1RTDB

Structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
427
structure length
414
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
molecule keywords DNA TEMPLATE FOR REVERSE TRANSCRIPTASE
total genus 109
structure length 414
sequence length 427
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtdB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdB03
4ID5A 2CJQA 1JKHB 4RNHA 1EETB 2IC3B 4MK8A 4WE1B 5KT6A 1KHWA 3QZ7A 3QGHA 2J6UA 5KT3A 2VG7B 1BQMA 3M8PA 1JLBA 4NZ0A 3DRPA 5L1IA 1JLQA 2BQUA 5CYQA 4NCGA 5K14B 4F4XA 2C28A 4DL5A 1UWBA 3TQ1A 2C2EA 3C6TA 3KJVB 3LAKA 2YNFA 2OPQB 3MFIA 4ECSA 1HNVB 4DEZA 4J9LA 2UVVA 3FFIB 4U7CA 1TL1A 2YNGB 3BR9A 4QPXA 1FK9B 2R2UA 3N6MA 1QUVA 2GIQA 4FS1A 2WCXA 4NRUA 5DG7A 3RBDA 4PUOA 4KE5A 4M95A 4TQRA 1LWCB 1DTTB 5EUHA 4IFYA 2YKMB 1RTDA 4QWDA 3NMAA 4IFYB 2AX1A 3N6LA 2HNYA 1RT7A 3CJ2A 4TXSA 3KK1B 1TKTA 2R2TA 3T5HA 3JYTA 2FLPA 5F8JA 3NGDA 2XGQA 5D3GA 5F8NA 2O5DA 3M8QA 3V81A 2IM1A 2B6AB 3HVTB 1JLAB 3NL0A 1LW0A 3Q8QB 1IKWB 1TV6A 3BQ0A 3MEGA 3GIJA 3CVKA 5HLFB 4MIBA 5KG2A 2BR0A 3QYYA 2UUWA 3CDUA 3NAIA 4IH6A 2W8LA 5DG8A 1DTQB 2W9CB 2J6TA 2B5JA 4NLPA 3UDLA 1J5OA 3H5SA 1R0AA 1S48A 5KFGA 4YP3A 1JLCB 1RT5A 3DOLA 4URSA 3JSMB 3OSNA 3ITHA 4J9RA 4H4OB 3DI6A 1NHVA 1S1WB 3RB4A 1RT5B 4ZHRA 1K1QA 2C2RA 3PHEA 4H4MB 3KHLA 4KO0B 3PVXA 2ASJA 2YKNA 3DMJB 2W9BB 3G86A 4J9SA 2JEJA 3DLEA 3FDSA 5J1EA 3DMJA 5KFEA 2W9BA 3IRXA 4ECZA 4ED2A 1ZTTA 2FVQA 3HKWA 1C0UB 2VG6A 4WFZA 3FRZA 3I0RA 1S6PB 2ASLA 2XWYA 2HNDA 5HLFA 2FJWA 4Q44A 3QO9A 4NLWA 5HROB 3CO9A 4G3IA 4K4ZA 3OHBA 4TY8A 2B5JB 3BSNA 5EWFA 4MFBA 1MU2A 2ZE2A 5KT2A 2FVSA 2AGQA 3DRSB 3H40A 5J2MA 3RB6A 3CDEA 2OPRA 3T5JA 1HARA 4FBUA 1HYSA 1IM4A 3KLEB 5CYQB 5K14A 5J2MB 3LP0B 3DI6B 4EO6A 4OL8A 3E51A 1S9GB 1FKOA 4LSNA 5J2PB 3PW5A 2HNZA 1N56A 4IFVB 1S0MA 1RT2A 1W25A 2YKNB 1VRTA 4TYAA 4JV2A 5I42A 1C1BA 4NLUA 4NLOA 5KG3A 1ZETA 2RDJA 4IDKB 4I2QA 4MH8A 2YNFB 2IJNA 1JLFB 2D7SA 3DDKA 4WZQA 4O3NA 1TQLA 2XGPA 3V6DA 3HVAA 1RTJB 2QE5A 1JLEA 3MEDA 2HMIB 1S6PA 2IM2A 2QV6A 5KFLA 4PWDB 2XI3A 5KG7A 4MKBA 3MEDB 2HMIA 4J9QA 1FKPA 1RT1B 1RT7B 5DGBA 4NYZA 4NLYA 4O44B 5KG6A 1RT1A 4YMEA 3CIZA 3DRSA 5KFFA 1QAJA 2JEIA 2WOMB 2XCAA 4WXOA 3LP0A 2JC0A 3DRPB 4O4GB 1IKWA 1TV6B 3KK3B 3KMSA 4LSNB 3H5XA 5KFNA 2RKIB 2B43A 2OPSA 1HNIA 4WZMA 2ZKUA 4MKAA 1BQNA 1HQEA 4RW6A 4EEYA 5J2NB 2FJVA 3C6UA 3FSIA 3KJVA 4URGA 4RNMA 3SI8A 5L1LA 4Q0BA 1RA7A 3EPIA 3ISND 4ZPAA 4RW4A 3OLAA 3OL8A 5J2QB 4F4YA 4ZPCA 5KG0A 4KHRA 3GYNA 3BSOA 1KLMB 3H2LA 2IM0A 1HQUA 1N48A 1J5OB 4IH7A 4ECXA 4WFYA 3PR4A 1JLCA 1C0TA 3IG1B 4RU9A 1IKXA 4JV0A 2BANA 5KFXA 4G1QB 4KV8B 4ECQA 4RNFA 4X2BA 1SV5B 1JLGA 2JC1A 5EWEA 2WOMA 1HPZA 3MR6A 1T03A 1TL3A 3NBPB 5I3UA 3RAXA 5KFPA 4MIAA 2IMWP 4J9PA 1SUQA 2R8JA 2ZD1B 4ED0A 4MK7A 3PZPA 3IRXB 3DLKA 3GILA 3MFHA 1BQNB 3DYAB 2R8GA 4KSEB 1RT3A 3KHRA 3KLHA 3DYAA 1Z4UA 1RTIB 1RT6A 1GX6A 4O3OA 4GC6A 4O3PA 5KT4A 2IAJB 3QIPA 1N6QA 5F9NA 2BQRA 4IR1A 4Y34A 5F8IA 3GIIA 2V4QA 4KKOA 2ASDA 5EWGA 3DOLB 1TKXB 4ED1A 2YNHB 4WE1A 2HNZB 3QZ8A 4ZHRB 5FDLB 1TKXA 4KHMA 4O3RA 2VG5A 3H4DA 4K4SA 1C2PA 2OPQA 5FDLA 2GC8A 5KFTA 1RAJA 2VG5B 2WONA 1DLOB 1KHVA 4ECVA 1S1XA 1JLFA 1VRTB 1TVRA 4K4TA 1DLOA 3DOKB 4I7FA 4R5PA 3D5MA 3H59A 3V4IA 3CJ4A 1C0UA 2BE2B 2CKWA 1C1CA 2BE2A 1RTJA 3NAHA 3KLHB 2HNDB 4DL3A 2VA3A 1C1CB 4YR0A 5DQGA 5C42B 2HNYB 4DL6A 2FVPA 4I2PA 4ID5B 3H4BA 5CYMA 4MK9A 4TY8B 4JV1A 3D28A 2E9RX 1S49A 2D3ZA 4O44A 3TAMB 2AGPA 3UR0A 2UVWA 1TKTB 5C25A 2GIRA 3GIKA 4IRDA 4F4WA 2VG7A 2RKIA 2UVRA 3FQKA 4NLDA 3UQSA 4J9OA 3RBEA 1N5YB 4ECWA 4NCGB 3GV5B 4ED6A 4IFVA 4PQUA 2JEGA 3KOAA 2OPPA 3I0SB 4NLQA 4PQUB 4TLRA 3V6JA 5DLFA 4WXWA 3DM2A 3KHGA 5KFWA 1S9EB 4URQU 1DTQA 4ICLA 3ITHB 2AGOA 2WTFA 2HWHA 1VRUB 3CJ0A 3BGRA 4YR3A 5F8GA 1T94A 4EBEA 2I5JB 3PW0A 3JSMA 5CYMB 1S1VA 2XCPA 1S6QB 2OH2A 4IRCA 4NLRA 2ILZA 2I5JA 4RNNA 4EYIB 5DQIA 4KB7A 3G6XA 3TAMA 1RT4B 4NLSA 4KO0A 2RF2B 3MEEB 3T19A 5KFUA 5JUMA 1SV5A 1XR7A 3CDWA 3PR5B 2DPIA 4K4UA 1T3NA 4ZP9A 4K4XA 1NHUA 5KFVA 2OPSB 1K1SA 1T05B 4ZMMA 1WNEA 5KFOA 5KFHA 2ZD1A 5KFJA 2AQ4A 3C6UB 2J6SA 1XR5A 5DLGA 1IKYA 1S1UA 3LP2A 3I5AA 4IOBA 3DLGA 4NLXA 5KFZA 3BSAA 5KFMA 3PW4A 5L1JA 1IKYB 1S1UB 4RW4B 5C24B 5HROA 4IH5A 3T1AA 1S4FA 3FQLA 4IKAA 3QGGA 1KLMA 4WFXA 2YNHA 4KAIA 3GV7B 2WHOA 3BQ1A 4EBCA 4DL7A 1RYSA 1BQMB 3M8PB 5F8LA 4IRKA 4RZRA 4ECUA 2V0NA 5KFAA 1UWBB 4ZP8A 3IS9B 3QLHB 3MR3A 1S6QA 4EO8A 3LP1B 5J2PA 2AX0A 3IN5A 4I2QB 1NNDA 1HMVB 4B3OA 5EDWA 4NRTA 4DL2A 4LQ9A 2C2DA 2WONB 5I42B 3E01B 2FLNA 4QWAA 3KLFA 3MECA 1DTTA 4I7FB 3CJ3A 1JKHA 2AWZA 4Q8FA 3KLFB 4R8UB 4ED7A 3KLIA 4JUZA 2BRLA 4ZVGA 1RTHB 3QO9B 5DGAA 3KLIB 2JEFA 3KK2A 3M9OB 4PWDA 4YR2A 4RNOA 1I6JA 3QIPB 2IAJA 1MU2B 1N6QB 5DG9A 2IC3A 3KLGA 1D0EA 3GQCA 4NLGA 2OPRB 1RDRA 4F50A 4F4ZA 4LSLB 4QW9A 4U6PA 1JLBB 4IR9A 2F8EX 2RDIA 4Q45A 1FKOB 2UVUA 2W7PA 1D1UA 1TL1B 2IM3A 1RT2B 3LALA 3G6VA 5KFCA 4WYLA 1HMVA 4B3OB 2FLLA 1HQEB 4QWCA 4IDKA 4EBDA 5J2QA 3DOKA 5F8HA 4QWBA 4O3QA 5KG5A 4TYBA 5KG1A 5HBMA 4XPCA 1FK9A 2R8KA 3CWJA 3V6DB 3V6KA 4ED3A 4R8UA 4PUOB 2W8KA 3KK1A 3SFGA 5KFYA 2DPJA 4ZVHA 4K4YA 3KK2B 4Y2AA 3OSPA 3BREA 4G1QA 1VRUA 4KV8A 5D3GB 5L9XA 3CJ5A 2D41A 1IKVA 1LWEB 4KFBB 1QE1B 3HVTA 2B6AA 3JYTB 1HPZB 2FVRA 1S1VB 3NKYA 4TY9A 5KFDA 3OHAA 1EP4A 3PJWA 4Q8EA 1RT4A 2HAIA 3MEGB 4RUAA 3V6HA 3HHKA 4IG0A 3G6YA 4ZVFA 3H5UA 1T03B 1RT3B 3BQ2A 1TKZA 2OPPB 2HWIA 3LP2B 4RW9A 4IG0B 2WK4A 3I0SA 3IGNA 3BSCA 4K4WA 3DRRB 5C5JA 1SH0A 5C24A 1QAIA 3M9NB 1S9FA 2IBKA 4RW8B 2ZE2B 4ECRA 1HYSB 4KBIA 3PW2A 1RA6A 1OS5A 1HQUB 3MTKA 4NLVA 3PW7A 4RW7B 1JLQB 2FJXA 2BRKA 4ED8A 1S97A 3T5KA 2ALZA 3OL6A 1S0NA 2JLEA 2R2SA 5JXSA 3LP1A 3C6TB 3IS9A 1REVB 2YNIA 3QLHA 2R2RA 4ECYA 2WRMA 2VG6B 3GIMA 4R5PB 3TVKA 3N6NA 1MMLA 4DG1B 3OL7A 3I5CA 2WB4A 1SUQB 4K4VA 1TVRB 4XO0A 4GC7A 1ZTWA 1LWCA 1TKZB 2V9WA 5L1KA 2VA2A 4WYWA 3V4IB 4K50A 3I0RB 5C42A 2IJFA 4NLTA 1CSJA 3RB0A 1LW2A 4O4RA 3BJYA 2E9ZA 1RTHA 2AU0A 3KLGB 1TP7A 4MFBB 4I2PB 5KFIA 3RAQA 5KFSA 1SH2A 2UUTA 1N4LA 4Q43A 3MR5A 4O4GA 3KK3A 4TQSA 2ILYA 4IG3A 3PJXA 2V4RA 4EYHB 4RUCA 5C25B 3MR2A 1HNVA 1S9GA 1U09A 4RW6B 4LSLA 3ICLA 5F9LA 1LWFA 1REVA 2YNIB 2BQ3A 2IA6A 3Q8RB 1JX4A 2W7OA 5KFRA 2FVCA 4ZPDA 1S10A 5HP1B 1GX5A 4Y3CA 3MECB 3GV8B 4J9KA 1JIHA 3UPFA 3DM2B 5DQHA 4ECTA 4O3SA 5HBMB 4ZVEA 3SFUA 4DL4A 3IG1A 4ICLB 3Q8PB 2BANB 3MF5A 5KFKA 1IKVB 1LWEA 1QE1A 2YKMA 1RTDB 3QIDA 5KT7A 3H5YA 1JLGB 3BGRB 5KG4A 3M8QB 3V81B 3T5LA 2C22A 1XR6A 5J1EB 2R8HA 1JLAA 4ZPBA 1TL3B 3NBPA 2W9AA 1HNIB 1S0OA 2E9TA 3I5BA 2XC9A 1JXLA 3KLVA 4IG3B 2RF2A 3MEEA 1N5YA 4RW9B 1SH3A 1LW0B 1YVFA 1LWFB 3LAMA 4R0EA 4FS2A 4Y2CA 5J2NA 3M9MB 4RW8A 3VQSA 1R0AB 5KT5A 4Q0BB 5KFBA 3DRRA 2XI2A 5HP1A 2W9CA 3DLGB 4H4OA 4KKOB 5F8MA 1RYRA 1C0TB 1S9EA 4RW7A 3EZUA 3KLEA 3RB3A 3KMQA 3KNAA 5T14A 2EC0A 4H4MA 4H54A 4TN2A 3EPGA 3ISNC 4QW8A 2I1RA 2ATLA 5KFQA 4YQWA 1S1TA 1S1WA 3OLBA 3DLEB 1IKXB 4QWEA 3Q8SB 4FBTA 3IGVA 3QGIA 3KHHA 1S1TB 1C1BB 4M94A 4KFBA 4HYKA 3OL9A 1S1XB 2R8IA 3FFIA 3DLKB 1EP4B 4LQ3A 4DG1A 2YNGA 3H98A 4IQXA 2D3UA 5I3UB 4J9MA 1JLEB 4ZP7A 4HKQA 4XPEA 3E01A 1RT6B 1RTIA 1T05A 4ZP6A 4J9NA 3HVWA 1EETA 1LW2B 1FKPB 3LANA
chains in the Genus database with same CATH superfamily
4HH1A 3M2RA 4FVCA 3L4BC 4CO2A 1T9VA 3CD0A 1K44A 1UEUA 4LFAJ 1OMSA 1YJUA 1X4AA 1FE0A 5KFLA 4W90B 4MK8A 2DGWA 2MZQA 1SC6A 4HT7A 3PEJA 2LP4A 4J91A 1HI1A 4F0HA 1TZ0A 3ZNUA 3AD7C 3KG0A 1EX8A 4CLWA 4CP5A 5L1IA 2MQMA 3DRPA 2Z0GA 3CE8A 1FVSA 2VJUA 4F4XA 2WSEC 4A8MP 1WTBA 1UWBA 3TQ1A 1T0TV 4X84A 2HQFA 2AZ1A 3FCHA 3J7A1 3KTQA 3QWUA 4DEZA 4OZ3A 4EWTA 5B0CA 2BVZA 3IBWA 2K3IA 2MDAA 4FPRA 1M0SA 1TL1A 2QYGA 1R31A 3NOCA 4ID8A 4U7CA 4AQYF 2XSJB 1B0PA 5ETMA 4TQRA 1B70B 1DTTB 2X51A 3HCXA 3TO8A 2IYIA 4HT5A 1YKWA 1AUSL 5CHCB 4QWDA 2Y1RI 4I6YA 4IFYB 2UXCF 4LRFA 1RT7A 1TKTA 3ZZRA 3PACA 5F8JA 3AQOA 2FTRA 4DZ6A 3BBCA 3HK2A 4L75A 5T41A 5IT4A 2WVCA 2O5DA 3IMQJ 1LWXA 3AH6A 2IM1A 3FEZA 4W98A 3LGHA 4M5DA 2BM1A 4DQRA 2X7IA 3GG1A 4DX7A 1TK8A 2MQOA 4EI2A 2QLXA 3MEGA 5FLXY 4OJ3A 1D09B 2PC6A 5HLFB 3K5OA 4TLQA 2UUWA 3I55S 2W8LA 4X4PA 3RU0A 4GKKJ 2J6TA 2GJIA 3UDLA 3VZHA 4KTQA 3A8KA 2DH9A 3FMWA 4HTIA 2ZZMA 1JLCB 1RT5A 2P9EA 3DOLA 3C2PA 3BPSP 3CCUS 2XMWA 1S1WB 4MMOA 3TYTA 3Q8UA 4ZPTR 2X1FA 3CJQA 3PHEA 3RRHA 2QMWA 3WC2A 4ATNA 4KO0B 3L9ZA 4CTAA 5HO4A 4MKYA 2FB0A 3HJVA 3VHQA 3T1YJ 1ZOTA 4CTAB 3DLEA 4RUHA 2VL1A 5KFEA 2AP6A 3IRXA 1Q78A 2IDLA 2B3TB 3C15A 1S0VA 2VG6A 2DD8S 1RWOB 2HVEA 2OEMA 4JOUA 4YN3B 3MOZA 1NUEA 3I0RA 1H6KX 2FY8A 3R3TA 5E33A 1QY7A 2XWYA 2FJWA 1V9OA 3M30A 2AYBA 4NLWA 2IY5B 3AFGA 3MPVA 5E5NA 3G8QA 1NJXA 2ZNYA 2MLYA 3BSNA 3K5LA 2MGZA 1OQ3A 2ZE2A 5A6WA 1UFKA 5HQ8A 2OPRA 1HARA 4OYPA 1HYSA 3H8YA 2CJBA 1AROP 3KLEB 3FJ2A 1JXVA 3LP0B 3G4SS 5LMNF 2VOPA 1M1HA 5J1PA 3C46A 3DXSX 5J2PB 4DQSA 1GQEA 2HNZA 2CNNB 2W2QP 4NA3A 3U27A 2CAJA 2YXLA 4B9NA 1RT2A 4TU8A 2YKNB 2OHDA 4WKYA 1KTQA 1WSRA 4TYAA 3CXCR 1C1BA 1TELA 4NLUA 1RU2A 2D9OA 3KDOA 1WELA 4DV7F 2AJQA 3ILIA 2O3DA 1NMEB 2ZVSA 2KM8C 2D7SA 1UW9A 2OP5A 2YTCA 2Z2LA 3DDKA 4C0HA 4F25A 3HVAA 2XGPA 1RTJB 3MHYA 3DXBA 3LW5C 2B56A 4CT9A 3W5YA 2JLGA 5IC4B 3CC2S 3T1YF 1IJFB 3IWLA 2IM2A 2PEHA 2L9WA 2QV6A 2VC0A 2K8GA 4ZJOA 4PWDB 2XI3A 1P9YA 3R5JB 1PJ7A 4F3MA 3TA1A 3DFEA 4KGMA 2ALYB 2HPUA 4O44B 5ETOA 4X4TA 1QTMA 2W01A 3CIZA 4JI7J 3OFGA 2AYMA 1W2BR 1FESA 2ZBIA 1CS4A 2ACMA 2VODA 4WXOA 3FEXB 1F5CA 2Z30B 3DRPB 4O4GB 1TV6B 1XMQJ 3H5XA 3QJLA 4I67A 1M5VC 2RKIB 3HJFA 3MAAB 4OYMA 2J6SA 1TL7B 1HBNB 2UXCJ 2V63A 3C6UA 3FSIA 2DR6A 3NGSA 3P3DA 3OT9A 1M1GA 2CJ9A 1DY3A 1RA7A 2CADA 2IVMA 1NXIA 2LA4A 4P7VA 5L1LA 2GHWA 3IR5B 3NWGA 2H65B 4MIWA 1I94J 3JTPA 3OL8A 1YBTA 4UZCA 2LYVA 2FJEB 3GZ7A 3PG9A 2GQ2A 4V1Ak 5H9EJ 1UVMA 4DSLA 3KUHA 4XDDA 4F26A 1UFLA 3NS7B 5D0RA 2Q79A 1IKXA 1LXJA 1WUUA 4JV0A 2KVQE 2BANA 2GIFA 2X1BA 2MKKA 5KFXA 2WVBA 5E0OA 2KDOA 4RNFA 2E44A 2DH8A 4KPCA 5EWEA 2UXDJ 2VKRA 3M8SA 5JVGQ 2Y8WA 5I3UA 3AOCA 4ZITA 4MIAA 4P9SA 3RAXA 1WF2A 3C66A 1MW7A 2PMWA 4J9PA 4ED0A 2VBXA 2R8JA 2RD5C 4DX6A 4B9UA 2HIQA 3M2RB 3KLHA 3FBCA 4V19J 3MAQA 4YB1P 1OWXA 1RTIB 1RT6A 1GX6A 2J8AA 2KT3A 2OUGA 2P9GA 3QT7A 4FVMA 5GMKa 2UV8G 2IAJB 3SSQA 3TVZA 1O5JA 2GAGC 3D67A 4CNYA 4IR1A 4BDPA 2ASDA 4KKOA 2DH7A 4MT1A 3DOLB 3CPWR 2KFZA 2K1RB 4A8OA 2SXLA 3QPIA 2KT5A 4KHMA 4O3RA 2CIMA 3LQVA 1VBXA 3AA9A 3N79A 2VFRA 2MPUA 1TFYA 4JYAF 1P1TA 4C97A 1RAJA 5F3ZA 2VPYB 2VG5B 2QA2A 3CD7A 3WIUA 1HNXF 1UA0A 2XHWA 1NZ8A 2J0QD 3G2XA 1S1XA 1JLFA 3DU5A 1VRTB 1JB0C 4K8RA 3QWPA 3R1LA 2HYIB 4LVOP 3Q24A 2XTJP 5ADZA 4R5PA 1U4BA 1VQ8S 4RJVA 5D4PA 2QYCA 1Q8IA 2VUGA 5LSOA 1EKSA 1YJTA 5HI7A 2XSJA 1ZAWA 1HW9A 2HNDB 3NAHA 1DBDA 3S1TA 2VA3A 1XNQF 5C42B 1GNKA 3D66A 4A47A 1TK0A 4I2PA 4ID5B 2JZ5A 5L39A 3EXYA 3H4BA 2UUAF 4TY8B 4JV1A 2VFVA 4B08A 3D28A 1H98A 1UTAA 1UVIA 2LQ8A 2GZOA 2OFGX 3M6XA 1TKTB 2PIIA 5D6GA 3LWLA 4JBCA 3W2WA 4JI0J 2BXJA 3FQKA 4J9OA 5F0WA 2K2PA 4G6VB 1D9DA 1VQOS 1RWWB 5F0UA 2IIHA 5CZVA 2CPHA 4TLRA 1VRQC 3V6JA 5DLFA 3UD3P 5GVQA 3E8OA 2DEJA 2RT3A 4WXWA 4O23A 1B4SA 3L09A 4D3GA 5M2RA 2Y9HA 5E3AA 2PMHA 4ICLA 4U95A 2HZVA 3ITHB 4C48A 2WTFA 2KG1A 3VAMA 2JJ4D 1NK7A 4S0MA 3L7PA 4YB6A 4HR2A 3EWGA 3N5BA 5F8GA 4EBEA 4OV1A 3H7HB 3PW0A 3JSMA 2MJUA 1S1VA 2XCPA 2OH2A 4IRCA 2H5EA 2DNNA 3ISZA 1A6LA 4RO0A 2V8VA 1RT4B 1DHMA 2O1PA 1XN9A 1JNRB 3LH2S 3MEEB 2FHJD 4HLBA 3J81U 4Z7YA 2VQEF 3PO4A 1APSA 1A9NB 1QUPA 1FDDA 3R6GB 2EI5A 5AJ3F 1IQTA 5ETQA 1ITPA 3MM9B 1U1QA 4DSFA 5KFVA 1D3WA 4G1PA 3MXHP 1K1SA 3E3XA 3LA0A 3MMBA 3UN5A 4JI8J 5KFHA 3NXZA 5L38A 5KFJA 3C6UB 1CC8A 1WOSA 1YDLA 1MN7A 1ZM9A 1YX2A 2APOA 3D3CJ 4ZOSA 4IOBA 5KFZA 1UETA 3TRGA 1GXLA 1JK9B 3BSAA 2AT1B 2MQNA 2HFZA 3LGNA 5MLCV 5L1JA 1IKYB 2IVYA 4B3RF 4RW4B 1VK8A 2ZUGA 4ZLPA 5A8KB 4DFMA 1X0FA 3IFEA 1XNQJ 4QIWD 3BQ1A 4KAIA 3PHTA 2YKAA 4IRKA 4Q5VA 5U47A 5F8LA 1RYSA 3HHNB 4RZRA 3MM8B 4QIVA 2V0NA 2VBYA 1XMBA 2DGOA 3PTWA 3QJPA 1RHUB 1DQ9A 4NE9C 4YEAA 1LFWA 2IRYA 1WHVA 1S6QA 1WEXA 5LSRA 1OYEA 4EBDA 4DS5A 2KYZA 2ZWPA 4KR0B 3TP2A 3MPYA 1NNDA 4NZ7A 3G82B 2MY7A 4JYAJ 3N5FA 1RXOB 2C2DA 1WTFA 3SQGB 5HMXA 5EN1A 2IRXA 2V2VA 2V67A 1TL4A 2XG8A 3G8SA 2BE9B 2MTLA 4I7FB 5K8MA 1UEKA 5EGYA 3BKUA 2LU1A 1I51B 4GMKA 4ZVGA 3FEYB 2H1YA 1YIJS 1HI0P 3EYZA 4JV5F 3ENAA 2XQCA 1RHKB 3QO9B 4CWBA 5DGAA 4MAKA 2Z8QA 4DL0C 4YR2A 4RNOA 3AD9C 2ADBA 1N6QB 1MU2B 2DHGA 2MSSA 4FF4A 1FX4A 3WQPA 2IC3A 5DRKA 3Q23A 4F0MA 4C8ZA 1SVDA 4OYBA 1TAQA 1UL3A 4F4ZA 1XMQF 4QW9A 1JLBB 3NEKA 3OR2B 1YJRA 3NOGA 2M9KA 2HBYB 3Q2SC 3SZ2A 4FYDA 1Q79A 3J81j 1W26A 1U2CA 2CNKB 2F65A 4B3OB 2JVOA 2RQ4A 3AB4B 3BGOP 4DFKA 1HBNA 1TL7A 4IDKA 4NYOA 5J2QA 3QMQA 4C0OC 3TA2A 5F8HA 1SKWA 4OI6A 2DHSA 1CJUB 5HBMA 2JLFA 4RX6A 5L9NA 4OI1A 2Y3YA 1GFWB 2NYHA 1WEYA 4PUOB 2ZHOA 4A46A 2GVZA 5A8WB 3KK1A 1RKIA 3A8EA 3F56A 3J7YI 2XMAA 3CCJS 1DZ5A 3CB4A 1Y11A 4CLSA 2QEXS 2LXFA 1I94F 5D3GB 1QM9A 1KC8T 2D41A 3GFYA 3HVTA 2B6AA 4NA2A 2UUCF 3OHAA 1VQPS 1B3TA 1Y10A 3F41A 1EKRA 4Q8EA 3PX6A 3X1LB 4RUAA 2BJ1A 4CLUA 1UWAA 2CPJA 2UU9J 3CMQA 2F9JA 2B9WA 2Z2ZA 4IG0A 1NSQA 4CLZA 3J7ZT 4EFAC 3W66A 5LMNJ 2EFPA 2KVIA 1H3DA 2ADCA 1SJFA 1HWJA 3F44A 4BBYA 1IBCB 3EUNA 3IGNA 1TMMA 3Q83A 3K57A 5C24A 2W7AA 1Q7LB 1AUDA 3M9NB 3PYDA 4P73A 2VB6A 2VH7A 3JSBA 1U1PA 4P2MA 4KBIA 1YLXA 2F63A 1RA6A 4NLVA 2NZ4A 2QLJB 1SIWB 3EVOA 2A6OA 4RW7B 4AT1B 2FJXA 4LFCF 3MD3A 4ED8A 4N76A 5CA5A 2ERRA 2GHPA 2KFNA 3AA8A 5JXSA 3LP1A 2DITA 5DDPC 1FJGF 3ZZZA 3I96A 2KH9A 2NPFA 5HMYA 1REVB 2LLZA 3FGVA 3VCDA 2ZITA 4NYPA 4C7QA 1O0PA 1X5OA 4LSZB 4R5PB 4X4OA 3EZ5A 4OHYA 3GR1A 1Q5VA 4XAKA 3TVKA 2B7BB 1MMLA 2WW4A 1I5OB 8ATCB 2OJ3A 1B99A 2HRTA 5CH7B 4DJBA 1TVRB 1MN9A 4GC7A 1FTRA 2MQ8A 3ENVA 3ZZOA 3IR6B 4LUBA 2W4PA 4WYWA 4Y2KA 1HNWJ 4PWWA 5BXIA 2ZJQQ 1ZM4A 1MROB 3AJ2A 4GKKF 1QJHA 1WHWA 4WP3A 2E9ZA 3KLGB 4JI6F 2QL9B 4DSJA 4OX9F 3LGMA 4UY8T 4I2PB 4X4UA 4DUYF 3OFEA 1KVIA 1U47A 3GR0A 2UUTA 5KFSA 4ZN1A 3SYZA 3S7RA 4X65F 1TUGB 2YWGA 3TANA 1JJHA 2P8IA 1N5QA 1VOMA 3DHWC 4CH7A 1DAXA 3AOBA 3BN7A 4Y2IA 5HSPA 2LDYA 1WF0A 1S9GA 3MR2A 4RW6B 2BW2A 1VC5A 1CJTA 3C14A 1H0HB 4N56A 2OGUA 3NCQA 3Q8RB 3C14B 1KFDA 2A1BA 3IXQA 2RQCA 1LV5A 2FVCA 4ZPDA 5CCLA 1VQNS 3MM6A 4Y3CA 3MECB 5I4MA 3SV3A 1JIHA 3N28A 3DM2B 2CWXA 1WC4A 2P6SA 2OSQA 3IG1A 3BF4A 4ICLB 2BUNA 2LEPA 3PJ9A 2KXFA 3OXGA 1QE1A 4ANEA 3H5YA 5KT7A 3OFFA 2DNKA 3CJ8A 4MYUA 1UEVA 3UO0A 3M8QB 3T5LA 4FPIA 4DPXA 1Y3KA 2GW8A 1MWYA 5H9FJ 2R3VA 4CM0A 3J81Y 4ZPBA 2PD1A 2ZH1A 1HNIB 4DSKA 1B7FA 2X3GA 1EZZB 4IG3B 3KLVA 1JXLA 3UR3C 3MEEA 1BHNA 1SH3A 4DZDA 1RQ0A 4TU7A 2WAQD 1LW0B 3EJMA 1VQKS 3B4DA 3IP0A 2IMOA 1Y9OA 5GADI 4NX9A 1R0AB 4JP8A 5KT5A 2J7KA 4DR5F 1BMQB 1Y5IB 2DCLA 2CQ2A 2J9DA 5D78A 3AAWB 1CJUA 2EW9A 3HHEA 1FI4A 2B8QA 2W9CA 4AL5A 4K0KJ 2XZTB 5F8MA 1RYRA 1FRKA 3EZUA 3KLEA 3ILOA 3R9LA 1AW0A 4W4MA 1SXLA 3NWRA 2I1RA 2Z57B 3DOMB 1Q81T 3PYEA 2MQPA 4YQWA 3A8IA 4RLEA 3JTNA 3MCMA 1G7CB 4A8WA 3RW6A 3IGVA 3M6WA 3HLUA 1S7HA 4ZJQA 2KHDA 4HYKA 1KNZA 3SCIE 2VIHA 3RBXA 1MWZA 1U24A 3M8YA 1NK6A 4DG1A 4WF9Q 4QBUA 3H98A 1CJVB 2D3UA 2VKZG 3PNIA 3QAUA 5I3UB 3I9ZA 4RL1A 3W63A 2Z2YB 2DXDA 1R27B 2G0CA 4J9NA 3ZFVA 1RB0A 2R7TA 3OTOJ 1VHIA 1FKPB 3LANA 1XK8A 2CJQA 1YWXA 4QQBA 4USIA 4ILMA 4DX5A 3Q8VA 3TZXA 2FHOB 2IC3B 2DGUA 2J0WA 4WE1B 1BUXA 3F73A 1JMTA 1KHWA 3QGHA 4WP8A 3QZ7A 1NKBA 1KWMA 1NSAA 1IBLF 3CF5Q 1J2VA 1JLBA 1D8ZA 2JH3A 3MURP 1JLQA 5CYQA 4NCGA 3CULA 1AFJA 3LUYA 3BO2A 4CH1A 4ZVSB 2JL9A 5DO2A 2H3EB 4L3KA 2C2EA 4K59A 1RAEB 4ECSA 1X0PA 1OQ6A 4LBPA 1HNVB 3MM5B 3MFIA 5JJBA 4J9LA 1RWKB 3L95X 2FIUA 2HQDA 3I87A 5B0EA 3P49B 3QJJA 1FK9B 4QIGA 2ZH2A 5KFMA 3HZGA 5IXUA 2QA4S 1WG1A 4I64A 2WCXA 4FN5A 1CQMA 4PUOA 4OHZA 3RBDA 1HHTP 1LWCB 2CQCA 2YKPA 3EE3A 4USUA 5D77A 1DARA 1HKAA 2XNRA 1XC9A 2YKMB 3G96A 4I6WA 2MZ1A 4ZPWR 3CJ2A 4TXSA 1KEKA 2O01C 5GAHI 2NUHA 2IRUA 3JYTA 3HHLC 3W5XA 3PDNA 2XGQA 2XO7A 1K73T 2ZNZA 4ER8A 5F8NA 4ALZA 1SJQA 2GVDA 4FF1A 2BJ8A 5DM7Q 1VC6A 5ETTA 3TJ9A 4HDGA 3VAGA 1N34F 2Q6BA 4PG7A 1NPPA 1X4DA 2F4FA 1PYSB 1RWVB 1IKWB 4KQZA 4DV5F 2JDJA 4FXDA 3S6EA 2NQPA 2QL7B 1CJTB 4DWIA 3CVKA 2CQDA 3FZ2A 2EG2A 4OYZA 4MIBA 2BR0A 3K59A 5LMUJ 3HFZB 3NAIA 2ZHBA 4NI2A 5KAKA 3PYGA 5DG8A 4Q7AA 3TAQA 5K5MA 1PSDA 3TARA 2HFSA 2N7YA 4F3QA 1S48A 1XIQA 3MM6B 3MTJA 4OZ2A 5CABA 4YP3A 2XY6A 4WU3A 4URSA 5D15A 3ITHA 1S4EA 4H4OB 2HS4A 2PA3A 2WVDA 2MKIA 1RT5B 4ZHRA 1YTYA 1V3SA 1FXLA 1IWAA 2RE1A 2CQHA 2Z4PA 3DMJB 1XWLA 3T9ZA 4J9SA 1XMOF 4QYZK 2PI4A 2CPZA 1YZ6A 2LQJA 3IM8A 4DR4J 1R8HA 2FVQA 4CH0S 5HMWA 4J37A 2HHUA 4DV1F 2FUG9 1Z2LA 4B02A 1M5SA 1G1XA 1C0UB 2YH0A 1H72C 4YY3F 3AODA 3VWSA 5ETNA 3KJFB 3TZYA 3C15B 4AFFA 1S6PB 5H1SV 3HP6A 4C11A 2XM3A 1NJZA 2HNDA 1SB6A 2Y0BB 2DR8A 4K4ZA 3HMJG 1SL2A 1S57A 5IQ6A 3QAEA 5LJ5Y 4G3IA 2BKPA 1FDNA 3M30B 4TY8A 4E0DA 1UPPA 3D0HE 5EWFA 1X4GA 2AIRB 2VDIA 2FVSA 1VIOA 1VJQA 3T5JA 4PXBA 2PFDA 2EC2A 2HEKA 2MMYA 5K14A 2ZBPA 2HG4A 4HEA9 1S9GB 1FKOA 1M5HA 5HVHA 1N56A 5E3RA 4PYAA 2V2QA 1SCJB 3M1VA 4HI1A 4DR3J 1VRTA 4CLKA 2HAFA 4I56A 5CYJA 2UXBJ 3I82A 1TTHB 5GAEI 1NBEB 1NZAA 2EFQA 1Q16B 3ETMA 4K5RA 2RDJA 1NJWA 4ZJLA 4OJGA 3IC1A 2YNFB 4WZQA 3KKFA 3SQOP 4O3NA 1TQLA 4Y00A 3GCXP 3V6DA 4QPTA 3UN3A 2ZKTA 2LQ9A 3POTA 2QE5A 2QO3A 3MEDA 3QGPA 1WG4A 2JX2A 2XMJA 4PABA 3CT9A 4IO9Q 2C2MB 4RUBA 1NK4A 1HNZF 4MKBA 3MEDB 4J9QA 1FKPA 1X60A 1RT7B 1HWUA 1WC5A 4E2FB 2AMCB 1G6BA 3GFXA 5DGBA 3EGVA 2XYGB 4NLYA 2K7KA 3AHPA 1PAUB 3GG0A 1EB0A 5KG6A 4CO3A 1LFPA 1NH7A 4OYWA 4USMA 2AZ3A 4YMEA 3DRSA 3D0IE 2JEIA 5ITHA 2XCAA 4DLEA 4BHQA 2G4BA 5THWA 3C16A 3UNGC 2CJYB 3CJRA 2CJKA 4R0JA 2G1HA 1FX2A 1U0SA 3C16B 4UOCA 4ES3A 4LSNB 4OHXA 2AYGA 4DFPA 1HNIA 2EG1A 4OI0A 4NEYA 2MY8A 2CZ9A 4DOZA 4BS2A 1SQGA 3MMAB 4M5HA 1Q95G 4M8LA 3ISND 4ZPAA 2IYGA 4RW4A 1EQMA 1EJ7L 1F3FA 5J2QB 1PC5A 1YRXA 3GYNA 4DPTA 2QLBB 1Q7YT 1HQUA 4MJKA 1F1BB 1K0TA 1X9SA 1VFJA 4I1TA 1U1MA 4DUYJ 4G1QB 1T95A 1X9WA 1JLGA 4NZ6A 2RRAA 4EZ9A 2WOMA 1PGZA 2DGVA 3G82A 3O8WA 3OPKA 1VLOA 1TL3A 1OJ4A 2EEYA 3QFWA 4ES1A 4FF2A 2R7WA 3NY0A 3EICA 4MK7A 3P45B 4AE5A 2N3OA 2HLTA 5IM0B 3GILA 1HLWA 1SKSA 5C2CA 2MQLA 1RT3A 4V19X 3R5GA 3KHRA 4ZCKA 4LF1A 1AT1B 3LOUA 3R2CJ 2CQIA 2VZ9A 3DRXA 3CSKA 4BLGA 3HT0A 2K06A 5A6PA 4WFAQ 2YKOA 1U0HB 3H20A 3P4UB 1N6QA 1FWPA 4O3PA 2HHHF 5F9NA 2BQRA 5A8RA 1FRJA 2F40A 2HSEB 3MR7A 5F8IA 4JI3F 1H2VZ 3DGPA 4GRSA 1HR0F 1IN0A 1NSPA 1TKXB 1RE1B 3MWBA 2X1AA 4J5OA 4ED1A 1SL0A 1F9FA 4ZHRB 1RAHB 4LR9A 1TKXA 4FF3A 2IBOA 2QFIA 4K4SA 4ITSA 1NKEA 2J0SD 2OPQA 3GJQB 2JFDA 1SBRA 2FZCB 2JWNA 1DLOB 1KHVA 3SQGA 3AJDA 1RAFB 4Y0FA 3L7OA 3K58A 1DLOA 1MMNA 1RAOA 2V8HA 3UW1A 3H59A 3V4IA 1VYAA 5IV3A 2AJ1A 2CKWA 2AKWB 1C0UA 2BE2B 4W92B 1AXQA 2B4PA 1RHJB 1H2TZ 2HS3A 3IAS9 1HW8A 3EXCX 4H4KC 2BE2A 2GCFA 1U45A 4ZVPB 1FEEA 4N77A 3SBMA 1WWHA 3SMZA 2MHEA 4E98A 3HHLB 4YR0A 1NB7A 5IT9U 2VONA 2ZM6J 5CYMA 2EFNA 3HFVA 2MXYA 1H7WA 1Q4RA 2NLWA 1GMVA 1WD6A 1RAAB 3UR0A 2GIRA 3L3CA 3P6YC 1CG2A 4F4WA 2VG7A 2RKIA 1S59A 2WSCC 3UQSA 4YS2A 2EK6A 3GV5B 3EX7B 4QR2A 1IJEB 1WC1A 4IFVA 4PQUA 1E6YB 4ED6A 2OPPA 2JEGA 1CPZA 2AEJA 2AJ2A 2BJDA 2KFYA 4FNHA 4NLQA 5HL7Q 1L3VA 4DR7J 1WI8A 2VPWB 3BYRA 2HVDA 5LM7E 5A76A 1SKRA 3M8WA 1X4HA 2XMUA 2GVZB 4FYXB 3JAMU 1S9EB 4URQU 3ZXWA 4ETXA 2AGOA 3BS9A 1JJ2R 3BN4A 2HWHA 3D68A 2A18A 3CW2C 7FDRA 2E5LJ 3CJ0A 5ETRA 4YR3A 3OFHA 3J7YU 2NXUA 4NLRA 2ILZA 5K8PA 5IZHA 4RNNA 4DV3F 3RZAA 1PAEX 4EYIB 1I1GA 1YI2S 1U1NA 2KZZA 4A8XA 4KO0A 4N8OA 2D1CA 2E5HA 5KFUA 5E41A 2C3PA 1XR7A 2DPIA 4QOTA 2DNMA 4UQGA 2WW8A 2YPZA 4YB7A 3THPA 4DF8A 3EMTA 1T05B 4ZMMA 2OEJA 2ZD1A 3PV8A 3GP9A 4KYZA 2ZBQA 2FHJA 4B9LA 5DLGA 1S1UA 3I5AA 1TU0B 4M5MA 4JI4J 3PW4A 1YBUA 2LECA 4UOFA 4DS4A 1HWLA 1TUVA 2B4UA 1FEHA 2HVIA 3BPDA 3GYXB 3HHDA 2KU7A 3T1AA 3FQLA 4FP9A 4IH5A 4WP9A 1YRUA 1KLMA 3QGGA 2YNHA 1WNEA 1FA0A 1BQMB 3M8PB 3O44A 2HHQA 2M52A 3FNNA 1QVGR 1Z1ZA 1UFWA 3RR7A 1BC6A 3AXMA 4EUVA 2YPYA 1UWBB 1RACB 1R8CA 3IS9B 3QLHB 3M1VB 2FC9A 3GMGA 1KTVA 3IWXA 3MCSA 4B3MF 4LF6J 3T41A 1CVJA 4ANDA 4GKJJ 3LPEA 5J2PA 1RI7A 2IFXA 3IN5A 1GTHA 1NK8A 1VIXA 5EDWA 4NRTA 4DUTA 2B0GA 3A3NB 3BH6B 4IOCQ 4YOEA 4PG6A 3E01B 1PKUA 3V4MA 4X4VA 1HHQA 3KLFA 2HBZB 3MECA 5E7OB 2DHXA 4OHWA 1DTTA 4Q8FA 3CJ3A 2AWZA 4XIUA 1H73A 3KLIA 2OKQA 4JUZA 3DDIA 1RTHB 2FQQB 2XMVA 1OYDA 3CNQP 1K9MT 5D4OA 4RBVA 2ZH5A 2V8DA 2EK1A 1DJ0A 4PWDA 1NDKA 1K8AT 2C1EB 2M8DB 2J9DE 2I2YA 5A8RB 1IM6A 2GNKA 4CIOA 4NLGA 4DV3J 3U7JA 2QSFA 3LWMA 1R8AA 1MG7A 1EHWA 4F50A 1R7IA 4C8YA 2CVEA 3W1YC 4B3SJ 2W7PA 2EFOA 2E5LF 1PJ6A 2CXEA 2E29A 5EX3A 5HATA 3B6BA 2ZC4A 2LQBA 2IM3A 1RT2B 4G1IA 4G65A 3K8WA 1FDAA 4LVNP 4WYLA 7AT1B 2DRDA 2HQ3A 1HMVA 1UMJA 2YWFA 3IBFB 1MLAA 4N47A 2VHGA 2M7SA 4O3QA 1FFGB 1U7LA 2HWTA 3EGNA 4XPCA 1GK8A 1FK9A 1CC7A 1NPRA 1L3KA 1N0VC 1PBAA 1X4CA 4BWJA 2VDHA 5D0GA 2OFHX 2HW3A 4WTOB 1ACMB 4WIIA 2YQ3A 3HF5A 5T7LB 5HANA 4R8UA 3V2UC 2W8KA 4JI0F 1ZH5A 4A4JA 2YWHA 2DPJA 4A48A 2QX0A 3I9V9 3KK2B 2L9NA 4Y2AA 4ZVHA 4G1QA 1VRUA 2GJFA 2XYHB 3M2VB 5L9XA 2XY7A 2R7XA 3CJ5A 2FHMA 3MM7A 4A8FA 4KFBB 3NKYA 3JYTB 1HPZB 5HQLA 1ZZNA 4YUDA 1FRIA 2DK2A 2R8KA 2RRBA 3O1LA 3ZTPA 1U1OA 2FZKB 2UV8A 2HVHA 2XMTA 4HVZA 1RLDA 3MDFA 3G6YA 3A3OB 2QT7A 5HN0A 1RT3B 1D9FA 2OPPB 4IG0B 4X66F 2RHQB 3DRRB 3GLJA 2YVSA 5HMZA 3A12A 2MKYA 2VV5A 4LRAA 3BDPA 4LF7J 1QAIA 2BKOA 2KB2A 4Q2LA 2VQFF 2ZE2B 1YZ7A 3TZZA 1HNXJ 2IBKA 2ZOMA 5I3PA 1FWLA 3QT6A 4ECRA 2E1AA 1HYSB 3PW2A 2H54B 3B54A 2QZ8A 2W1BA 1EARA 3PYFA 4D3HA 4IO1A 1PILA 3MTKA 1WKLA 3TNVA 5ETVA 3W9JA 3PW7A 1Q0NA 2IMWP 1JLQB 2M88A 1S97A 3SCKE 2MEWA 2LKZA 3T5KA 3OL6A 1PIEA 2JLEA 1CULB 2E5GA 3K5PA 3KFWX 2FJAB 1D8YA 3A8JA 1BGXT 2J9CA 2YNIA 1V5VA 2CJAA 4M1KA 4HL9A 4DSEA 3F0NA 3J7Z5 4F67A 3HD1A 4CO1A 2G9OA 2B9XA 1SUQB 2HFUA 2WB4A 3T9NA 4XO0A 3H25A 4LF8J 4K4VA 3HHLD 1LWCA 2NUUG 2XY5A 1XJWB 4K50A 4AYBD 3ZTOA 3ILJA 3AJ1A 2DGSA 2IA0A 4XTTA 3D1QA 2KHCA 3BJYA 2DISA 2KG0A 2UXDF 2AU0A 1FRHA 2DEIA 3QFHA 3MR5A 1N4LA 2Z56B 5G0RB 2V9KA 4O4GA 1IVZA 5IWAF 1Q1KA 2IJRA 3PJXA 4EZ6A 4LF4J 4RUCA 3Q2TC 4QIEA 3D6HB 5GAGU 4FYWB 3MAHA 4KT0C 2Y1JA 2V34A 1HWIA 3R8YA 1Y4ZB 2ZFHA 5KFRA 3FCVA 1YJ9S 2HK2A 3FBBA 2UUBJ 3T5HA 1OSDA 1FWKA 3BO4A 3PEHA 1X5PA 1XTZA 3GV8B 4L73A 2GQCA 4ECTA 2YWKA 4FXVA 3SFUA 3HSDA 4DL4A 3SIPB 1YJNS 1S99A 2FPHX 3PRDA 1TKDA 2BANB 2ZJRQ 3KG1A 3UCZP 3W2VA 1YQHA 3TJAA 2VC1A 3W9HA 1VC0A 1QLNA 2XWXA 1EIYB 1OSCA 5EX0A 5B08A 5FD1A 3D6MB 2I9SA 2C22A 5J1EB 2HKEA 2QIFA 4M5DB 5B0GA 3K2YA 4PG8A 1X5SA 2E9TA 2JOQA 2YX4A 4WU2A 1S0OA 2ZBRA 1IUJA 3AQPA 3MI7X 2XC9A 1VQ6S 1KR4A 4OLPA 3NMRA 1N5YA 4RW9B 1F9HA 1REGX 2LDIA 2UUBF 2L9DA 2BZ2A 4FS2A 4LRBA 4DF4A 2B8PA 2E1CA 4RW8A 5D0HA 3VQSA 3DNCA 4Q0BB 1RLCL 3T1HJ 5MAOA 2C3YA 3UD5A 1U6ZA 5KFBA 3PX0A 3DLHA 1SPBP 2GV1A 3SDEA 4H4OA 1S5ZA 3EGWB 3R27A 4L3NA 2OIHA 1C0TB 4XDCA 4QYRA 3SDEB 3RB3A 3TVYA 1QSSA 3D2WA 4DR3F 4Y6IA 4B17A 5KOXA 1NJYA 3ISNC 2CQBA 4QW8A 3CO0P 4PPDA 1EAYC 3TW0A 5KFQA 2QGFB 1R89A 2RIJA 4OYAA 3DLEB 2FD2A 5A0YB 4WK1A 5HQMA 3CCES 3U1NA 1ZM3A 3KHHA 1JQGA 4M94A 4KFBA 3ZZTA 1U6FA 5CD4H 2BBEA 4LQ3A 2MKHA 3DLKB 2HRYA 4FDFA 2YNGA 5F3TA 1Q82T 1IBKJ 4DPOA 3MPWA 3W60A 4KH1B 3MM9A 3TUJC 4GVBB 1T9TA 1YHQS 2HBRB 4ZP7A 2BDPA 4TU9A 3KNGA 1YJWS 4DCOB 4F0KA 3MMBB 4ZP6A 2XZWA 1LW2B 1PC4A 2U2FA 2PE8A 1UAWA 2ZBCA 1S77D 3ILLA 2R7VA 4DR4F 2E1RA 3CDAA 1S6UA 1VMBA 4DV2F 4LT6A 2E5JA 2C3UA 1QAXA 2DNZA 1A0OB 4CT8A 3OBIA 3TUIC 2HZCA 2BQUA 1CJKA 2BOAA 1ZS6A 2E7XA 5C7PA 4QR1A 4ZVRB 5ETPA 4DL5A 2KRRA 3UCUP 1CJKB 1FD8A 4U96A 2HVZA 3TX8A 2VQFJ 1R0BG 2DIUA 1U1RA 2YNFA 2OPQB 2W25A 3RW7A 2ZH4A 3CJKA 2GO8A 2F5GA 3UWTA 3FFIB 2QFJA 4QPXA 3BR9A 4ZCLA 5GAEU 3OVSA 1S79A 2R2UA 4IYQA 1QUVA 2GIQA 3GTYX 2N7CA 5LMUF 4FS1A 4NRUA 4U8YA 4LF4F 2QLWA 3BYPA 3VAHA 1DFDA 4F8RA 2ROGA 1PJ5A 4RBUA 4NXMF 3G87A 4LBIA 3GFZA 1RWNB 1H7XA 1RTDA 3EVMA 3NMAA 1P8GA 1N34J 3QRQA 3IBCB 2AX1A 8RUCA 3N6LA 3HHLA 3EZOA 3KK1B 4F36A 3MMCA 3OUYB 4NCBA 3NGDA 3BGUA 2XS7A 5D3GA 4CO4A 4ETZA 5G4DA 3V81A 3HX9A 4NOHA 5G0RA 2C2ZB 2W4CA 2B6AB 3HVTB 4X64J 4DR6J 2F8HA 1JLAB 1RBAA 4P74A 1AZSB 2AHOB 1JXEA 5IM0A 1U8WA 2MKSA 4UUXA 4K7QA 3BQ0A 4ZVUB 1M5KC 3O5TB 3MM5A 3I31A 1FKAF 4KHPF 4NCAA 3R2DJ 2LXIA 2LEBA 1DTQB 1PYTA 1R6YA 1OY6A 1YJ7A 2RMLA 2B5JA 2AF6A 1T9UA 4NLPA 2I6WA 2HQCA 3DN9A 4YHHF 3H5SA 2E5IA 4B3SF 4HI2A 2CZ4A 1ZZFA 2CZVC 4FKXA 5AXMA 4KIAA 5FIIA 5KFGA 3WX8A 4EMDA 1RHRB 1KDNA 2JNJA 2V2ZA 1AA1B 3DI6A 2BJ9A 3CCTA 1QD1A 1RGVA 3CJTA 3CCLS 4ZLNA 3RB4A 2C2RA 4I6AA 1XNRF 1VQ4S 5ETLA 4QU6A 5AE2A 3KHLA 1IQZA 2ASJA 2ZDOA 3G9CA 2RUSA 2W9BB 3G86A 4OYOA 2JEJA 2H4YB 3FDSA 4LFAF 5J1EA 1FVQA 3DMJA 2RQMA 4ENOA 4USJC 1ZTTA 2G1DA 2JHEA 3HKWA 4USVA 2ROPA 3I4HX 3OXLA 3QT8A 3CCQS 1U1KA 1U25A 2NXNA 1C4AA 3OTOF 2BW7A 2YWEA 4C8LA 3GWCA 2XLKA 5CAAA 3ELHA 5HJYA 4OYIA 5HLFA 2YQ1A 3BZQA 3HULA 4OHVA 5HROB 3CO9A 1CQNA 1PG5B 2KTQA 3BV8A 4USWA 3OHBA 2ZH9A 1NCLA 1MU2A 1RJJA 3DU6A 4X4RA 4DXLA 2N82B 4RR5A 4OV6A 5J2MA 3CDEA 3K89A 2R4FA 4B9MA 2ABYA 1IM4A 4QZVB 4EO6A 3BGFA 3E51A 2CA9A 3KJQB 5KG1A 3OV7A 1N88A 5H9EK 3N9UC 3R6LB 4IFVB 4LR8A 4NL5A 4P2FA 4I4BA 3Q22A 4DV6J 3IWNC 3A1YG 3K7RA 3JQJA 3P5BP 4NLOA 2CDQA 3M6VA 4IDKB 4UTGA 3RAMA 3P8BB 5KG3A 4PXEA 3AB2B 1ZETA 2HQIA 4CYUA 4DR5J 1RKJA 4B3RJ 1Y3JA 1N33J 1VQLS 3CEDA 3K17A 3ZZYA 2C3OA 2DNHA 1VLYA 3D1OA 2E1PA 4DUZJ 5C2GA 2A10A 3D3BJ 1RT1B 3PKYA 1N5VA 3T3FA 4WIQA 1XNRJ 2H5JB 5H9FK 1FFSB 2MSTA 4NYZA 4NXMJ 3I6PA 1RAGB 4OZ0A 4IOAQ 1T02A 1QAJA 4ZVOB 2YBVA 3R5AA 1U2FA 1TR0A 4ILLA 3LP0A 2JC0A 4F7VA 2DR9A 4LF5F 2OELA 2NS1B 4P7TA 3KK3B 1IKWA 2C2KB 3D4JA 3KMSA 1L5UA 1Y0HA 1ICEB 4WJBA 5KFNA 2OPSA 1ZA2B 4WZMA 2ZKUA 2PT0A 4FYYB 3NG8A 1BQNA 1HQEA 4RW6A 1RU1A 1LK5A 1HHSA 1HL6A 3KJVA 2BX6A 2ZEJA 3PIPQ 1NK9A 1FFWB 2WVEA 2VFUA 3W3SA 4Q0BA 1FD2A 2CQGA 2B4VA 1YBAA 1PYOB 3EPIA 1N32J 2COLA 3OLAA 4Z7CA 1R43A 4USKA 4MTPA 5KG0A 4F4YA 2KT2A 4KHRA 5DS7A 1KLMB 2UP1A 1GH8A 3H2LA 1J5OB 1FHTA 2K1RA 1RZMA 5KOWA 2PN6A 3D1HA 4GO5X 3IG1B 2GA7A 2FHKA 4RU9A 4ZIWA 3CCRS 1IBLJ 2BKNA 4M5NA 4LRDA 4KV8B 2HQGA 3V5RA 5LXRA 4ECQA 2ATCB 5GMDA 1JJCB 2DJWA 2ZC3A 4QCLA 1HPZA 4BCAA 5L8RC 3MR6A 3NBPB 4LJMA 4P72A 5KFPA 2OLWA 3MMJA 1WKJA 1KOHA 3KUEA 1N54B 1W2IA 3BKTA 3D7SB 2DVIA 3PCOB 3WBZA 1FJ7A 4NWBA 2HK3A 2ZH8A 4KSEB 3TAPA 5LJ3Y 1B7YB 3N0VA 3G8TA 4A8YA 4B9SA 2CQPA 1Z4UA 4O0IA 3ENWA 4N8NA 4O3OA 5IT0A 4OX6A 4GC6A 2RJZA 4GO7X 5KT4A 4DV2J 1SQFA 1WF1A 3DLBA 1IWGA 4UOHA 3MM8A 4Y34A 2VPZB 3FSXA 3FCWA 3T1HF 5EWGA 5LT5A 4ED4A 1HR0J 4WE1A 2DO0A 1NU4A 2HNZB 1IR2A 3PFOA 3RTVA 3QZ8A 1X7VA 5FDLB 4C8OA 1SC1B 3H4DA 5FDLA 2GC8A 2V4JB 5KFTA 4DR2J 3IR7B 2EPIA 1WDTA 5HK4A 4UOGA 4ECVA 9RUBA 1IBKF 1GEHA 2BM0A 1P9QC 2HFNA 4HTJA 4BWMA 3DOKB 2PDAA 4OQJA 4I7FA 2Y1LB 5B0FA 3D5MA 1NDPA 1CJVA 4DR1F 1J27A 1WJ9A 2M2BA 4M5GA 2H4WB 1C1CA 2BJ3A 1VDHA 4DL3A 4NASA 3UVJA 3KLHB 4CI0B 1BXNA 1X4EA 5DQGA 1R0CB 2HNYB 2FVPA 4MK9A 3W62A 1PBUA 4ELVA 5E3PA 4TNOA 2D3ZA 4O44A 3TAMB 2CQ0A 2ZDPA 3ENQA 3QSYB 2AGPA 2UUCJ 3ZTRA 5C25A 2DNLA 2WSFC 3TI0A 4IRDA 3NGKA 1CBKA 5DZ6A 1KQSR 1WC0A 4Z37A 1T9XA 4ECWA 3O6QA 4P71A 2F4VF 1TMJA 2LU2A 1NB2A 4ERDA 2CWKA 3RUBL 3Q0AA 3GJRB 4PQUB 3MAAA 2EBGA 3ET6A 1V3RA 4YFUA 1H74A 3KHGA 2ACYA 4PXCA 1T9YA 2BOPA 4LFCJ 2DCUB 3ADAC 2GO9A 5KFWA 2R9LA 4LF2A 1OO0B 2G2ZA 5AE1A 2DNPA 4AL6A 1KLNA 4DR1J 3UD4P 2RQKA 4B9TA 5DDOC 1S6QB 3D6FB 4M5LA 1WKKA 1O51A 5DQIA 3G6XA 3PX4A 3DLLQ 4U67Q 4C8NA 5JUMA 2RF2B 3T19A 2KJVA 1SV5A 3OD2A 3PR5B 2C3MA 4K4XA 1WC6A 4JV5J 2OPSB 5CCMA 4PXDA 4KC5A 5KFOA 2HHSA 2AQ4A 4USHA 2XYPB 4JI5J 1XR5A 2DNGA 1U6BA 3LP2A 4NLXA 3DLGA 2VASA 3IAM9 3GB0A 4NI2B 3CCZA 2KXNB 1S1UB 5C24B 2QJ3A 3IO1A 1U8SA 1S4FA 2D69A 1VBKA 4IKAA 1HBMA 4WFXA 4DL7A 2AD9A 1RHQB 2OSRA 2WHOA 4EBCA 3JS9A 2EKNA 4WKRA 4P2XA 1EQ0A 4LMZA 1N36J 3QRPA 4HDHA 1GXTA 4J7CA 3BEGB 5KFAA 1U1LA 3HSGA 1VR6A 2HFOA 2RSQA 1N52B 2RNEA 4EO8A 4LF8F 2CPEA 1XBWA 2OD6A 3LP1B 3A3PB 4OZJA 5D4LA 5A0YA 4RBTA 5B0DA 1U49A 4R25A 4DR2F 4B3OA 3AXKA 3R7BB 2DRAA 4DL2A 5LL6d 2WONB 3Q89A 2FLNA 4OX7A 2XLIA 5K8OA 4MKVA 1OY8A 2RILA 2ZZTA 1LNQA 2VFTA 4DV4F 4DV1J 3CD6S 4C9DA 2JVRA 1JKHA 1KVKA 1HBOB 3KLFB 3T6BA 2QG9B 3GSDA 3BR8A 4X4QA 4ED7A 2BRLA 3CJSA 1UW4A 1RBOB 2M8HA 1XMOJ 4C3MA 4JI2J 4Y65A 3KLIB 3TWZA 1B0VA 2BEFA 3RRGA 3M9OB 3C8YA 2MZJA 5BYRA 3BDEA 1LOUA 1I6JA 3QIPB 1Q8LA 3LF0A 1NSKL 5DG9A 1L3TA 4DSIA 1D9AA 3GQCA 1D0EA 2VBZA 2OPRB 3W2WB 5RUBA 2RUGA 2ZH6A 1DRZA 4LF7F 2G13A 3JQMA 2A2DA 2L48A 2H51B 3MUMP 4U6PA 2IDEA 1DQAA 2F8EX 4Q45A 1FKOB 4DN9A 3CTRA 1D1UA 2H9ZA 1S72S 3LALA 1FXRA 3ZZPA 3UI3A 5KFCA 5DDRC 3AD8C 3G6VA 1KQFB 2AV5A 2AEFA 1HBUB 1Y7PA 1HQEB 1R6VA 1ZBTA 2KN4A 2GJ2A 4U8VA 3VF0B 2VD3A 3DOKA 4C0BA 3HM9A 5KG5A 3G71S 1B64A 4Y28C 1RADB 3ETOA 2NR0A 3M6UA 3V6DB 1BE4A 1V6HA 4P75A 1FE4A 1O6XA 4KGZB 4EGLA 4ZLLA 2DT9A 2Q3PA 4K4YA 4KV8A 1FXDA 3X3UA 1JNZB 1TAUA 4ZIVA 1X9MA 1NHKL 4ZCIA 1IKVA 1LWEB 2ZWOA 3R5BA 3MMCB 1Q5YA 2FVRA 2AJ4A 2YQ0A 2X3DA 3FK4A 4TY9A 3OUYA 2NREA 1EP4A 5GAGI 4RU2A 2NXEA 3PXGa 4C98A 2UUAJ 3MEGB 2NPIA 2V8PA 3V6HA 2J8SA 3HHKA 4GKJF 4LF5J 2LVWA 3NLCA 4ZVFA 3QSIA 3CD5A 1AZSA 2VBWA 2XEXA 3BQ2A 1TKZA 2WK4A 3I0SA 1ZPWX 1UPMB 2CNLB 3OTEA 3HD2A 4JB8B 4RWWA 3DC2A 3VQTA 4DCPB 4ELTA 1SH0A 4DDFA 3CC4S 5A8KA 2OMLA 3DRYA 3RGIA 1F5BA 1ZA1B 2O67A 2LFVA 2DKOB 1XERA 2LCWA 2QA4G 2B7CB 2Q6CA 2P2CB 2CNOB 3RRKA 2D9PA 3OVAA 4JI4F 1G3OA 2L3MA 2M70A 2J7UA 2W2NP 2R2SA 2HS0A 4M63A 4AXJA 3C6TB 2FJBB 3VV2B 4HH0A 2E7VA 2U1AA 1NRKA 1U2RA 3G6ES 4PWUA 2R2RA 4ECYA 3QATA 5B0AA 5D8HB 2OEKA 3GIMA 3FUYA 1SJ4P 1L3UA 1J5EJ 2MLXA 4L76A 1RWPB 3UN2A 3JSRA 4ZN3A 3I5CA 5BR8F 3GE9A 1AFIA 1HFEL 1ZTWA 1HA1A 2CFXA 4LF6F 4X62J 3M2UA 5L1KA 2V9WA 4OIXA 3V4IB 2VA2A 4NMLA 4ZDNA 3M2UB 3D54A 2IHR1 4IQMA 2EVZA 2V68A 4DPYA 4ZLJA 3RB0A 4KJIA 4LFBJ 2J7WA 4KHPJ 3QRRA 1TP7A 4MFBB 3OQ2A 2GAHC 4ANCA 1RWMB 4FZVA 4ZVTB 5KFIA 1WDDA 3U1MA 2FDNA 3DDNA 2DGXA 1XEZA 3OR1A 2MZSA 1BWEA 4TQSA 2ILYA 4IG3A 4EYHB 2G2YA 1HNVA 1U09A 5K8NA 2YWWA 4LSLA 2GQQA 1C4CA 2OAUA 3ICLA 1RK8A 1FRMA 5F9LA 1LWFA 1FNXH 1R8BA 4OI2A 4CNZA 2XSFA 1REVA 1AYEA 3H0PA 4C8MA 2BQ3A 2IA6A 4OJHA 2BE7D 2V94A 3MEKA 3TZWA 2W7OA 2L08A 1JX4A 1CLFA 4KGKA 4HACA 3HSZA 3SEOA 2CPIA 2Q1LA 5HP1B 1F3VA 2DO4A 3PRVA 1GX5A 4QIFA 4J9KA 3NNHA 2CQ4A 3DCAA 4O3SA 3VZIA 2GFFA 2QA1A 4L6V3 2GGPA 2QSWA 1TFWA 2XNQA 3ZO7A 2GMLA 2HBQB 3VGSA 5A8WA 2D74B 3LPYA 2YKMA 2DNYA 3GIRA 3D9BA 3QIDA 1M1KT 3OVBA 1JLGB 2KXHA 2YY3A 1QDUB 1F2GA 4FXWA 4NMXA 4DBQA 2R8HA 2H5IB 4JI7F 3FKBA 1TL3B 2F9DA 3W61A 1UKUA 2DNRA 5IOLA 2AYEA 5AXNA 2WVFA 3H2UB 4FYVB 4X64F 4DR6F 2RF2A 3M32A 4UF4A 4AL7A 3EDRB 1YVFA 3OTDA 4JI2F 5CXTA 3GONA 3LAMA 4OZNA 1RISA 2MKCA 1QSYA 1S12A 2R42A 5J2NA 3R5CA 4Y2CA 3M9MB 2YX1A 3RBZA 1RTZA 3S8SA 2D3O1 3BB5A 5LOQA 3B8HA 2CYYA 3HXMA 4L74A 3VAIA 4OI4A 3TEHB 4KKOB 4C2MA 1MNEA 2KZMA 4RW7A 2VPXB 1GAOA 3MZIA 3WC0A 2N3LA 3DKDA 5GAHU 3KMQA 2EC0A 3HO1A 4H54A 2ATLA 2HZAA 3FSYA 3GJTB 4WTYA 4UT4A 1NKCA 1S1TA 1S1WA 3OLBA 4JI6J 4QR0A 4ED5A 1LQ9A 3U1LA 3Q8SB 4FBTA 3QGIA 2RDDA 3W9IA 1S1TB 1N36F 1WOPA 4ELUA 1WC3A 4OYXA 1S1XB 5IV4A 1EP4B 3KG4A 4CYUB 3HDSA 4CLTA 3PKMA 4IQXA 3T6JA 4CLLA 5I3QA 2IPOB 4J9MA 1IR1A 3R5DA 4B3TJ 1JLEB 5ETKA 4HKQA 4XPEA 3E01A 3RR8A 1T05A 3FBEA 2V8GA 3HVWA 3ZTQA 2C2OB 1MROA 1EETA 3W8PA 3EPGA 3NCRA 4JI5F 4P6QA 4LBHA 4ID5A 4PYDA 1JKHB 5IC6B 4RNHA 4C11B 3MGJA 1EETB 1FJGJ 2RVJA 1ULRA 1VCTA 4CLFA 5FJ4A 3O3LA 1VQYA 1B0TA 2GHVC 5M2PA 5KT6A 5K9FA 4JI3J 2J6UA 4OZ1A 4HHJA 5KT3A 2VG7B 1QSLA 5K20B 1BQMA 3M8PA 2W4DA 2PA8D 4NZ0A 3RYLA 1YITS 4F02A 5K14B 2A6MA 1SIZA 3NS5A 3ONQA 4GVLA 2C28A 4DQPA 1YK9A 1NO8A 2JFKA 3W7BA 2A3JA 5SZTA 4F2RA 3C6TA 3TUZC 3KJVB 3VGTA 3LAKA 1S6OA 2UVVA 2KJWA 3IM9A 2QMUB 3VAKA 2YNGB 3POTB 1WORA 3MCOA 3N6MA 2G0IA 2NCKL 5DG7A 2LXUA 4KE5A 4M95A 2F7VA 2CQ3A 3US5A 2ZOGA 3UCGA 3K8VA 5EUHA 4IFYA 1RCOB 5B0BA 1T11A 1IBMJ 2W2OP 2F4VJ 4PEOA 2HNYA 2R2TA 1WG5A 4LIRA 5DZ7A 1TUWA 2DXEA 4AXIA 5B09A 2VICA 2AW0A 5AT1B 3M8ZA 2ZHAA 2FLPA 2XMKA 3HPOA 1VBZA 3M8QA 1WEZA 1IBMF 3PIOQ 2NXCA 1BY9A 5IWAJ 2QL5B 3NL0A 2ZUAA 1LW0A 2QRRA 2HGMA 1Y5LB 3A13A 2W24A 5ETSA 1TV6A 2CG4A 3VVTA 2VF3A 2RU3A 2J9EA 3O2IA 2PSZA 2WB1D 3GIJA 2MZTA 5KG2A 3QYYA 3CDUA 4IH6A 3QBCA 4I68A 3RJMB 3B78A 1UVLA 3NRBA 2W9CB 4TKTA 4U7UK 3NGTA 2POKA 2JSXA 2R7QA 1J5OA 4U9RA 1R0AA 1T9WA 3JAMY 2EFVA 3JSMB 3OSNA 1LEOA 1NHVA 4F2SA 1G2EA 1K1QA 4H4MB 1OIAA 1R8PA 2C42A 1GMWD 2LEAA 2LQ5A 3DLJA 2YKNA 3GYGA 4P52A 3K5NA 2NSBA 3E2EA 2E7WA 2ROEA 4BC7A 3JSYA 5LXYA 1GXUA 3GCWP 3IRWP 4N5SA 2W9BA 1T3OA 2GVDB 3GSIA 4ECZA 4ED2A 2V50A 4GVBA 3ULHA 2XBPA 1KN6A 2HGNA 3B4MA 4WFZA 1ZPVA 1H38A 3FRZA 2PO4A 2GX8A 4YDXA 2D3OR 2JRSA 3OTBA 4OZ5A 2ASLA 1SL1A 4Q44A 2HIYA 4DX8H 3PO5A 1GMWA 3QO9A 3KXDA 4ZVQB 4CRJA 3CMAS 1DURA 2B5JB 4MFBA 1V3ZA 5L46A 3I4PA 8AT1B 5KT2A 2AGQA 2XMMA 3DRSB 4NEZA 3U02A 4WFBQ 3H40A 2HGLA 3RB6A 4FBUA 3HKZD 2AJFE 5CYQB 5J2MB 2ZH7A 5E3CA 3DI6B 3CCSS 4TVAB 1F0XA 4OL8A 4LRCA 2V4JA 4CDIA 3BO3A 1NJIT 4LSNA 3AOAA 3PW5A 2P5VA 3L7UA 2ZJPQ 2RAQA 1S0MA 1W25A 3GPAA 2HHPA 1UJ5A 2UZAA 4JV2A 5I42A 2FGOA 2AJ0A 3ET6B 3MMAA 1VK3A 2CUYA 3CCWA 5IFMA 5KTQA 3M8RA 4I2QA 4MH8A 2IJNA 2Z58B 1JLFB 2P9CA 3KJNB 1X5TA 3UVJB 2LA6A 3KUGA 4C3LA 3TR5A 1JLEA 2HMIB 5AJ3J 1S6PA 2M3DA 3OW2R 2R7UA 1HBOA 5KG7A 2HMIA 1IXKA 3JQKA 1PCAA 2EFGA 3H2VE 3DGVA 4ZK7M 1KD1T 4N41A 1UJ6A 4LF9J 4QYZJ 1KP6A 3SCLE 1RT1A 5D4NA 1N8RT 3C3LA 4RKUC 2R7RA 2Q43A 5KFFA 2WOMB 1UCNA 2G2OA 3FRYA 5DJBA 4B3TF 2ZH3A 4WBFA 2J76E 2YH1A 1KFSA 2VJVA 1U02A 2PFFB 2RU9A 3N01A 2B43A 1ZM2A 4MKAA 4EEYA 2NYIA 5J2NB 2FJVA 1KQGB 3M4XA 5HAOA 2YKQA 4DUZF 1E6YA 1NH8A 2RH3A 4I0WA 1F9EB 2CDRB 3TOQA 4URGA 4RNMA 2F8MA 5BYSA 2RS2A 3SI8A 1M5OC 3OTCA 1WACA 5HVGA 5JMNA 1K0VA 4LIWA 2GMJA 2DR5A 3CDBA 4ZPCA 2BA9A 1VQMS 1RP5A 3UFCX 1HBMB 3BSOA 2IM0A 1N48A 1WI6A 4K5SA 1ZYQA 3TUPA 2EXUA 4IH7A 1N0UA 1FERA 1YGYA 2FC8A 4DV6F 4ECXA 4WFYA 2DBBA 3UNYA 3PR4A 1JLCA 1C0TA 2VFSA 4F04B 1QAYA 2V4RA 5M2UA 4E8UA 4X2BA 1UVNA 1SV5B 2JC1A 1VQ7S 4Z2XA 1Y00A 1FJCA 4CCHA 4DCJB 1KKHA 1T03A 1P6TA 2XLJA 1URNA 1DQ8A 1M5PC 2ZOFA 1SUQA 3IA0A 2ZD1B 3PZPA 3IRXB 3DLKA 1UJ4A 4J90A 4X62F 3JTOA 2XS5A 2DHHA 3MFHA 1BQNB 2BACA 3DYAB 2HRUA 2R8GA 3ZZUA 4OX8A 4XK8C 5BR8J 1U48A 2ZZNA 2M0GB 1J5EF 1HD0A 2B9EA 2PI5A 3DYAA 1FF2A 4F4KA 1F2HA 1FDBA 4WPAA 5B7WA 3M05A 2QMXA 2I8EA 4DV0F 3KWMA 3QIPA 2G0JA 2FGCA 4K0KF 2M5YA 4DPWA 1YSJA 2W2MP 4OI3A 3GIIA 2V4QA 2PGCA 1KRPA 1FRXA 2YNHB 1UZDA 5BYQA 1FJEB 3NCPA 3KYLA 5E3QA 2KI2A 1OPIA 2VG5A 5AXKA 4PG4A 1C2PA 4HHUA 4N7TA 1JJ4A 4KGVB 2WONA 1FCAA 1N5SA 2WZ1A 1VS3A 1KBRA 1TVRA 4UW2A 4PKDB 4NPOA 1OPZA 1M90T 1RSCA 2A0FB 2AEMA 3VAJA 4B3MJ 4CQ1A 2DY1A 2MHNA 3WIVA 1I3OB 3CJ4A 4YHHJ 3BM7A 1NEEA 1SI9A 4KY3A 2QC3A 1URRA 3R97A 3Q86A 3VVUA 3VR1A 4BC9A 5JVHQ 3SSRA 4DN0A 3KDNA 1RTJA 2YX7A 1C1CB 4PPZA 2RB7A 3W2VB 4DL6A 1V5IB 3NS6A 2E1MC 3HSJA 2MZRA 4ES2A 4P10A 5A2QU 2E9RX 1S49A 4U7UD 5CD4A 1NM2A 1R3NA 3DGPB 2KL8A 2Q66A 2UVWA 4QWCA 3GIKA 3CMES 1L3SA 2O66A 1YRTA 3B82A 1RWUA 2K3KA 5AXLA 2UVRA 4NLDA 4DU7A 3OR1B 4LREA 1N5YB 2Y0SD 3RBEA 4NCGB 1E6VB 1Z2ZA 3D0GE 3KOAA 2IVFB 2EBEA 2ASYA 2BJ7A 3I0SB 1MSWD 1BLUA 2F1FA 4Y2MA 4PRFA 4HHHA 1X31C 3DM2A 5SUHA 4CM2A 2WBMA 1G4CA 1VQSA 2V6AA 3DHXA 3OJUA 3ZC4A 3J7AN 4M5IA 4I69A 3GJSB 1DTQA 1WSVA 2MKJA 3TQEA 4F3OA 3OXFA 1VQ5S 5IS2A 1VRUB 3M2VA 4NXNF 3DOMA 4DQQA 3BGRA 1O8BA 2OMOA 2Y1IA 1T94A 2I0XA 1SC3B 1HNWF 2I5JB 3ZZ0A 5CYMB 2KRBA 4DU8A 3J80Y 2I5JA 4C3KA 4DR7F 2CQ1A 4KB7A 3TAMA 2CRLA 2F3JA 4NLSA 4UY85 4X4NA 3CDWA 4DFJA 4JI1J 3BBFA 5A2QY 2W2PP 4RWXA 1T3NA 4ZP9A 4K4UA 3HT3A 1NHUA 4DV4J 1SJRA 3JB9k 4K2JA 4DV7J 1WHXA 4UUWA 5FLXU 1CEZA 2V2KA 1IKYA 5GADU 2HHHJ 4K2XA 4X65J 3ZNJ1 2DY9A 3VGVA 2ZM6F 1Q86T 2HHTA 2HHVA 4ZKAA 5HROA 6FDRA 2DIVA 2MQQA 4OX9J 1UVKA 3GV7B 2BJEA 1NPKA 4ZS6A 2PEBA 4PCQA 3THTA 4DQIA 4OMFG 3FMBA 2HHWA 4ECUA 1LKZA 2OTLS 2MYFA 4ZP8A 3MR3A 2EKYA 3LO3A 2DHAA 4OJ1A 2DGTA 2B4OA 5AE3A 3CJKB 1ZAXA 2AX0A 4I2QB 2EWHA 1F5AA 1HMVB 1RWXB 4KGXB 2NSCA 4LQ9A 2OD4A 1VQ9S 4A8KA 5I42B 1Y5NB 3SXLA 5J1NA 2R7OA 4QWAA 4DMZA 3EDQB 6FD1A 2GGPB 5E2QA 4R8UB 1TL5A 2E66A 3J80U 1FT8A 3UDCA 4J9RA 4MYTA 2XS2A 2JEFA 3BH7B 3OJSA 3KK2A 3FVYA 3N4WA 4A8QA 4JI1F 2M4MA 1RHMB 3THVA 1Q8BA 2IAJA 3MM7B 3PRBA 3QT5A 2XB2D 2XZDB 3UE2A 1S7IA 3KLGA 1SJ1A 2OTJS 3TA0A 2RHSB 1HIYA 1N5TA 1RDRA 2HURA 3OR2A 3R7SB 4WFNQ 4ZPVR 4C6AA 4LSLB 1BD6A 4FKYA 3VAFA 1FTCA 1FO1A 2GMHA 3HVRA 3FZBA 4IR9A 2V69A 2DRBA 2RDIA 3CIMA 2UVUA 4LFBF 4NXNJ 3CUNA 4DLGA 2FLOA 1NDCA 1RBLA 3BGLA 1TL1B 4CLPA 2J5AA 2UU9F 1KQKA 1OY9A 2XULA 3MCNA 3EGZA 2FLLA 1T7PA 2MJNA 4UQTA 3K0JA 1RAIB 3QQCD 4WWSA 4QWBA 2DGQA 4TYBA 2K7JA 3NNCA 3CWJA 4LR7A 2XO6A 1HNZJ 3V6KA 4C4WA 1LXNA 1LK7A 3Q8YA 4OLOA 3S01A 4EK2A 1W7WA 4YDDB 1BWVA 3CCVS 4ED3A 1PO6A 5BJRA 1WOOA 4QJVA 4AUKA 3SSSA 3D6TB 3SFGA 5KFYA 9ATCB 5F41A 1ZAVA 3OSPA 4KPYA 3BREA 4KH0B 4PG5A 2N4DA 1QE1B 5DDQC 3UDEA 1NAQA 3MD1A 3M7VA 5EHHA 2L41A 4K4TA 1S1VB 4ZCMA 2UXBF 5KFDA 4DHVA 1VGYA 2R7SA 1GMUA 3TJ8A 3PVXA 2RRNA 4IUFA 1F60B 3PJWA 2NXJA 5DM6Q 1VISA 1RT4A 2DNQA 2HAIA 4P2SA 2NZCA 4AD6A 4WK3A 2KO1A 4USTA 4YB5A 3H5UA 1T03B 3Q8QB 4AQYJ 2B51A 2HWIA 3LP2B 4RW9A 3MPDA 3I56S 3BSCA 4PQAA 4K4WA 2FJDB 1JWWA 5C5JA 2FYXA 1X8DA 3PY8A 4FNIA 2Y8YA 1ELOA 1S9FA 4J9UE 4RW8B 2A2CA 1FRLA 1H2UX 2DNOA 2LMIA 3VGUA 2CG8A 3P96A 5CZXA 1OS5A 2WBRA 1KSPA 1HQUB 2CJXB 1NDLA 2CPXA 1F6TA 2V5HG 4ILRA 2BRKA 4C8KA 1RUSA 2DTJA 4NA1A 2ALZA 1S0NA 2PMZD 2FY1A 2OO4A 3VALA 3FC9A 4JI8F 2DYAA 4O0NA 3BKFA 2BABA 4ZA1A 3W65A 3IS9A 3QLHA 3P5TL 1YG0A 2WRMA 2VG6B 2N4CA 1IR0A 4DV0J 1KS2A 3FBFA 5LSLA 3MUTP 3R1HA 3N6NA 4CLYA 4DG1B 3OL7A 3WDOA 1X4BA 2HLUA 3RG6A 1P1LA 1TKZB 3I32A 1A7GE 1FNMA 3I0RB 5C42A 2IJFA 3QNWB 2X1GA 4NLTA 4X66J 4DPUA 1Q53A 5IT9Y 1CSJA 2CPDA 1LW2A 4O4RA 1KOOA 1RTHA 1GTEA 1QTNB 3CGIA 2P6TA 3HFKA 3ZTSA 2MGZB 4PAAA 1XQIA 3PFEA 3VTIA 3AY0A 1VHFA 4CZCA 4UZBA 3RAQA 1SH2A 1NK0A 2KKHA 2B9YA 2BV3A 4YY3J 4Q43A 1HD1A 3KK3A 3W5ZA 1GT8A 1E6VA 2DB1A 2HFVA 3MPUB 1P27B 4RPFA 5DETA 3W64A 5C25B 1CULA 3WHIA 2I38A 1SQEA 3H42A 1ROFA 3EVWA 3JXOA 3NP5A 3PM9A 1FNOA 3W8GA 3WX4A 4EU0A 1HBUA 4OZLA 2FZGB 2YNIB 4PR6A 1N32F 4B9VA 1AB8A 1NLKL 2OI2A 2VQEJ 3BBBA 1S10A 2H48B 4KRWA 5HJXA 1VI7A 4DI6A 3AT1B 4HACB 2BMBA 4M5KA 2KM8B 5DQHA 3UPFA 2J0XA 1Q8KA 3C19A 1UVJA 1HI8A 5HBMB 1WHYA 4ZVEA 4CO0A 2QLFB 3Q8PB 2XHCA 3MF5A 5T7LA 5CQGA 5KFKA 1IKVB 1LWEA 1RTDB 2QN6B 1N33F 3BGRB 5KG4A 3V81B 2BYCA 2CPYA 3TEGA 7FD1A 1VBYA 3CC7S 1XR6A 2MLZA 5IQQA 1NK5A 1JLAA 2W9AA 3NBPA 3TX0A 1CS4B 1RCXB 4DV5J 3SCJE 3I5BA 1T8EA 2CPFA 4PZVA 3WZ0A 3SV4A 4LF9F 3UDVA 1SKUB 4CO5A 4A8SA 3HI9A 3CCMS 1LWFB 4R0EA 1TK5A 4OFZA 2KYXA 4J9VA 1UZHA 4F4AA 3EM1A 3HZEA 3K5MA 3H90A 1QVFR 2DR7A 1KVJA 2VOOA 5GMEA 1U0HA 4X4SA 1MMDA 2Z2MA 1S76D 3DRRA 2XI2A 5HP1A 2RS8A 3DLGB 1MWQA 3MUVP 1S9EA 3GU0A 5D0EA 1VJWA 3KNAA 1HWKA 5T14A 4H4MA 4TN2A 4QU7A 1BQXA 4H4KA 1SC4B 1HQ2A 2CVIA 3NGUA 2MB0B 3NNAA 5HVFA 6AT1B 4QWEA 1IKXB 1SJ3P 3MOJB 1C1BB 3OL9A 2GS8A 2VU5A 1K47A 2ZVIA 3R7NB 2C2NA 4WCEQ 2R8IA 3FFIA 1X4FA 2DXFA 3NGRA 3A4TA 3LTOA 4Q2MA 1KONA 1RABB 2QTWA 3GFHA 1YJVA 3M32B 4M5JA 4L72B 1RT6B 1RTIA 1U26A 2HHXA 1UA1A 1UP1A
chains in the Genus database with same CATH topology
4HH1A 3M2RA 4FVCA 4CO2A 3CD0A 1UEUA 1YJUA 1X4AA 1FE0A 4W90B 4MK8A 2DGWA 2MZQA 1SC6A 4HT7A 3PEJA 1HI1A 1TZ0A 3KG0A 5L1IA 2MQMA 3DRPA 2Z0GA 3CE8A 1FVSA 4F4XA 4A8MP 2WSEC 1WTBA 1UWBA 3TQ1A 4X84A 3J7A1 3FCHA 3KTQA 3QWUA 4DEZA 5B0CA 4EWTA 2BVZA 3IBWA 2K3IA 2MDAA 4FPRA 1M0SA 1TL1A 4ID8A 1R31A 4U7CA 4AQYF 2XSJB 1B0PA 4TQRA 1DTTB 2X51A 3TO8A 2IYIA 4HT5A 5CHCB 4QWDA 2Y1RI 4I6YA 4IFYB 2UXCF 1RT7A 1TKTA 3ZZRA 3PACA 5F8JA 3AQOA 2FTRA 3HK2A 5T41A 5IT4A 2O5DA 3AH6A 2IM1A 3FEZA 4M5DA 2BM1A 4DQRA 3GG1A 1TK8A 2MQOA 2QLXA 3MEGA 5FLXY 4OJ3A 2PC6A 5HLFB 3K5OA 4TLQA 2UUWA 3I55S 2W8LA 4X4PA 3RU0A 2J6TA 2GJIA 3UDLA 3VZHA 4KTQA 4HTIA 2DH9A 3FMWA 2ZZMA 1JLCB 1RT5A 2P9EA 3DOLA 3C2PA 3CCUS 2XMWA 1S1WB 4MMOA 3TYTA 4ZPTR 2X1FA 3PHEA 3RRHA 2QMWA 3WC2A 4ATNA 4KO0B 4CTAA 5HO4A 4MKYA 2FB0A 1ZOTA 4CTAB 3DLEA 4RUHA 2VL1A 5KFEA 2AP6A 3IRXA 1Q78A 1S0VA 2B3TB 2VG6A 2DD8S 4JOUA 3MOZA 3I0RA 1H6KX 3R3TA 5E33A 1QY7A 2XWYA 2FJWA 1V9OA 3M30A 2AYBA 4NLWA 3MPVA 5E5NA 3G8QA 1NJXA 2ZNYA 3BSNA 3K5LA 2MGZA 1OQ3A 2ZE2A 5A6WA 5HQ8A 2OPRA 1HARA 1HYSA 3H8YA 2CJBA 1AROP 3KLEB 3FJ2A 3LP0B 3G4SS 5LMNF 2VOPA 5J1PA 3C46A 3DXSX 5J2PB 4DQSA 1GQEA 2HNZA 4NA3A 3U27A 4B9NA 1RT2A 4TU8A 2YKNB 4WKYA 1KTQA 4TYAA 3CXCR 1C1BA 4NLUA 2D9OA 1WELA 4DV7F 2AJQA 2O3DA 2KM8C 2ZVSA 2D7SA 2OP5A 2YTCA 2Z2LA 3DDKA 4C0HA 4F25A 2XGPA 3HVAA 1RTJB 3MHYA 3DXBA 3LW5C 2B56A 4CT9A 2JLGA 3CC2S 3T1YF 1YHQS 1IJFB 3IWLA 2IM2A 2PEHA 2L9WA 2QV6A 2VC0A 2K8GA 5KFLA 4PWDB 2XI3A 4F3MA 3TA1A 3DFEA 4KGMA 2HPUA 4O44B 4X4TA 3CIZA 3OFGA 2AYMA 1W2BR 1FESA 2ZBIA 2VODA 4WXOA 3FEXB 1F5CA 3DRPB 4O4GB 1TV6B 3H5XA 3QJLA 4I67A 1M5VC 2RKIB 3HJFA 1HBNB 3C6UA 3FSIA 3P3DA 2CJ9A 2IVMA 1RA7A 2LA4A 4P7VA 5L1LA 2GHWA 3IR5B 3NWGA 4MIWA 3JTPA 3OL8A 2LYVA 2FJEB 3GZ7A 1UVMA 2GQ2A 5H9EJ 4DSLA 4XDDA 4F26A 1UFLA 2Q79A 1IKXA 1LXJA 4JV0A 2BANA 2X1BA 2MKKA