3PTA A;  1JJ2 S;  1VQ5 Q;  5LJ3 e;  2E5Q A;  2HAX A;  1PRL C;  4E6R A;  3JCM d;  5KYW B;  3OBY A;  2FRW A;  2EGE A;  2DXU A;  2CUD A;  2E64 A;  2K5F A;  1Q95 G;  1AEY A;  4ELZ C;  2D8J A;  2MYS A;  3VJP A;  2CT3 A;  3HFN A;  3OYD A;  1ZLM A;  4BI8 B;  3EGU A;  3CD6 Q;  4IKF A;  4XAX B;  4GY5 A;  1GCQ C;  4C8Q F;  1RAG B;  3OQ5 A;  1B3Q A;  2DYB A;  2X9H A;  3S3O A;  1D1A A;  1IRX A;  5EC7 A;  1PC0 A;  1E6G A;  2XI9 A;  1N8R R;  2KYB A;  1PG5 B;  1YN8 A;  2Y4X A;  3EGD B;  1YJ9 Q;  1WHL A;  2EKH A;  3QJY A;  2QGF B;  3VS2 A;  3VS1 A;  1QQJ A;  1U5S A;  5GAO n;  1WXT A;  4ZN1 A;  2HBW A;  2KAF A;  3A8M B;  4ZTJ A;  2DVE A;  2KGT A;  3URG A;  1NE8 A;  3G7Z A;  4D8K A;  2OTJ Q;  4E2F B;  1K1Z A;  3JB9 G;  1Y57 A;  1OOT A;  2PU9 B;  4ATO A;  5KH6 A;  2GQV A;  2EVR A;  3CXC A;  5D6W A;  4ORZ A;  2NUT B;  2CP6 A;  3CCL Q;  2QQS A;  5KYY B;  3M54 A;  4M7D D;  1Q7Y R;  4M78 F;  4Y92 A;  2RK1 A;  4J9I A;  2JOY A;  1MMA A;  1OI1 A;  1AT1 B;  2ENM A;  3L2U A;  2ZGW A;  4E7J A;  5GAO r;  2QTX A;  3X24 B;  1JEG A;  3NTK A;  3VRY A;  1RLP C;  2JJ9 A;  3QYH B;  2DTH A;  1NYG A;  3H41 A;  3I35 A;  4VUB A;  1IO6 A;  3MP8 A;  2NUP A;  4OMN A;  3S6W A;  1K73 R;  1WHJ A;  2QQ9 A;  1I5O B;  2M02 A;  1ABQ A;  1M90 C;  1VQ6 Q;  4F7U B;  4KRT A;  3NFC A;  4M7A G;  4M75 G;  1IHW A;  4M7A E;  1KG1 A;  1YCS B;  2L8D A;  2RD1 A;  3CC2 A;  1WPY A;  3QXE B;  1Q81 C;  4J9F A;  2RNA A;  1KC8 R;  3GBQ A;  4F17 A;  1QVP A;  4BI3 A;  1HJD A;  2O88 A;  1WHM A;  4DOW A;  4CI0 C;  4J9B A;  3TEE A;  1ZQ1 A;  4D6W A;  1YIJ T;  4N4G A;  4Z8A A;  1VQP T;  2HQX A;  2FG0 A;  3OYH A;  1BYM A;  1VQ8 T;  1T3S A;  3OYN A;  2LX9 A;  2GF7 A;  2ABL A;  4JZ3 A;  3MEA A;  2LZ6 B;  3GOX A;  4WTO B;  2DM1 A;  3EGX A;  4BI4 A;  1TXQ A;  3FDR A;  4IUV A;  2MOX A;  3MET A;  4PK4 A;  2XDB A;  1TUC A;  3HRU A;  3WVE B;  3OW2 P;  3N5B B;  1NPR A;  1WQW A;  1WIE A;  3JSC A;  1ZSZ C;  2IG0 A;  3LH0 A;  3OYB A;  4WCI A;  2EYW A;  1ARK A;  3CEY A;  1U1T A;  2ZPB B;  3PVL A;  1AWJ A;  4RTU A;  4EMK A;  1YJN A;  5GAN f;  3C0C A;  4DBH A;  2EJF A;  1D0Z A;  3INZ A;  2HQH A;  3EG0 A;  3QWX X;  1KIK A;  2H8H A;  1MND A;  2MIO A;  5ECA A;  4DBQ A;  3V8K A;  3P8D A;  5J26 A;  5M9O A;  4KUL A;  2D8H A;  2KRS A;  2EYQ A;  1XOV A;  1LVK A;  3M4Y A;  4RTX A;  5GMK l;  5GAN d;  3OYI A;  5GAN 6;  2A3L A;  2KDS A;  3CME T;  1WHH A;  1UG1 A;  1M8V A;  3F70 A;  5KCH A;  1VQK A;  4FYX B;  2RM4 A;  1QVG P;  3CCV T;  3TVT A;  1R8O B;  1TOV A;  1TTH B;  2O9S A;  3QJ6 A;  3EG9 A;  3JB9 D;  2IVW A;  2RF0 A;  2O4X B;  3OW2 S;  1F1B B;  1KQS A;  4C8Q B;  3LYI A;  4XTV A;  1YIJ Q;  3BE3 A;  4OGE A;  1N5Z A;  1Q86 U;  1VQP Q;  3PVQ A;  5KYU A;  4AFS C;  2AKK A;  1D1C A;  2KT1 A;  2DRM A;  3BW1 A;  1VQ8 Q;  1W2B P;  1K8A C;  4PJO D;  5LJ5 f;  4C0Z A;  3GIB A;  2VXF A;  5LJ5 g;  1BIA A;  3OYG A;  2V8I A;  1WLP B;  5GAN 5;  1VQ9 A;  4JPB W;  1AVZ C;  2LNH B;  4FSX A;  3PMT A;  3JCM c;  2A7Y A;  2LQN A;  2RJE A;  1VQ4 T;  2MMP A;  4PLL A;  4HVW A;  3RNJ A;  1NPP A;  2NYS A;  3CBP A;  3G6E T;  1QKX A;  2JVV A;  4J9D A;  3QSU A;  1X75 C;  1BI3 A;  4TVR A;  5LJ5 d;  3RKY A;  1P92 A;  1M1K R;  4DOV A;  4M75 D;  2JXB A;  3FRN A;  4FM4 B;  1GCQ A;  2PTK A;  4RG2 A;  5GMK i;  4OB0 B;  1QVG S;  4XU1 A;  1PD0 A;  2JN0 A;  1YJN T;  2DIQ A;  2A37 A;  2RJC A;  3EFS A;  5GAM g;  1I8F A;  4M78 B;  4XTX A;  1NJI R;  1D3B B;  2M0Y A;  1V29 B;  3CME Q;  2LCL A;  1V76 A;  1G3S A;  1PD1 A;  3EG1 A;  2RQR A;  4PJM A;  4JS4 A;  4RCB A;  3GPL A;  2LTO A;  3EHR A;  1W2B S;  1JJ2 A;  2KQW A;  2HL5 C;  2BZX A;  3MP6 A;  3JCM P;  1GCP A;  2EW3 A;  4BY6 C;  2C0I A;  3E2U A;  3RKX A;  2FZG B;  3SB2 A;  3ULR B;  3M57 A;  2DBM A;  1VQ5 A;  3REB B;  5J39 A;  3L2R A;  1KQ1 A;  5DY9 A;  4AFU C;  3TU4 K;  1OUL A;  3JCM b;  4BB7 A;  2OJ2 A;  5CAI A;  5A0L A;  2E65 A;  2A36 A;  3M4G A;  4FYW B;  1Y71 A;  2X4W A;  1ZUY A;  6AT1 B;  4FW1 A;  1M9S A;  5I21 A;  5KE3 A;  3CD6 A;  1UEC A;  3PNW C;  3J81 E;  3X28 B;  1E7O A;  4GBQ A;  3LW5 E;  4A53 A;  3EFO A;  1VQ4 Q;  1JO8 A;  5GMK h;  3CPW A;  1TUD A;  1QW1 A;  3MJX A;  3JCM Q;  3G6E Q;  2RI2 A;  2J06 A;  1HXD A;  2GFA A;  1VQ9 T;  4PJJ A;  5LJ5 e;  1Q7Y C;  2VUB A;  1OZ2 A;  2EFI A;  2ZZD A;  2DZ9 A;  1YJ9 A;  4A4K A;  1YJN Q;  2LDM A;  4RG8 A;  2E3I A;  1YIT T;  3I56 A;  3HPW A;  3OYL A;  1QP3 A;  1K9M U;  3MPU B;  4E7K A;  4C92 E;  1K73 C;  1S72 T;  4C5E A;  4LNP A;  2VC8 A;  2Y4Y A;  5FRM A;  3UAT A;  2OTJ A;  4EIK A;  1UTI A;  5D6X A;  1QMC A;  3WXM B;  4XTW A;  3FEO A;  2QYZ A;  5GAM e;  4OGC A;  2DJZ A;  2FO0 A;  2RH2 A;  3QWY A;  1NZ9 A;  1G3T A;  2LQW A;  3CCL A;  4JRI A;  2RHX A;  2P0K A;  1KC8 C;  4X34 A;  1E6H A;  2JM8 A;  1T0H A;  4PJO C;  1WNL A;  4AG1 C;  4LDW A;  1VYV A;  2DEQ A;  1ZSZ A;  1X2K A;  2BZ8 A;  2X4J A;  1M3A A;  4KH0 B;  4FSS A;  2RN8 A;  4RTY A;  4HCB A;  7AT1 B;  2QI2 A;  3D7S B;  1X01 A;  1PSE A;  5CVI A;  4N0A A;  2HKN A;  1XJW B;  3JV3 A;  4BE0 A;  2PQW A;  4X9C A;  2KRM A;  4C92 A;  1Y96 B;  4HVV A;  4DQ2 A;  2L3P A;  4Q5W A;  4IUP A;  5I2M A;  3AHU A;  2NUP B;  4L5G A;  1VQ9 Q;  5HKC A;  4M7D G;  2FVU A;  4M7D E;  2MWP A;  1VQL T;  2HEQ A;  1M30 A;  3LX7 A;  2JS0 A;  1M8M A;  5FWB A;  1YIT Q;  1KFZ A;  1G83 A;  2P4T A;  4LDU A;  1R0C B;  5HCK A;  4FL6 A;  4OVA A;  4RKU E;  3OYM A;  2QDL A;  2RQV A;  2XU8 A;  4J9E A;  1S72 Q;  2JM9 A;  1ZX6 A;  4JS5 A;  4OF1 A;  2LT1 A;  4RCC A;  5IAY A;  2YHT A;  2EGC A;  4Y28 E;  3P8H A;  4C0D B;  2VB6 A;  2DAQ A;  5GAM j;  2K2V A;  4PJN A;  1KSW A;  4MZT A;  4Z89 A;  1VYT A;  3Q1J A;  3OYA A;  1LJO A;  5CKH A;  1I5L A;  4XU0 A;  3QZ5 B;  2GBQ A;  4LUD A;  4OB1 B;  1QWF A;  4M77 A;  3LGL A;  4QVZ A;  3EGX B;  3T9N A;  4M7D A;  3SWN A;  1IGU A;  5LL6 S;  3CCR T;  2GTJ A;  1RAB B;  3DB3 A;  4J9C A;  2XHC A;  1BIB A;  1IXD A;  1LNX A;  1K0S A;  4EMK B;  2YXY A;  4YTL A;  3J80 E;  2RQU A;  2DL3 A;  2DJQ A;  8ATC B;  1ZUK A;  4MZP A;  3PT9 A;  5LJ3 h;  4EMG A;  2EYY A;  3G4S T;  4BUG A;  1J3T A;  2ZAE A;  5A0G A;  2OI3 A;  3OW2 A;  3LLR A;  2YT6 A;  1MV3 A;  5FU7 B;  2DO3 A;  1K76 A;  1N6A A;  3HP9 A;  4R55 A;  2D9T A;  4AFZ C;  2DIG A;  2NWM A;  1M27 C;  1VQL Q;  3RMQ A;  4JJN K;  1IZ6 A;  4GLK A;  1M1K C;  2ED1 A;  4LDX A;  1G5V A;  2F5T X;  4PJL A;  1YIJ A;  2OTL T;  4KGX B;  3JCM W;  4JZ4 A;  1C6V X;  1VQP A;  1QLY A;  3H9N A;  1OPL A;  4ESR A;  1O75 A;  2K5L A;  1OYX A;  2COW A;  4LDY A;  3EG9 B;  1QCN A;  1VQ8 A;  1WXB A;  2CS7 A;  2L89 A;  3I56 Q;  4XU2 A;  2G6F X;  1N9R A;  1D09 B;  1UGR B;  2ZPE B;  5CCA A;  2Z0W A;  4C92 F;  1GFD A;  1SG5 A;  5KYU B;  2BE9 B;  5L23 A;  1C1A A;  1SEM A;  3NPF A;  2CP0 A;  4M78 D;  4JDS A;  3E9G A;  5KE2 A;  4XQ3 A;  4FYV B;  5CKD A;  3QYG B;  1OU9 A;  4CC4 B;  1QWE A;  2LVM A;  2R58 A;  3CCR Q;  1M90 U;  1LPL A;  2D6F A;  2DRK A;  4LN2 A;  3BDL A;  3X20 B;  3DB4 A;  3JB9 I;  3V7R A;  3C95 A;  2X35 A;  5IHI A;  4CRI A;  2K5I A;  3VYG A;  4ANJ A;  4FW2 A;  3OYY A;  4PJO G;  1Q81 U;  4C5G A;  1G3W A;  2DNU A;  3MKD A;  4J6Y A;  1W2B A;  4PJO E;  2AZV A;  4A4H A;  3THK A;  3H8Z A;  2HSE B;  1X69 A;  2X3X D;  2M16 A;  1MMG A;  1KD1 U;  3RUX A;  5FW9 A;  3G4S Q;  3CME A;  2QA4 T;  2ROL A;  2B8A A;  3NTI A;  3JCM h;  1FMV A;  2X4X A;  3GNF B;  2KYM A;  5D7U A;  1UJY A;  2FYK A;  3CCU T;  2WSF E;  1H92 A;  3CMA T;  4R0K A;  4P5N A;  3CCV A;  3S3M A;  3PFS A;  5CQX A;  4M75 E;  1U06 A;  4ZTF A;  2ZPI B;  4M77 F;  2SEM A;  3I5S A;  2OTL Q;  4M7D F;  1U3O A;  1BKB A;  3RIR A;  2BKD N;  3CPF A;  2QTV A;  2GFU A;  1KHI A;  2FEI A;  1Z9Q A;  2GQI A;  2EQU A;  2MCN A;  4PLI A;  3UT1 A;  2JZ2 A;  4PJO A;  3QKJ A;  1WQ7 A;  2YWW A;  2FL7 A;  2CGH A;  1B34 A;  5GAN 3;  4HCC A;  3EAE A;  2EYX A;  1FMW A;  1W6X A;  2KSS A;  1VQ4 A;  3HSB A;  4EMH A;  5IHN A;  1K9M R;  3G6E A;  2LQ8 A;  4MZM A;  5CKB A;  3RR6 A;  2QEX T;  2A28 A;  2J6O A;  4M7A A;  4M75 A;  1SSH A;  1EX4 A;  3EFO B;  2YRV A;  2HBP A;  1QKW A;  3TCJ A;  4C8Q C;  1N9S A;  2D0Q B;  3VKI A;  9ATC B;  1IHV A;  5GAO q;  2CZ0 B;  4DBR A;  1WXU A;  1JB0 E;  1RAE B;  2H3J A;  1VIE A;  2QA4 Q;  3OBW A;  4B9W A;  3O5Z A;  5J3B A;  2E3H A;  2P0Q A;  1ZBX A;  4PFP A;  4CC7 A;  2V1R A;  2JS2 A;  2F1L A;  2JTM A;  4D8D A;  4Z02 A;  1BCM A;  3CMA Q;  2HL3 A;  1W70 A;  2CT4 A;  4E7L A;  3M0S A;  1OQK A;  4EDU A;  4PL6 A;  1PWT A;  2XDD A;  1OV3 A;  2JW4 A;  1K8A U;  2ED0 A;  2GTO A;  2DIL A;  2KRN A;  1ZHI A;  3TRE A;  3GLX A;  4KUD K;  2DL8 A;  4II1 A;  3SHW A;  3L2W A;  1RI9 A;  1YCY A;  2K3B A;  5HY6 A;  2PNI A;  3C94 A;  2F69 A;  3QHS A;  1WZO A;  2CDT A;  2BZY A;  1MHN A;  2IIM A;  3LGF A;  2RO0 A;  3SDZ A;  3BDU A;  4A4G A;  1QP2 A;  2LC4 A;  3R6O A;  3AT1 B;  3I5R A;  5FRO A;  3CBM A;  4QKU A;  2DTI A;  3L2Z A;  4ZNX A;  4FT4 A;  4M78 C;  2J7I A;  4C0G A;  1IRE B;  2YUO A;  4HA8 A;  2EGA A;  1ZSZ B;  3LH5 A;  4V2S A;  5CKE A;  4KT0 E;  3CXC P;  3ZBD A;  2K57 A;  3PE0 A;  2OAW A;  2JTF A;  5FU6 B;  1KHC A;  1VQO T;  2EJG A;  3QII A;  3HTR A;  4FU6 A;  2QEX Q;  4C92 B;  2KNB B;  4F7U G;  1CKB A;  1JXO A;  4NS5 A;  1VUB A;  2ZPH B;  3HKS A;  3JB9 F;  4E7H A;  1NLP C;  3V7S A;  1YIT A;  1NLO C;  4LD9 K;  1UUE A;  3LWH A;  4HXJ A;  1M4Z A;  1JXM A;  4BAC A;  3CQT A;  2FPD A;  4RTV A;  1WYX A;  1S72 A;  1PKS A;  5IHK A;  2FHD A;  1X2Q A;  3QBY A;  5GAM f;  1MNE A;  1Y0M A;  3RBB B;  3RES A;  4PJO F;  4FIB A;  1YHQ A;  2AT1 B;  4OML A;  1KK7 A;  1IGQ A;  3G1J A;  1RAD B;  1WA7 A;  3CCM T;  2QQR A;  1H8K A;  5GAN h;  3M55 A;  3NHN A;  1UHF A;  1WX6 A;  3VS3 A;  1M5Q 1;  2AK5 A;  2YUP A;  3TSZ A;  1SKU B;  3CC4 T;  2DK3 A;  1IB8 A;  4JJD A;  5GAM d;  2ATC B;  4ZGD B;  3CCV Q;  3CXC S;  4M7A F;  4BD3 A;  2CP7 A;  4M75 F;  3FIF A;  2A08 A;  1N8R C;  3DKM A;  2EYZ A;  4LXC A;  4FYY B;  4HCZ A;  4HVU A;  4JJC A;  4M77 B;  3HFO A;  1AHJ B;  3QG1 A;  3SWN B;  3VU3 C;  4M7D B;  1UE9 A;  2KR3 A;  3VRZ A;  4A4E A;  1VYU A;  3VS4 A;  1TUG B;  1ZA2 B;  4J83 A;  4QVD A;  1M3B A;  3H0F A;  1CKA A;  4XTY A;  2YDL A;  1G8X A;  4PNO A;  3R6N A;  3UA6 A;  1VQL A;  1K73 U;  2BIV A;  1R0B G;  2K7A A;  2LNV A;  1RAA B;  1GBR A;  2H3E B;  2DER A;  3TQ7 P;  5FWC A;  2IPO B;  2KE9 A;  2JTE A;  4MML A;  1I1J A;  5GMK e;  2YRD A;  4LUE A;  2K2M A;  4C5I A;  2EAY A;  1I07 A;  1VQ7 T;  2RA2 A;  4AT1 B;  2DZC A;  2JNG A;  2EJ9 A;  2L3S A;  3CCM Q;  4BY6 B;  1DJ7 B;  2RI3 A;  3OYF A;  1YHQ T;  1GXI E;  3CC4 Q;  1KD1 R;  3HHT B;  3FC3 A;  2EBP A;  2EPD A;  2QAS A;  1WJQ A;  2COY A;  4KGV B;  1KQS P;  5A2Q E;  3CCR A;  2CP3 A;  2FPE A;  2MAM A;  3JRZ A;  2O31 A;  1XTD A;  4FT2 A;  2XID A;  2RHY A;  2EQJ A;  5IXB A;  1D0Y A;  4IUT A;  1TH7 A;  2ESW A;  1X6B A;  2KRO A;  5GAN 4;  1U1S A;  1RI0 A;  3RMS A;  4LD6 A;  2J05 A;  5DLO A;  4J6X A;  2J6F A;  2AKL A;  2JMA A;  3LWI A;  2LJ0 A;  3QZ9 B;  2R57 A;  1YBY A;  3G4S A;  3G71 T;  1YJW T;  3MO8 A;  2QXF A;  1MV0 B;  4OB2 B;  2MI6 A;  3GNG A;  3M59 A;  3CCE T;  4M78 G;  1AD5 A;  4C0D C;  2AHJ B;  4M78 E;  2DXT A;  1JBM A;  1K9M C;  1HK9 A;  2VVK A;  1N27 A;  3WVD B;  4HT9 A;  4IUQ A;  2DBK A;  1RAC B;  1GBQ A;  2NUZ A;  3FB9 A;  1Y07 A;  4O5V A;  2OTL A;  2QK0 A;  3MHX A;  1UDL A;  1Z9Z A;  5I22 A;  2LT4 A;  5GMK j;  8AT1 B;  5HK3 A;  4J9G A;  2DD4 A;  2BE7 D;  4DEY A;  1VQ7 Q;  4J6W A;  2DL5 A;  4EMK C;  1B07 A;  1GRI A;  1WHK A;  2CYZ B;  5IH2 A;  1Q82 U;  2O01 E;  3E19 A;  2XKO C;  2RHU A;  2RQW A;  1H3Z A;  3M0Q A;  3EG3 A;  4CC2 A;  4ME7 A;  3E9F A;  4NL2 A;  3FLG A;  1JJ2 P;  2FPF A;  1FXX A;  3OSV A;  4F14 A;  1YHQ Q;  4PJO B;  1BK2 A;  5C0M A;  3OMG A;  3OS5 A;  4A54 A;  3M58 A;  3M0P A;  3KFV A;  1B34 B;  2GCX A;  1UJ0 A;  4DBF A;  3H0I A;  2VGN A;  4IIO A;  3EFR A;  4KBM B;  2CKK A;  2XK0 A;  5GAO p;  3ME9 A;  3QDF A;  3OA6 A;  2ZCF B;  3UWN A;  3FJ5 A;  1YWP A;  1WHG A;  2ECZ A;  1XQH A;  1NYF A;  3V7C A;  4XU3 A;  4M7A B;  2RHI A;  3G71 Q;  2QA4 A;  4M75 B;  1YJW Q;  4JLG A;  1FX7 A;  1I81 A;  1UGV A;  1M1K U;  2OX7 A;  2PZ1 A;  4AFQ C;  3CCE Q;  3CCU A;  2EQI A;  2KXD A;  1M2V A;  3CMA A;  2KVQ G;  3KUF A;  2Y90 A;  4IUU A;  2XDP A;  3CPW P;  4O6J A;  3JCM g;  3UDC A;  4C8Q D;  2E6Z A;  2JUF A;  4XK8 E;  1VQM T;  1X43 A;  3OB9 A;  1HYO A;  1Q86 R;  3M53 A;  4NOY A;  1UB4 A;  1OU8 A;  1PNJ A;  1NEG A;  4RUG A;  2WAC A;  4B6M A;  2R5M A;  2HMA A;  2YRC A;  1QVF P;  2VGM A;  2QAZ A;  2EQK A;  1RLQ C;  1BCO A;  4HT8 A;  2LMJ A;  4JJB A;  4L59 A;  2M9U A;  2J6K A;  3KXT A;  4C92 D;  4M4Z A;  4RMO A;  1RL2 A;  3VS7 A;  4J7F A;  4BE1 A;  2E1H A;  2LRQ A;  4XTU A;  1VQ6 T;  3ER0 A;  1NJI C;  1YP5 A;  3A1P A;  2K4Y A;  4J9H A;  2HQE A;  4AMC A;  4QW2 A;  2DF6 A;  4B9X A;  5I2S A;  4QQD A;  2G3R A;  4A63 B;  1ZSG A;  4Z88 A;  2QEX A;  3ZEH A;  3CCQ T;  1UEB A;  3NGP A;  4MDW A;  1X27 A;  1QVG A;  3H6Z A;  3CPW S;  5GAO m;  1JQQ A;  2I2L A;  3VS0 A;  3C12 A;  1RUW A;  2JMC A;  3ZFJ A;  1YWO A;  1M1F A;  2XIC A;  4XTZ A;  3BY7 A;  2M0O A;  2DD5 A;  3SEM A;  3L2V A;  5CO7 A;  1OPK A;  4OMF B;  2WSE E;  1ZA1 B;  5CQY A;  1EIF A;  4EPC A;  3VS6 A;  1OX9 A;  2W10 A;  2CSI A;  3M0T A;  4QQG A;  2DX1 A;  4GLM A;  1QVF S;  1MGQ A;  3HRT A;  2HCK A;  3CCS T;  2MWO A;  3SFM A;  3CC7 T;  4OMM A;  4J7I A;  2DEU A;  1TG0 A;  1VA7 A;  3I55 T;  3JCM X;  1YI2 A;  1UFF A;  1VQM Q;  4RTT A;  2SRC A;  2LX7 A;  3V8J A;  3L1A A;  4M77 D;  3A8G B;  4A4F A;  1ACM B;  3VUB A;  2B86 A;  5LJ3 j;  3C4S A;  4BDZ A;  1W1F A;  5EG2 A;  3MEU A;  1Y96 A;  1HD3 A;  2RJD A;  5DM7 R;  2OAU A;  2QDY B;  2DXB A;  1FWZ A;  4L6V 5;  3JCM e;  1JU5 C;  3M5A A;  2ZPG B;  4QVC A;  3EH1 A;  2P84 A;  3M9Q A;  4KUI A;  2LP5 A;  1O9S A;  2YUN A;  3GP8 A;  5C6S A;  5KYX A;  2DPP B;  2HD0 A;  4C5H A;  5IT9 E;  2C0T A;  1BI2 A;  2R5A A;  1HSQ A;  2QG9 B;  1WJR A;  1VQO A;  2COZ A;  4IUR A;  3QPH A;  1M1G A;  1GFC A;  2CH4 W;  1I4K 1;  3CCQ Q;  1ZUU A;  1KD1 C;  2VWF A;  2C0O A;  2DXC A;  3VUZ A;  2DVJ A;  4JUV A;  3SD4 A;  2FRY A;  3V8L A;  3OSS C;  4IIM A;  3FJP A; 
#chains in the Genus database with same CATH homology
 3CME Q;  1YI2 Q;  1M1K R;  3CC4 Q;  1VQO Q;  1KD1 R;  3CCU Q;  1Q82 R;  3G4S Q;  1VQM Q;  1VQ5 Q;  1YJN Q;  1VQL Q;  3CCE Q;  3CMA Q;  3CXC P;  1QVF P;  3I56 Q;  3CCR Q;  2OTL Q;  3CCJ Q;  1VQ4 Q;  1VQN Q;  1S72 Q;  1M90 R;  1KQS P;  1VQ9 Q;  3CCL Q;  3CCQ Q;  1YIJ Q;  1K73 R;  1KC8 R;  3CPW P;  3CCS Q;  3G6E Q;  3CC7 Q;  1Q7Y R;  1K9M R;  2QEX Q;  3CCV Q;  1VQP Q;  1Q86 R;  1JJ2 P;  1K8A R;  3I55 Q;  1YHQ Q;  1VQ6 Q;  1N8R R;  1VQK Q;  1NJI R;  3CCM Q;  2QA4 Q;  3OW2 P;  2OTJ Q;  1Q81 R;  3CC2 Q;  1YIT Q;  3G71 Q;  1QVG P;  1YJW Q;  1VQ8 Q;  1W2B P;  3CD6 Q;  1VQ7 Q;  1YJ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...