1RLGA

Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
b'VPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 25-MER
publication title Molecular Basis of Box C/D RNA-Protein Interactions; Cocrystal Structure of Archaeal L7Ae and a Box C/D RNA.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural protein/rna
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1rlgA00
1RA4A 1Q82H 1QVGF 1E7KA 2JNBA 3MCAB 1VQ6F 3NVIB 3SIUA 2AIFA 5IT9M 5A2QM 3RA5A 3CCRF 3I56F 3PAFA 3CMEF 1VQ9F 1W2BF 1K9MH 3V7EA 3CXCF 2QI2A 1CK2A 5EO3A 1ZWZA 3CCVF 2QA4F 2OHWA 2VGMA 3ON1A 1PXWA 5GANK 1NMUB 1X52A 1KQSF 4X3MA 3CC2F 4LCKA 4NUTA 1VQ7F 5DCVA 1H7MA 1W3EX 3CCLF 5GIOC 3CCQF 3O85A 3OBWA 3LWPC 3CC4F 3SIVA 3CCUF 1K73H 2LBXA 3JCMM 5GAPK 1YHQF 1S72F 3NK7A 3V7QA 3G6EF 1VQ4F 1XBIA 3CCSF 5GIPC 2VGNA 3CCEF 4X3LA 2KTVA 2OTJF 2QEXF 3CD6F 1W42A 3HAXD 3CC7F 1YIJF 3OBYA 1VQKF 1VQMF 1RLGA 3LWQC 4BW0B 3VMFB 3WXMB 3CCMF 1VQNF 1CN7A 1YJNF 1NJIH 3CMAF 3CCJF 1K8AH 3JAMM 3IR9A 3FFMA 1VQ8F 1YJWF 5FLXM 3NK6A 3HJWC 1KC8H 1GZ0A 2HVYD 3N4YA 3J80M 3LFOA 4C4WC 1VQLF 3VI6A 5EWRA 2KTUA 1VQPF 5G4VC 1Q86H 2BO1A 1JJ2F 1GO1A 1IPAA 2ALEA 1DT9A 3E1YA 3LWRC 1VQ5F 2KG4A 1QVFF 3CPQA 1GO0A 3G4SF 3GYQA 1X7OA 2LBWA 3PLAC 1X7PA 3OW2F 1YJ9F 3CPWF 2CZWA 1W40A 3NMUC 4BY9D 3G71F 5G4UC 3NVKE 3CG6A 4TZZA 3J7AR 5FJ4C 1Q7YH 2FC3A 1Q81H 1KD1H 2OZBA 5GINC 3LWOC 3LWVC 2WALA 2I6DA 1W41A 3RA6A 3AGKA 1VQOF 3I55F 3E20B 2OTLF 1YITF 1M90H 1SDSA 1N8RH 3J81M 3N4ZA 1YI2F 1T0KB 1M1KH
chains in the Genus database with same CATH superfamily
1T0AA 1E7KA 5GONA 2JNBA 3MCAB 1FNJA 1IV3A 3SIUA 1RQ7A 4TV9B 1ONIA 4IHJA 1J7HA 5JVDB 3RYCB 2RHOA 4O4LA 2BTQB 1K9MH 3VOBA 1VQVA 2OHWA 3ON1A 3S06A 2HRYA 4EB6A 5CA0A 4X3MA 2H8CA 3C8LA 4G88A 1QAHA 5GIOC 4O4IA 3OONA 1W57A 3TD3A 4I55B 5CA1B 1YHQF 1S72F 3NK7A 1XBIA 1VH8A 3RYHA 1PF5A 3CCSF 2VGNA 4ZI7A 4ZHQA 4O4JA 3RYFB 3ZP7A 3QUWA 5IJ0B 2OTMA 2G9IA 1YIJF 2ZVYA 1VQKF 1VQMF 1H48A 2H8EA 3C9SA 3IMPA 5LXTB 3VMFB 1FFXA 1NJIH 5C8YA 4YJ3A 3CMAF 2UYNA 2VAPA 2IG8A 4X1KB 5JQGB 3JAMM 3CYQA 2UZHA 1U43A 1JFFB 3D00A 3JAKA 3N2KB 4O4HA 4I50A 1KC8H 2EWCA 3J80M 5EWRA 5EZYA 3VCZA 5ITZB 2R751 3HKDB 3DC2A 3GHZA 3RYIA 1TVKB 3K14A 2IAFA 1IPAA 3LWRC 1CLIA 1VQ5F 3HTNA 1GO0A 3G4SF 4X20A 1X7PA 3JATA 3CPWF 1W40A 4TZZA 1OAPA 1QD9A 2ZVZA 4TV9A 1NQ3A 2K1SA 4ERHA 1Q7YH 2FC3A 5KX5A 1KD1H 2OZBA 4G4YA 2VAWA 3D54A 5JVDA 3RYCA 3KE1A 2WALA 1TUBB 3RA6A 3AGKA 2HP0A 5MN6A 3E20B 1FNKA 1YITF 1H47A 1JN1A 1M90H 3K12A 1Z5WA 1W59A 5LP6B 1YI2F 3P4EA 4U3JB 1YQNA 4M8IA 4C8GA 4YJ2A 1QVGF 4I4TB 1W5BA 2W8BC 4G4VA 3HKBB 1KNKA 3QTYA 5HXZA 2GLZA 3WPXA 3CMEF 2PHNA 3CXCF 3I3FA 3RYFA 5MN5A 1PXWA 5IJ0A 1NMUB 4EI7A 3WGMA 3TD5A 4F6RA 2UYPA 2YYEA 3C9UA 4LCKA 3UT5B 5DCVA 1H7MA 3ERNA 3JARB 4B5CA 3CCQF 3K2XA 3O85A 3CYPB 3LWPC 3CC4F 3CCUF 2LBXA 5GAPK 2CHTA 3V7QA 2UYKA 4X1KA 4O2AB 3JALB 3MQWA 5GIPC 1JFFA 3LYBA 1W5AA 3MDOA 4X3LA 3ZP4A 3CC7F 4C8EA 3OBYA 1XV2A 4KWEA 3VOAA 5ITZA 5EYPB 3WXMB 1TVKA 4X1YB 4BT4A 5AVMA 5HWEA 1OFUA 2AIZP 5FNVB 1RLUA 2HS0A 3B6NA 3FFMA 1VQ8F 1IV1A 1YJWF 2L26A 2DT4A 3F0FA 5FLXM 3HJWC 3HKEB 3VYSC 5JCOC 5J2UB 2BTOA 3E22B 3ESJA 1TUBA 5G4VC 5LP6C 1GO1A 3IEWA 3E1YA 1X25A 4DRXB 1QVFF 5LP6A 3GYQA 4U3JA 1UI9A 3PLAC 1XRGA 4BVTA 3OW2F 1YJ9F 1IV2A 2CZWA 2HP3A 3Q8HA 4I4TA 3NMUC 3NVKE 2DYYA 3N2GA 3D01A 3WPWA 4B62A 2ZF8A 3HKBA 3V4DA 3MCQA 3FD6A 3IKEA 3LWVC 5LYJB 1FSZA 3WGKA 2Z1TA 2OTLF 2PMPA 2Z1EA 1SDSA 1N8RH 3J81M 3V3TA 5GONB 3VIUA 3FD5A 3VYTC 1U3PA 4R40B 2Q1XA 4ZK7A 3UT5A 4WBNB 2YXZA 4B46A 4BT2A 3JARA 4C82A 2AIFA 5IT9M 4DXDA 3EORA 3VYUC 5A2QM 2CSLA 3RA5A 3F6MA 2ZODA 2CWJA 5BMVB 3PAFA 1QU9A 1UFYA 2GVIA 2HS4A 1W2BF 3V7EA 2QI2A 3JALA 2BTUA 4EB6B 5EO3A 1ZWZA 2FGYA 3P10A 2VGMA 1X52A 5KMGB 3CC2F 5EYPA 3WGJA 3S0HA 4X1YA 3OBWA 3WGLA 3SIVA 3JCMM 4BVRA 4FFBB 3G6EF 4BT3A 4X1IB 3IEQA 3KHNA 4G4WA 4I55A 1IV4A 5CA1A 4TUYB 3T80A 5EIBC 3RE3A 3HKEA 2QEXF 4ZOLB 1W42A 3WJPA 1RLGA 3K0TA 3E22A 3LWQC 4BW0B 4YJ3B 3M1XA 1CN7A 5HP8A 4IIJB 4TV8B 3FPIA 1YJNF 5LXTA 1VHAA 1SA0B 4DRXA 2AMTA 1K8AH 3LDTA 3NK6A 3WJQA 5JQGA 3GTZA 1GZ0A 2CW4A 3N4YA 3N2KA 4C4WC 5J2TB 3VI6A 5JH7B 5HY2A 4RHAA 4PWTA 2KGWA 1JJ2F 5LYJA 2MQEA 4BT5A 2R6R1 4X20B 3HKCB 1DT9A 3M84A 3HKDA 4RQOA 2KG4A 3JATB 3IKFA 3KJJA 2HRUA 4G4ZA 2GZLA 3FBAA 2RHLA 1Z5VA 1JD1A 3L7QA 3QHDA 3JAWB 2RB9A 3S03A 4U39A 4WBNA 3S0WA 4HNAB 5IYZB 5KX5B 3I7TA 3J7AR 3R0PA 2HS3A 3C9RA 3S0YA 5CB4B 2HP0B 5LOVB 5BMVA 3LWOC 4O2BB 2I6DA 4BVSA 3TD4A 3M4SA 4BT7A 1VQOF 1SZQA 3I55F 3ELCA 4YJ2B 2HQSC 5JCOA 2VXYA 1JY8A 3N4ZA 5KMGA 4ZHYB 1M1KH 3VTIC 1RA4A 1Q82H 5HXUA 3JASB 1VQ6F 4ZHWA 1R1MA 2Z1UA 3JVHA 3U0OA 3NVIB 3F0EA 5IJ9B 1XHOA 3CCRF 3I56F 4C81A 4LNUB 3DDNA 4FFBA 1VQ9F 4X1IA 1CK2A 4TUYA 3CCVF 2QA4F 5LA6B 4F6RB 2VAMA 4ZOLA 2P6YA 5GANK 2HX0A 3S02A 1KQSF 3ZOPA 3F0DA 5EAZA 4NUTA 1U3LA 1VQ7F 2QTPA 1DBFA 1W5EA 1W3EX 2Q1YA 4BT6A 2NMUA 5EIBD 1RQ2A 3CCLF 5MN4A 4EI8A 4IIJA 4TV8A 1K73H 1SA0A 4IHJB 1VQ4F 4O4LB 1W5FA 2UYJA 3CCEF 2RHHA 2KTVA 2F9ZC 2OTJF 3F0GA 3LMEA 4O2AA 3KJKA 2LBTA 4EI9A 3CD6F 3HAXD 2CVLA 5CA0B 2IQQA 5J2TA 5JH7A 4XCQA 2ZAUA 3CCMF 4O4IB 1VQNF 3WGNA 2V9YA 3HKCA 1W581 4BVQA 3CCJF 3RYHB 3IR9A 3MBMA 4ZI7B 3BYQA 2B33A 5FNVA 4ZHQB 4O4JB 3JAWA 3VO8A 4HNAA 5IYZA 4B45A 4C8IA 2HVYD 1GX1A 3LFOA 1VQLF 2ZOVA 4ZHVA 3HWUA 5HY0A 5CB4A 1KNJA 5LOVA 2KTUA 2Z01A 5J2UA 4O2BA 1VQPF 1Q86H 2BO1A 2H6LA 1FFXB 1W55A 4G4XA 5HP7A 2ALEA 2LCAA 3CB2A 4E6EA 5C8YB 1Q8RA 2RHJA 5EB1B 3CPQA 2UYNB 5HY4A 1X7OA 4NWOB 2LBWA 2Z1FA 1U40A 5HY1A 3N2GB 3JAKB 3ZO8A 4O4HB 3JASA 5B8FA 5EB0A 3WJRA 4I50B 3G71F 4BY9D 5G4UC 3CG6A 1VK3A 5FJ4C 5IJ9A 1Q81H 5EZYB 5GINC 4LNUA 1YGYA 1W41A 3RYIB 3P0ZA 1COMA 3C9TA 1ODEA 2I6RA 4NQ3A 5LA6A 3KIZA 2CHSA 2N48A 1T0KB
chains in the Genus database with same CATH topology
1RA4A 1Q82H 1QVGF 5HXUA 1E7KA 2JNBA 3MCAB 1VQ6F 3NVIB 3SIUA 2AIFA 5IT9M 5A2QM 3RA5A 5HXZA 2GLZA 3CCRF 3I56F 3PAFA 3CMEF 1VQ9F 1W2BF 1K9MH 3V7EA 3CXCF 2QI2A 1CK2A 5EO3A 1ZWZA 2FGYA 3CCVF 2QA4F 2OHWA 2VGMA 3ON1A 1PXWA 5GANK 1NMUB 1X52A 1KQSF 4EI7A 4X3MA 3CC2F 4LCKA 4NUTA 1VQ7F 5DCVA 1H7MA 1W3EX 3CCLF 5GIOC 3CCQF 3O85A 3OBWA 4EI8A 3LWPC 3CC4F 3SIVA 3CCUF 1K73H 2LBXA 3JCMM 4BVRA 5GAPK 1YHQF 1S72F 3NK7A 3V7QA 3G6EF 1VQ4F 1XBIA 3CCSF 5GIPC 2VGNA 3CCEF 4X3LA 2KTVA 2F9ZC 2OTJF 2QEXF 4EI9A 3CD6F 1W42A 3HAXD 3CC7F 1YIJF 3OBYA 1VQKF 1VQMF 1RLGA 3LWQC 4XCQA 4BW0B 3VMFB 3WXMB 3CCMF 5HWEA 1VQNF 1CN7A 1YJNF 4BVQA 1NJIH 3CMAF 3CCJF 1K8AH 3JAMM 3IR9A 3D00A 3FFMA 1VQ8F 1YJWF 5FLXM 3NK6A 3HJWC 1KC8H 1GZ0A 2HVYD 3N4YA 3J80M 3LFOA 4C4WC 1VQLF 3VI6A 5HY0A 5HY2A 5EWRA 2KTUA 1VQPF 5G4VC 1Q86H 2BO1A 1JJ2F 1GO1A 3V3TA 1IPAA 2ALEA 1DT9A 3E1YA 3LWRC 1VQ5F 2KG4A 1QVFF 3CPQA 5HY4A 1GO0A 3G4SF 3GYQA 1X7OA 2LBWA 5HY1A 1X7PA 3PLAC 4BVTA 3OW2F 1YJ9F 3CPWF 2CZWA 1W40A 3NMUC 4BY9D 3G71F 5G4UC 3NVKE 3CG6A 4TZZA 3J7AR 5FJ4C 1Q7YH 2FC3A 1Q81H 1KD1H 2OZBA 5GINC 3LWOC 3LWVC 2WALA 2I6DA 1W41A 3RA6A 4BVSA 3AGKA 1VQOF 3I55F 3E20B 2OTLF 4NQ3A 1YITF 1M90H 1SDSA 1N8RH 3J81M 3N4ZA 1YI2F 1T0KB 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RA4 A;  1Q82 H;  1QVG F;  1E7K A;  2JNB A;  3MCA B;  1VQ6 F;  3NVI B;  3SIU A;  2AIF A;  5IT9 M;  5A2Q M;  3RA5 A;  3CCR F;  3I56 F;  3PAF A;  3CME F;  1VQ9 F;  1W2B F;  1K9M H;  3V7E A;  3CXC F;  2QI2 A;  1CK2 A;  5EO3 A;  1ZWZ A;  3CCV F;  2QA4 F;  2OHW A;  2VGM A;  3ON1 A;  1PXW A;  5GAN K;  1NMU B;  1X52 A;  1KQS F;  4X3M A;  3CC2 F;  4LCK A;  4NUT A;  1VQ7 F;  5DCV A;  1H7M A;  1W3E X;  3CCL F;  5GIO C;  3CCQ F;  3O85 A;  3OBW A;  3LWP C;  3CC4 F;  3SIV A;  3CCU F;  1K73 H;  2LBX A;  3JCM M;  5GAP K;  1YHQ F;  1S72 F;  3NK7 A;  3V7Q A;  3G6E F;  1VQ4 F;  1XBI A;  3CCS F;  5GIP C;  2VGN A;  3CCE F;  4X3L A;  2KTV A;  2OTJ F;  2QEX F;  3CD6 F;  1W42 A;  3HAX D;  3CC7 F;  1YIJ F;  3OBY A;  1VQK F;  1VQM F;  1RLG A;  3LWQ C;  4BW0 B;  3VMF B;  3WXM B;  3CCM F;  1VQN F;  1CN7 A;  1YJN F;  1NJI H;  3CMA F;  3CCJ F;  1K8A H;  3JAM M;  3IR9 A;  3FFM A;  1VQ8 F;  1YJW F;  5FLX M;  3NK6 A;  3HJW C;  1KC8 H;  1GZ0 A;  2HVY D;  3N4Y A;  3J80 M;  3LFO A;  4C4W C;  1VQL F;  3VI6 A;  5EWR A;  2KTU A;  1VQP F;  5G4V C;  1Q86 H;  2BO1 A;  1JJ2 F;  1GO1 A;  1IPA A;  2ALE A;  1DT9 A;  3E1Y A;  3LWR C;  1VQ5 F;  2KG4 A;  1QVF F;  3CPQ A;  1GO0 A;  3G4S F;  3GYQ A;  1X7O A;  2LBW A;  3PLA C;  1X7P A;  3OW2 F;  1YJ9 F;  3CPW F;  2CZW A;  1W40 A;  3NMU C;  4BY9 D;  3G71 F;  5G4U C;  3NVK E;  3CG6 A;  4TZZ A;  3J7A R;  5FJ4 C;  1Q7Y H;  2FC3 A;  1Q81 H;  1KD1 H;  2OZB A;  5GIN C;  3LWO C;  3LWV C;  2WAL A;  2I6D A;  1W41 A;  3RA6 A;  3AGK A;  1VQO F;  3I55 F;  3E20 B;  2OTL F;  1YIT F;  1M90 H;  1SDS A;  1N8R H;  3J81 M;  3N4Z A;  1YI2 F;  1T0K B;  1M1K H; 
#chains in the Genus database with same CATH topology
 1T0A A;  1E7K A;  5GON A;  2JNB A;  3MCA B;  1FNJ A;  1IV3 A;  3SIU A;  1RQ7 A;  4TV9 B;  1ONI A;  4IHJ A;  1J7H A;  5JVD B;  3RYC B;  2RHO A;  4O4L A;  2BTQ B;  1K9M H;  3VOB A;  1VQV A;  2OHW A;  3ON1 A;  3S06 A;  2HRY A;  4EB6 A;  5CA0 A;  4X3M A;  2H8C A;  3C8L A;  4G88 A;  1QAH A;  5GIO C;  4O4I A;  3OON A;  1W57 A;  3TD3 A;  4I55 B;  5CA1 B;  1YHQ F;  1S72 F;  3NK7 A;  1XBI A;  1VH8 A;  3RYH A;  1PF5 A;  3CCS F;  2VGN A;  4ZI7 A;  4ZHQ A;  4O4J A;  3RYF B;  3ZP7 A;  3QUW A;  5IJ0 B;  2OTM A;  2G9I A;  1YIJ F;  2ZVY A;  1VQK F;  1VQM F;  1H48 A;  2H8E A;  3C9S A;  3IMP A;  5LXT B;  3VMF B;  1FFX A;  1NJI H;  5C8Y A;  4YJ3 A;  3CMA F;  2UYN A;  2VAP A;  2IG8 A;  4X1K B;  5JQG B;  3JAM M;  3CYQ A;  2UZH A;  1U43 A;  1JFF B;  3D00 A;  3JAK A;  3N2K B;  4O4H A;  4I50 A;  1KC8 H;  2EWC A;  3J80 M;  5EWR A;  5EZY A;  3VCZ A;  5ITZ B;  2R75 1;  3HKD B;  3DC2 A;  3GHZ A;  3RYI A;  1TVK B;  3K14 A;  2IAF A;  1IPA A;  3LWR C;  1CLI A;  1VQ5 F;  3HTN A;  1GO0 A;  3G4S F;  4X20 A;  1X7P A;  3JAT A;  3CPW F;  1W40 A;  4TZZ A;  1OAP A;  1QD9 A;  2ZVZ A;  4TV9 A;  1NQ3 A;  2K1S A;  4ERH A;  1Q7Y H;  2FC3 A;  5KX5 A;  1KD1 H;  2OZB A;  4G4Y A;  2VAW A;  3D54 A;  5JVD A;  3RYC A;  3KE1 A;  2WAL A;  1TUB B;  3RA6 A;  3AGK A;  2HP0 A;  5MN6 A;  3E20 B;  1FNK A;  1YIT F;  1H47 A;  1JN1 A;  1M90 H;  3K12 A;  1Z5W A;  1W59 A;  5LP6 B;  1YI2 F;  3P4E A;  4U3J B;  1YQN A;  4M8I A;  4C8G A;  4YJ2 A;  1QVG F;  4I4T B;  1W5B A;  2W8B C;  4G4V A;  3HKB B;  1KNK A;  3QTY A;  5HXZ A;  2GLZ A;  3WPX A;  3CME F;  2PHN A;  3CXC F;  3I3F A;  3RYF A;  5MN5 A;  1PXW A;  5IJ0 A;  1NMU B;  4EI7 A;  3WGM A;  3TD5 A;  4F6R A;  2UYP A;  2YYE A;  3C9U A;  4LCK A;  3UT5 B;  5DCV A;  1H7M A;  3ERN A;  3JAR B;  4B5C A;  3CCQ F;  3K2X A;  3O85 A;  3CYP B;  3LWP C;  3CC4 F;  3CCU F;  2LBX A;  5GAP K;  2CHT A;  3V7Q A;  2UYK A;  4X1K A;  4O2A B;  3JAL B;  3MQW A;  5GIP C;  1JFF A;  3LYB A;  1W5A A;  3MDO A;  4X3L A;  3ZP4 A;  3CC7 F;  4C8E A;  3OBY A;  1XV2 A;  4KWE A;  3VOA A;  5ITZ A;  5EYP B;  3WXM B;  1TVK A;  4X1Y B;  4BT4 A;  5AVM A;  5HWE A;  1OFU A;  2AIZ P;  5FNV B;  1RLU A;  2HS0 A;  3B6N A;  3FFM A;  1VQ8 F;  1IV1 A;  1YJW F;  2L26 A;  2DT4 A;  3F0F A;  5FLX M;  3HJW C;  3HKE B;  3VYS C;  5JCO C;  5J2U B;  2BTO A;  3E22 B;  3ESJ A;  1TUB A;  5G4V C;  5LP6 C;  1GO1 A;  3IEW A;  3E1Y A;  1X25 A;  4DRX B;  1QVF F;  5LP6 A;  3GYQ A;  4U3J A;  1UI9 A;  3PLA C;  1XRG A;  4BVT A;  3OW2 F;  1YJ9 F;  1IV2 A;  2CZW A;  2HP3 A;  3Q8H A;  4I4T A;  3NMU C;  3NVK E;  2DYY A;  3N2G A;  3D01 A;  3WPW A;  4B62 A;  2ZF8 A;  3HKB A;  3V4D A;  3MCQ A;  3FD6 A;  3IKE A;  3LWV C;  5LYJ B;  1FSZ A;  3WGK A;  2Z1T A;  2OTL F;  2PMP A;  2Z1E A;  1SDS A;  1N8R H;  3J81 M;  3V3T A;  5GON B;  3VIU A;  3FD5 A;  3VYT C;  1U3P A;  4R40 B;  2Q1X A;  4ZK7 A;  3UT5 A;  4WBN B;  2YXZ A;  4B46 A;  4BT2 A;  3JAR A;  4C82 A;  2AIF A;  5IT9 M;  4DXD A;  3EOR A;  3VYU C;  5A2Q M;  2CSL A;  3RA5 A;  3F6M A;  2ZOD A;  2CWJ A;  5BMV B;  3PAF A;  1QU9 A;  1UFY A;  2GVI A;  2HS4 A;  1W2B F;  3V7E A;  2QI2 A;  3JAL A;  2BTU A;  4EB6 B;  5EO3 A;  1ZWZ A;  2FGY A;  3P10 A;  2VGM A;  1X52 A;  5KMG B;  3CC2 F;  5EYP A;  3WGJ A;  3S0H A;  4X1Y A;  3OBW A;  3WGL A;  3SIV A;  3JCM M;  4BVR A;  4FFB B;  3G6E F;  4BT3 A;  4X1I B;  3IEQ A;  3KHN A;  4G4W A;  4I55 A;  1IV4 A;  5CA1 A;  4TUY B;  3T80 A;  5EIB C;  3RE3 A;  3HKE A;  2QEX F;  4ZOL B;  1W42 A;  3WJP A;  1RLG A;  3K0T A;  3E22 A;  3LWQ C;  4BW0 B;  4YJ3 B;  3M1X A;  1CN7 A;  5HP8 A;  4IIJ B;  4TV8 B;  3FPI A;  1YJN F;  5LXT A;  1VHA A;  1SA0 B;  4DRX A;  2AMT A;  1K8A H;  3LDT A;  3NK6 A;  3WJQ A;  5JQG A;  3GTZ A;  1GZ0 A;  2CW4 A;  3N4Y A;  3N2K A;  4C4W C;  5J2T B;  3VI6 A;  5JH7 B;  5HY2 A;  4RHA A;  4PWT A;  2KGW A;  1JJ2 F;  5LYJ A;  2MQE A;  4BT5 A;  2R6R 1;  4X20 B;  3HKC B;  1DT9 A;  3M84 A;  3HKD A;  4RQO A;  2KG4 A;  3JAT B;  3IKF A;  3KJJ A;  2HRU A;  4G4Z A;  2GZL A;  3FBA A;  2RHL A;  1Z5V A;  1JD1 A;  3L7Q A;  3QHD A;  3JAW B;  2RB9 A;  3S03 A;  4U39 A;  4WBN A;  3S0W A;  4HNA B;  5IYZ B;  5KX5 B;  3I7T A;  3J7A R;  3R0P A;  2HS3 A;  3C9R A;  3S0Y A;  5CB4 B;  2HP0 B;  5LOV B;  5BMV A;  3LWO C;  4O2B B;  2I6D A;  4BVS A;  3TD4 A;  3M4S A;  4BT7 A;  1VQO F;  1SZQ A;  3I55 F;  3ELC A;  4YJ2 B;  2HQS C;  5JCO A;  2VXY A;  1JY8 A;  3N4Z A;  5KMG A;  4ZHY B;  1M1K H;  3VTI C;  1RA4 A;  1Q82 H;  5HXU A;  3JAS B;  1VQ6 F;  4ZHW A;  1R1M A;  2Z1U A;  3JVH A;  3U0O A;  3NVI B;  3F0E A;  5IJ9 B;  1XHO A;  3CCR F;  3I56 F;  4C81 A;  4LNU B;  3DDN A;  4FFB A;  1VQ9 F;  4X1I A;  1CK2 A;  4TUY A;  3CCV F;  2QA4 F;  5LA6 B;  4F6R B;  2VAM A;  4ZOL A;  2P6Y A;  5GAN K;  2HX0 A;  3S02 A;  1KQS F;  3ZOP A;  3F0D A;  5EAZ A;  4NUT A;  1U3L A;  1VQ7 F;  2QTP A;  1DBF A;  1W5E A;  1W3E X;  2Q1Y A;  4BT6 A;  2NMU A;  5EIB D;  1RQ2 A;  3CCL F;  5MN4 A;  4EI8 A;  4IIJ A;  4TV8 A;  1K73 H;  1SA0 A;  4IHJ B;  1VQ4 F;  4O4L B;  1W5F A;  2UYJ A;  3CCE F;  2RHH A;  2KTV A;  2F9Z C;  2OTJ F;  3F0G A;  3LME A;  4O2A A;  3KJK A;  2LBT A;  4EI9 A;  3CD6 F;  3HAX D;  2CVL A;  5CA0 B;  2IQQ A;  5J2T A;  5JH7 A;  4XCQ A;  2ZAU A;  3CCM F;  4O4I B;  1VQN F;  3WGN A;  2V9Y A;  3HKC A;  1W58 1;  4BVQ A;  3CCJ F;  3RYH B;  3IR9 A;  3MBM A;  4ZI7 B;  3BYQ A;  2B33 A;  5FNV A;  4ZHQ B;  4O4J B;  3JAW A;  3VO8 A;  4HNA A;  5IYZ A;  4B45 A;  4C8I A;  2HVY D;  1GX1 A;  3LFO A;  1VQL F;  2ZOV A;  4ZHV A;  3HWU A;  5HY0 A;  5CB4 A;  1KNJ A;  5LOV A;  2KTU A;  2Z01 A;  5J2U A;  4O2B A;  1VQP F;  1Q86 H;  2BO1 A;  2H6L A;  1FFX B;  1W55 A;  4G4X A;  5HP7 A;  2ALE A;  2LCA A;  3CB2 A;  4E6E A;  5C8Y B;  1Q8R A;  2RHJ A;  5EB1 B;  3CPQ A;  2UYN B;  5HY4 A;  1X7O A;  4NWO B;  2LBW A;  2Z1F A;  1U40 A;  5HY1 A;  3N2G B;  3JAK B;  3ZO8 A;  4O4H B;  3JAS A;  5B8F A;  5EB0 A;  3WJR A;  4I50 B;  3G71 F;  4BY9 D;  5G4U C;  3CG6 A;  1VK3 A;  5FJ4 C;  5IJ9 A;  1Q81 H;  5EZY B;  5GIN C;  4LNU A;  1YGY A;  1W41 A;  3RYI B;  3P0Z A;  1COM A;  3C9T A;  1ODE A;  2I6R A;  4NQ3 A;  5LA6 A;  3KIZ A;  2CHS A;  2N48 A;  1T0K B; 
#chains in the Genus database with same CATH homology
 1RA4 A;  1Q82 H;  1QVG F;  5HXU A;  1E7K A;  2JNB A;  3MCA B;  1VQ6 F;  3NVI B;  3SIU A;  2AIF A;  5IT9 M;  5A2Q M;  3RA5 A;  5HXZ A;  2GLZ A;  3CCR F;  3I56 F;  3PAF A;  3CME F;  1VQ9 F;  1W2B F;  1K9M H;  3V7E A;  3CXC F;  2QI2 A;  1CK2 A;  5EO3 A;  1ZWZ A;  2FGY A;  3CCV F;  2QA4 F;  2OHW A;  2VGM A;  3ON1 A;  1PXW A;  5GAN K;  1NMU B;  1X52 A;  1KQS F;  4EI7 A;  4X3M A;  3CC2 F;  4LCK A;  4NUT A;  1VQ7 F;  5DCV A;  1H7M A;  1W3E X;  3CCL F;  5GIO C;  3CCQ F;  3O85 A;  3OBW A;  4EI8 A;  3LWP C;  3CC4 F;  3SIV A;  3CCU F;  1K73 H;  2LBX A;  3JCM M;  4BVR A;  5GAP K;  1YHQ F;  1S72 F;  3NK7 A;  3V7Q A;  3G6E F;  1VQ4 F;  1XBI A;  3CCS F;  5GIP C;  2VGN A;  3CCE F;  4X3L A;  2KTV A;  2F9Z C;  2OTJ F;  2QEX F;  4EI9 A;  3CD6 F;  1W42 A;  3HAX D;  3CC7 F;  1YIJ F;  3OBY A;  1VQK F;  1VQM F;  1RLG A;  3LWQ C;  4XCQ A;  4BW0 B;  3VMF B;  3WXM B;  3CCM F;  5HWE A;  1VQN F;  1CN7 A;  1YJN F;  4BVQ A;  1NJI H;  3CMA F;  3CCJ F;  1K8A H;  3JAM M;  3IR9 A;  3D00 A;  3FFM A;  1VQ8 F;  1YJW F;  5FLX M;  3NK6 A;  3HJW C;  1KC8 H;  1GZ0 A;  2HVY D;  3N4Y A;  3J80 M;  3LFO A;  4C4W C;  1VQL F;  3VI6 A;  5HY0 A;  5HY2 A;  5EWR A;  2KTU A;  1VQP F;  5G4V C;  1Q86 H;  2BO1 A;  1JJ2 F;  1GO1 A;  3V3T A;  1IPA A;  2ALE A;  1DT9 A;  3E1Y A;  3LWR C;  1VQ5 F;  2KG4 A;  1QVF F;  3CPQ A;  5HY4 A;  1GO0 A;  3G4S F;  3GYQ A;  1X7O A;  2LBW A;  5HY1 A;  1X7P A;  3PLA C;  4BVT A;  3OW2 F;  1YJ9 F;  3CPW F;  2CZW A;  1W40 A;  3NMU C;  4BY9 D;  3G71 F;  5G4U C;  3NVK E;  3CG6 A;  4TZZ A;  3J7A R;  5FJ4 C;  1Q7Y H;  2FC3 A;  1Q81 H;  1KD1 H;  2OZB A;  5GIN C;  3LWO C;  3LWV C;  2WAL A;  2I6D A;  1W41 A;  3RA6 A;  4BVS A;  3AGK A;  1VQO F;  3I55 F;  3E20 B;  2OTL F;  4NQ3 A;  1YIT F;  1M90 H;  1SDS A;  1N8R H;  3J81 M;  3N4Z A;  1YI2 F;  1T0K B;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...