1QVGH

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
167
structure length
156
Chain Sequence
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 28
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1qvgH00
5GADN 5JVHJ 3CCMH 2ZJPJ 2ZJQJ 5JVGJ 3CD6H 1NJIJ 1VQ8H 2QEXH 1YHQH 3CC2H 3I56H 1WKIA 2ZJRJ 1VQPH 1VQLH 4WF9J 4WFNJ 1YI2H 4WFBJ 1VQ5H 1YJ9H 1VQ4H 1M90J 5GAHN 3CCVH 2PA2A 5H1SO 1S72H 4UY8M 5AN9F 3CC4H 1Q81J 1VQ6H 4U67J 1W2BH 1VQOH 4IO9J 1JJ2H 1VQKH 1N8RJ 3CCSH 4IOCJ 2OTJH 1Q82J 3CPWH 1VQ9H 3CXCH 3CMAH 3CCRH 1Q7YJ 4WFAJ 3G4SH 3CC7H 1VQ7H 1VQMH 1QVFH 1KD1J 1Y69K 1YIJH 3CCUH 3G71H 3CF5J 1KC8J 3PIPJ 5GAGN 2QA4H 3J7ZM 3CMEH 3CCQH 3OW2H 1YITH 1YJWH 3CCJH 3G6EH 1K9MJ 1KQSH 5MLCO 1VQNH 3CCLH 4IOAJ 4WCEJ 1K73J 3CCEH 1QVGH 5HL7J 1Q86J 1K8AJ 5DM6J 1M1KJ 2OTLH 5DM7J 1YJNH 3DLLJ 5GAEN 3I55H 3PIOJ
chains in the Genus database with same CATH superfamily
2B7NA 1FFUB 5GADN 5JVHJ 1UOUA 3CCMH 2ZJPJ 2ZJQJ 2W3RB 5JVGJ 3CD6H 4KWWA 1NJIJ 1NVJA 1VQ8H 2QEXH 1YHQH 3CC2H 1N5XA 4YYYA 4EADA 2Q5WE 1FO4A 4ZOHA 3I56H 1WKIA 1N63B 2ZJRJ 3NRZC 1VQPH 2WP4A 1QPQA 1VQLH 4WF9J 4WFNJ 1YI2H 2OMDA 4WFBJ 2QIEA 1VQ5H 5EY3A 1YJ9H 1VQ4H 1M90J 4US9A 4C7ZA 3EUB4 5GAHN 2PA2A 3CCVH 5H1SO 1SB3A 1QPRA 2W3SB 1S72H 4UY8M 4GA4A 2J0FA 5AN9F 3CC4H 1FM0E 3SR6C 5MPOC 1SIJA 1Q81J 1VQ6H 4U67J 1JROB 1W2BH 1VQOH 2B7QA 4IO9J 1QPNA 1JJ2H 1VQKH 1N8RJ 1N61B 2WK6A 3BIIE 3RPFA 5HULA 3CCSH 4IOCJ 2OTJH 1Q82J 3ETRC 3CPWH 1ZXIB 1VQ9H 3CXCH 3CMAH 2B7PA 3WO0A 3GNNA 3AMZA 3CCRH 2WK5A 1Q7YJ 5HUOA 2JBMA 1N60B 4WFAJ 3G4SH 3CC7H 1VQ7H 1VQMH 3WNZA 1QVFH 1KD1J 3NVVC 1Y69K 1FMAE 1YIJH 3H5QA 4X46A 3CCUH 3NS1C 1BRWA 3AN1A 5AYYA 3C2EA 3B9JC 1VDVA 3G71H 4XR5A 3C2OA 5AYZA 3CF5J 1KC8J 2I14A 4LHMA 1VLBA 3PIPJ 4AP8A 1JRPB 5GAGN 3NVZC 1FFVB 5EP8A 2QA4H 3J7ZM 5AYXA 4USAA 2DSJA 3AM9A 3CMEH 2E3TA 1N5WB 3CCQH 4C7YA 3OW2H 4YEKA 1WYGA 1AZYA 3C2RA 4KWVA 1YITH 1O4UA 1YJWH 1RM6A 3CCJH 3G6EH 1K9MJ 1KQSH 5MLCO 1VQNH 2TPTA 4EAFA 4C80A 1N62B 2W54B 3CCLH 2I1OA 1YTEA 1YTKA 1X1OA 3TQVA 1V97A 4US8A 1YTDA 3L0GA 3FC4A 1DGJA 1NVIE 4IOAJ 4GA5A 4WCEJ 1OTPA 4GA6A 1K73J 3CCEH 1QVGH 5HL7J 1Q86J 3PAJA 3WO1A 1QPOA 2W55B 3NVWC 3C2VA 5HUPA 1QAPA 1K8AJ 1FIQC 3L4PA 5DM6J 1M1KJ 2OTLH 3FAHA 5DM7J 3VMMA 4I9AA 1YJNH 3C2FA 3DLLJ 5GAEN 3NVYC 3I55H 3PIOJ
chains in the Genus database with same CATH topology
5GADN 5JVHJ 3CCMH 2ZJPJ 2ZJQJ 5JVGJ 3CD6H 1NJIJ 1VQ8H 2QEXH 1YHQH 3CC2H 3I56H 1WKIA 2ZJRJ 1VQPH 1VQLH 4WF9J 4WFNJ 1YI2H 4WFBJ 1VQ5H 1YJ9H 1VQ4H 1M90J 5GAHN 3CCVH 2PA2A 5H1SO 1S72H 4UY8M 5AN9F 3CC4H 1Q81J 1VQ6H 4U67J 1W2BH 1VQOH 4IO9J 1JJ2H 1VQKH 1N8RJ 3CCSH 4IOCJ 2OTJH 1Q82J 3CPWH 1VQ9H 3CXCH 3CMAH 3CCRH 1Q7YJ 4WFAJ 3G4SH 3CC7H 1VQ7H 1VQMH 1QVFH 1KD1J 1Y69K 1YIJH 3CCUH 3G71H 3CF5J 1KC8J 3PIPJ 5GAGN 2QA4H 3J7ZM 3CMEH 3CCQH 3OW2H 1YITH 1YJWH 3CCJH 3G6EH 1K9MJ 1KQSH 5MLCO 1VQNH 3CCLH 4IOAJ 4WCEJ 1K73J 3CCEH 1QVGH 5HL7J 1Q86J 1K8AJ 5DM6J 1M1KJ 2OTLH 5DM7J 1YJNH 3DLLJ 5GAEN 3I55H 3PIOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD N;  5JVH J;  3CCM H;  2ZJP J;  2ZJQ J;  5JVG J;  3CD6 H;  1NJI J;  1VQ8 H;  2QEX H;  1YHQ H;  3CC2 H;  3I56 H;  1WKI A;  2ZJR J;  1VQP H;  1VQL H;  4WF9 J;  4WFN J;  1YI2 H;  4WFB J;  1VQ5 H;  1YJ9 H;  1VQ4 H;  1M90 J;  5GAH N;  3CCV H;  2PA2 A;  5H1S O;  1S72 H;  4UY8 M;  5AN9 F;  3CC4 H;  1Q81 J;  1VQ6 H;  4U67 J;  1W2B H;  1VQO H;  4IO9 J;  1JJ2 H;  1VQK H;  1N8R J;  3CCS H;  4IOC J;  2OTJ H;  1Q82 J;  3CPW H;  1VQ9 H;  3CXC H;  3CMA H;  3CCR H;  1Q7Y J;  4WFA J;  3G4S H;  3CC7 H;  1VQ7 H;  1VQM H;  1QVF H;  1KD1 J;  1Y69 K;  1YIJ H;  3CCU H;  3G71 H;  3CF5 J;  1KC8 J;  3PIP J;  5GAG N;  2QA4 H;  3J7Z M;  3CME H;  3CCQ H;  3OW2 H;  1YIT H;  1YJW H;  3CCJ H;  3G6E H;  1K9M J;  1KQS H;  5MLC O;  1VQN H;  3CCL H;  4IOA J;  4WCE J;  1K73 J;  3CCE H;  1QVG H;  5HL7 J;  1Q86 J;  1K8A J;  5DM6 J;  1M1K J;  2OTL H;  5DM7 J;  1YJN H;  3DLL J;  5GAE N;  3I55 H;  3PIO J; 
#chains in the Genus database with same CATH topology
 2B7N A;  1FFU B;  5GAD N;  5JVH J;  1UOU A;  3CCM H;  2ZJP J;  2ZJQ J;  2W3R B;  5JVG J;  3CD6 H;  4KWW A;  1NJI J;  1NVJ A;  1VQ8 H;  2QEX H;  1YHQ H;  3CC2 H;  1N5X A;  4YYY A;  4EAD A;  2Q5W E;  1FO4 A;  4ZOH A;  3I56 H;  1WKI A;  1N63 B;  2ZJR J;  3NRZ C;  1VQP H;  2WP4 A;  1QPQ A;  1VQL H;  4WF9 J;  4WFN J;  1YI2 H;  2OMD A;  4WFB J;  2QIE A;  1VQ5 H;  5EY3 A;  1YJ9 H;  1VQ4 H;  1M90 J;  4US9 A;  4C7Z A;  3EUB 4;  5GAH N;  2PA2 A;  3CCV H;  5H1S O;  1SB3 A;  1QPR A;  2W3S B;  1S72 H;  4UY8 M;  4GA4 A;  2J0F A;  5AN9 F;  3CC4 H;  1FM0 E;  3SR6 C;  5MPO C;  1SIJ A;  1Q81 J;  1VQ6 H;  4U67 J;  1JRO B;  1W2B H;  1VQO H;  2B7Q A;  4IO9 J;  1QPN A;  1JJ2 H;  1VQK H;  1N8R J;  1N61 B;  2WK6 A;  3BII E;  3RPF A;  5HUL A;  3CCS H;  4IOC J;  2OTJ H;  1Q82 J;  3ETR C;  3CPW H;  1ZXI B;  1VQ9 H;  3CXC H;  3CMA H;  2B7P A;  3WO0 A;  3GNN A;  3AMZ A;  3CCR H;  2WK5 A;  1Q7Y J;  5HUO A;  2JBM A;  1N60 B;  4WFA J;  3G4S H;  3CC7 H;  1VQ7 H;  1VQM H;  3WNZ A;  1QVF H;  1KD1 J;  3NVV C;  1Y69 K;  1FMA E;  1YIJ H;  3H5Q A;  4X46 A;  3CCU H;  3NS1 C;  1BRW A;  3AN1 A;  5AYY A;  3C2E A;  3B9J C;  1VDV A;  3G71 H;  4XR5 A;  3C2O A;  5AYZ A;  3CF5 J;  1KC8 J;  2I14 A;  4LHM A;  1VLB A;  3PIP J;  4AP8 A;  1JRP B;  5GAG N;  3NVZ C;  1FFV B;  5EP8 A;  2QA4 H;  3J7Z M;  5AYX A;  4USA A;  2DSJ A;  3AM9 A;  3CME H;  2E3T A;  1N5W B;  3CCQ H;  4C7Y A;  3OW2 H;  4YEK A;  1WYG A;  1AZY A;  3C2R A;  4KWV A;  1YIT H;  1O4U A;  1YJW H;  1RM6 A;  3CCJ H;  3G6E H;  1K9M J;  1KQS H;  5MLC O;  1VQN H;  2TPT A;  4EAF A;  4C80 A;  1N62 B;  2W54 B;  3CCL H;  2I1O A;  1YTE A;  1YTK A;  1X1O A;  3TQV A;  1V97 A;  4US8 A;  1YTD A;  3L0G A;  3FC4 A;  1DGJ A;  1NVI E;  4IOA J;  4GA5 A;  4WCE J;  1OTP A;  4GA6 A;  1K73 J;  3CCE H;  1QVG H;  5HL7 J;  1Q86 J;  3PAJ A;  3WO1 A;  1QPO A;  2W55 B;  3NVW C;  3C2V A;  5HUP A;  1QAP A;  1K8A J;  1FIQ C;  3L4P A;  5DM6 J;  1M1K J;  2OTL H;  3FAH A;  5DM7 J;  3VMM A;  4I9A A;  1YJN H;  3C2F A;  3DLL J;  5GAE N;  3NVY C;  3I55 H;  3PIO J; 
#chains in the Genus database with same CATH homology
 5GAD N;  5JVH J;  3CCM H;  2ZJP J;  2ZJQ J;  5JVG J;  3CD6 H;  1NJI J;  1VQ8 H;  2QEX H;  1YHQ H;  3CC2 H;  3I56 H;  1WKI A;  2ZJR J;  1VQP H;  1VQL H;  4WF9 J;  4WFN J;  1YI2 H;  4WFB J;  1VQ5 H;  1YJ9 H;  1VQ4 H;  1M90 J;  5GAH N;  3CCV H;  2PA2 A;  5H1S O;  1S72 H;  4UY8 M;  5AN9 F;  3CC4 H;  1Q81 J;  1VQ6 H;  4U67 J;  1W2B H;  1VQO H;  4IO9 J;  1JJ2 H;  1VQK H;  1N8R J;  3CCS H;  4IOC J;  2OTJ H;  1Q82 J;  3CPW H;  1VQ9 H;  3CXC H;  3CMA H;  3CCR H;  1Q7Y J;  4WFA J;  3G4S H;  3CC7 H;  1VQ7 H;  1VQM H;  1QVF H;  1KD1 J;  1Y69 K;  1YIJ H;  3CCU H;  3G71 H;  3CF5 J;  1KC8 J;  3PIP J;  5GAG N;  2QA4 H;  3J7Z M;  3CME H;  3CCQ H;  3OW2 H;  1YIT H;  1YJW H;  3CCJ H;  3G6E H;  1K9M J;  1KQS H;  5MLC O;  1VQN H;  3CCL H;  4IOA J;  4WCE J;  1K73 J;  3CCE H;  1QVG H;  5HL7 J;  1Q86 J;  1K8A J;  5DM6 J;  1M1K J;  2OTL H;  5DM7 J;  1YJN H;  3DLL J;  5GAE N;  3I55 H;  3PIO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...