1QVGK

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 26
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1qvgK02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1qvgK01
1VQ9L 1VQMO 3CCQO 1K8AM 1VQ6L 1Q82P 3CCLL 3G4SL 3CCMO 1KQSK 1VQLO 3CCSL 2OTLO 2QA4L 1YJWO 1VQ8L 1VQKO 1N8RP 3CCRO 1VQ5L 1Q86M 1YIJO 2QEXL 3OW2K 1M90P 1S72O 1Q7YM 3CCJO 3CD6O 3CCVO 1YHQL 1QVFN 3CMAO 1YJNO 1YITO 1Q81P 3I56O 1K9MP 3CXCK 1VQPO 1VQ4L 1VQOL 2OTJL 1N8RM 1YJ9O 1VQNO 1K73P 1VQ9O 1NJIP 3CCLO 1JJ2K 3CC4L 3CC7O 1KC8M 3CC2L 3G6EO 1QVFK 1M1KP 1VQ7O 3I55L 2QA4O 1KD1P 3CCQL 2QEXO 3CCEO 1Q82M 3CCUO 1VQLL 3CMEL 1YHQO 1YI2L 1K73M 2OTLL 1NJIM 1VQKL 3G71L 3CCRL 1S72L 3CCJL 1M1KM 1M90M 1VQ6O 1KQSN 3CMAL 1KD1M 3G4SO 1QVGN 3CCSO 1Q81M 3CC4O 3CC2O 1VQ8O 1VQPL 3OW2N 1VQML 1VQ5O 3I55O 1K9MM 3CPWN 1VQNL 1YJ9L 3CCML 1W2BN 1YJWL 3CC7L 3G6EL 3CMEO 3CXCN 1QVGK 1YI2O 1VQ7L 1YIJL 1K8AP 3CD6L 3CCVL 3G71O 1VQ4O 1VQOO 2OTJO 3CCEL 1YJNL 1YITL 3CPWK 3CCUL 1KC8P 1JJ2N 3I56L 1Q86P 1W2BK 1Q7YP
chains in the Genus database with same CATH superfamily
1VQ9L 1VQMO 3CCQO 1K8AM 1VQ6L 1Q82P 3CCLL 3G4SL 3CCMO 5DLJA 1KQSK 1VQLO 4N06A 3CCSL 2OTLO 5DS6A 2QA4L 1YJWO 5DS5A 1VQ8L 4W8KA 1VQKO 1N8RP 3CCRO 1VQ5L 1Q86M 1YIJO 2QEXL 3OW2K 1M90P 1S72O 1Q7YM 3CCJO 3CD6O 3CCVO 1YHQL 1QVFN 3CMAO 3NKDA 1YJNO 1YITO 1Q81P 3I56O 4XTKA 1K9MP 3CXCK 1VQPO 5DQTA 1VQ4L 1VQOL 2OTJL 1N8RM 1YJ9O 1VQNO 1K73P 1VQ9O 1NJIP 3CCLO 1JJ2K 3CC4L 3CC7O 1KC8M 3CC2L 3G6EO 1QVFK 5FCLA 1M1KP 1VQ7O 3I55L 2QA4O 1KD1P 3GODA 3CCQL 2QEXO 3CCEO 1Q82M 3CCUO 1VQLL 3CMEL 1YHQO 1YI2L 1K73M 2OTLL 1NJIM 1VQKL 3G71L 3CCRL 1S72L 3CCJL 1M1KM 1M90M 1VQ6O 1KQSN 3CMAL 1KD1M 3G4SO 1QVGN 2YZSA 3CCSO 4P6IC 1Q81M 3CC4O 3CC2O 1VQ8O 1VQPL 3OW2N 1VQML 1VQ5O 3I55O 1K9MM 3CPWN 1VQNL 1YJ9L 3CCML 4QDLA 1W2BN 4WJ0A 1YJWL 3CC7L 3G6EL 3CMEO 3CXCN 1QVGK 1YI2O 1VQ7L 1YIJL 1K8AP 5DQZA 3CCVL 3CD6L 3G71O 1VQ4O 1VQOO 2OTJO 3CCEL 1YJNL 1YITL 3CPWK 5DS4A 3CCUL 1KC8P 1JJ2N 3I56L 1Q86P 1W2BK 1Q7YP
chains in the Genus database with same CATH topology
1VQ9L 1VQMO 3CCQO 1K8AM 1VQ6L 1Q82P 3CCLL 3G4SL 3CCMO 5DLJA 1KQSK 1VQLO 4N06A 3CCSL 2OTLO 5DS6A 2QA4L 1YJWO 5DS5A 1VQ8L 4W8KA 1VQKO 1N8RP 3CCRO 1VQ5L 1Q86M 1YIJO 2QEXL 3OW2K 1M90P 1S72O 1Q7YM 3CCJO 3CD6O 3CCVO 1YHQL 1QVFN 3CMAO 3NKDA 1YJNO 1YITO 1Q81P 3I56O 4XTKA 1K9MP 3CXCK 1VQPO 5DQTA 1VQ4L 1VQOL 2OTJL 1N8RM 1YJ9O 1VQNO 1K73P 1VQ9O 1NJIP 3CCLO 1JJ2K 3CC4L 3CC7O 1KC8M 3CC2L 3G6EO 1QVFK 5FCLA 1M1KP 1VQ7O 3I55L 2QA4O 1KD1P 3GODA 3CCQL 2QEXO 3CCEO 1Q82M 3CCUO 1VQLL 3CMEL 1YHQO 1YI2L 1K73M 2OTLL 1NJIM 1VQKL 3G71L 3CCRL 1S72L 3CCJL 1M1KM 1M90M 1VQ6O 1KQSN 3CMAL 1KD1M 3G4SO 1QVGN 2YZSA 3CCSO 4P6IC 1Q81M 3CC4O 3CC2O 1VQ8O 1VQPL 3OW2N 1VQML 1VQ5O 3I55O 1K9MM 3CPWN 1VQNL 1YJ9L 3CCML 4QDLA 1W2BN 4WJ0A 1YJWL 3CC7L 3G6EL 3CMEO 3CXCN 1QVGK 1YI2O 1VQ7L 1YIJL 1K8AP 5DQZA 3CCVL 3CD6L 3G71O 1VQ4O 1VQOO 2OTJO 3CCEL 1YJNL 1YITL 3CPWK 5DS4A 3CCUL 1KC8P 1JJ2N 3I56L 1Q86P 1W2BK 1Q7YP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 L;  1VQM O;  3CCQ O;  1K8A M;  1VQ6 L;  1Q82 P;  3CCL L;  3G4S L;  3CCM O;  1KQS K;  1VQL O;  3CCS L;  2OTL O;  2QA4 L;  1YJW O;  1VQ8 L;  1VQK O;  1N8R P;  3CCR O;  1VQ5 L;  1Q86 M;  1YIJ O;  2QEX L;  3OW2 K;  1M90 P;  1S72 O;  1Q7Y M;  3CCJ O;  3CD6 O;  3CCV O;  1YHQ L;  1QVF N;  3CMA O;  1YJN O;  1YIT O;  1Q81 P;  3I56 O;  1K9M P;  3CXC K;  1VQP O;  1VQ4 L;  1VQO L;  2OTJ L;  1N8R M;  1YJ9 O;  1VQN O;  1K73 P;  1VQ9 O;  1NJI P;  3CCL O;  1JJ2 K;  3CC4 L;  3CC7 O;  1KC8 M;  3CC2 L;  3G6E O;  1QVF K;  1M1K P;  1VQ7 O;  3I55 L;  2QA4 O;  1KD1 P;  3CCQ L;  2QEX O;  3CCE O;  1Q82 M;  3CCU O;  1VQL L;  3CME L;  1YHQ O;  1YI2 L;  1K73 M;  2OTL L;  1NJI M;  1VQK L;  3G71 L;  3CCR L;  1S72 L;  3CCJ L;  1M1K M;  1M90 M;  1VQ6 O;  1KQS N;  3CMA L;  1KD1 M;  3G4S O;  1QVG N;  3CCS O;  1Q81 M;  3CC4 O;  3CC2 O;  1VQ8 O;  1VQP L;  3OW2 N;  1VQM L;  1VQ5 O;  3I55 O;  1K9M M;  3CPW N;  1VQN L;  1YJ9 L;  3CCM L;  1W2B N;  1YJW L;  3CC7 L;  3G6E L;  3CME O;  3CXC N;  1QVG K;  1YI2 O;  1VQ7 L;  1YIJ L;  1K8A P;  3CD6 L;  3CCV L;  3G71 O;  1VQ4 O;  1VQO O;  2OTJ O;  3CCE L;  1YJN L;  1YIT L;  3CPW K;  3CCU L;  1KC8 P;  1JJ2 N;  3I56 L;  1Q86 P;  1W2B K;  1Q7Y P; 
#chains in the Genus database with same CATH topology
 1VQ9 L;  1VQM O;  3CCQ O;  1K8A M;  1VQ6 L;  1Q82 P;  3CCL L;  3G4S L;  3CCM O;  5DLJ A;  1KQS K;  1VQL O;  4N06 A;  3CCS L;  2OTL O;  5DS6 A;  2QA4 L;  1YJW O;  5DS5 A;  1VQ8 L;  4W8K A;  1VQK O;  1N8R P;  3CCR O;  1VQ5 L;  1Q86 M;  1YIJ O;  2QEX L;  3OW2 K;  1M90 P;  1S72 O;  1Q7Y M;  3CCJ O;  3CD6 O;  3CCV O;  1YHQ L;  1QVF N;  3CMA O;  3NKD A;  1YJN O;  1YIT O;  1Q81 P;  3I56 O;  4XTK A;  1K9M P;  3CXC K;  1VQP O;  5DQT A;  1VQ4 L;  1VQO L;  2OTJ L;  1N8R M;  1YJ9 O;  1VQN O;  1K73 P;  1VQ9 O;  1NJI P;  3CCL O;  1JJ2 K;  3CC4 L;  3CC7 O;  1KC8 M;  3CC2 L;  3G6E O;  1QVF K;  5FCL A;  1M1K P;  1VQ7 O;  3I55 L;  2QA4 O;  1KD1 P;  3GOD A;  3CCQ L;  2QEX O;  3CCE O;  1Q82 M;  3CCU O;  1VQL L;  3CME L;  1YHQ O;  1YI2 L;  1K73 M;  2OTL L;  1NJI M;  1VQK L;  3G71 L;  3CCR L;  1S72 L;  3CCJ L;  1M1K M;  1M90 M;  1VQ6 O;  1KQS N;  3CMA L;  1KD1 M;  3G4S O;  1QVG N;  2YZS A;  3CCS O;  4P6I C;  1Q81 M;  3CC4 O;  3CC2 O;  1VQ8 O;  1VQP L;  3OW2 N;  1VQM L;  1VQ5 O;  3I55 O;  1K9M M;  3CPW N;  1VQN L;  1YJ9 L;  3CCM L;  4QDL A;  1W2B N;  4WJ0 A;  1YJW L;  3CC7 L;  3G6E L;  3CME O;  3CXC N;  1QVG K;  1YI2 O;  1VQ7 L;  1YIJ L;  1K8A P;  5DQZ A;  3CCV L;  3CD6 L;  3G71 O;  1VQ4 O;  1VQO O;  2OTJ O;  3CCE L;  1YJN L;  1YIT L;  3CPW K;  5DS4 A;  3CCU L;  1KC8 P;  1JJ2 N;  3I56 L;  1Q86 P;  1W2B K;  1Q7Y P; 
#chains in the Genus database with same CATH homology
 1VQ9 L;  1VQM O;  3CCQ O;  1K8A M;  1VQ6 L;  1Q82 P;  3CCL L;  3G4S L;  3CCM O;  5DLJ A;  1KQS K;  1VQL O;  4N06 A;  3CCS L;  2OTL O;  5DS6 A;  2QA4 L;  1YJW O;  5DS5 A;  1VQ8 L;  4W8K A;  1VQK O;  1N8R P;  3CCR O;  1VQ5 L;  1Q86 M;  1YIJ O;  2QEX L;  3OW2 K;  1M90 P;  1S72 O;  1Q7Y M;  3CCJ O;  3CD6 O;  3CCV O;  1YHQ L;  1QVF N;  3CMA O;  3NKD A;  1YJN O;  1YIT O;  1Q81 P;  3I56 O;  4XTK A;  1K9M P;  3CXC K;  1VQP O;  5DQT A;  1VQ4 L;  1VQO L;  2OTJ L;  1N8R M;  1YJ9 O;  1VQN O;  1K73 P;  1VQ9 O;  1NJI P;  3CCL O;  1JJ2 K;  3CC4 L;  3CC7 O;  1KC8 M;  3CC2 L;  3G6E O;  1QVF K;  5FCL A;  1M1K P;  1VQ7 O;  3I55 L;  2QA4 O;  1KD1 P;  3GOD A;  3CCQ L;  2QEX O;  3CCE O;  1Q82 M;  3CCU O;  1VQL L;  3CME L;  1YHQ O;  1YI2 L;  1K73 M;  2OTL L;  1NJI M;  1VQK L;  3G71 L;  3CCR L;  1S72 L;  3CCJ L;  1M1K M;  1M90 M;  1VQ6 O;  1KQS N;  3CMA L;  1KD1 M;  3G4S O;  1QVG N;  2YZS A;  3CCS O;  4P6I C;  1Q81 M;  3CC4 O;  3CC2 O;  1VQ8 O;  1VQP L;  3OW2 N;  1VQM L;  1VQ5 O;  3I55 O;  1K9M M;  3CPW N;  1VQN L;  1YJ9 L;  3CCM L;  4QDL A;  1W2B N;  4WJ0 A;  1YJW L;  3CC7 L;  3G6E L;  3CME O;  3CXC N;  1QVG K;  1YI2 O;  1VQ7 L;  1YIJ L;  1K8A P;  5DQZ A;  3CCV L;  3CD6 L;  3G71 O;  1VQ4 O;  1VQO O;  2OTJ O;  3CCE L;  1YJN L;  1YIT L;  3CPW K;  5DS4 A;  3CCU L;  1KC8 P;  1JJ2 N;  3I56 L;  1Q86 P;  1W2B K;  1Q7Y P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...