1SDSA

Structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
b'AVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords box H/ACA sRNA
publication title Structure of Protein L7Ae Bound to a K-Turn Derived from an Archaeal Box H/ACA sRNA at 1.8 A Resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein/rna complex
total genus 38
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1sdsA00
1RLGA 2KTVA 3ON1A 3V7EA 1IPAA 5DCVA 3LWOC 2FC3A 2QI2A 3RA5A 1E7KA 1Q86H 1M1KH 2VGNA 5EWRA 1VQKF 3CPQA 2ALEA 1VQLF 2OZBA 3CD6F 3O85A 3J81M 1RA4A 2OHWA 1VQ8F 4X3LA 3OBYA 3NMUC 1VQOF 3LWRC 3CC7F 1YJNF 1K9MH 3CCVF 3CXCF 4LCKA 2JNBA 2AIFA 1VQMF 1DT9A 1W41A 1YI2F 2LBXA 3RA6A 2WALA 3CG6A 3CCQF 2OTJF 5EO3A 1X7OA 1YITF 5GIOC 5G4VC 2I6DA 3PAFA 3JCMM 5FLXM 1Q82H 5FJ4C 3LWPC 1GO1A 1VQ6F 3CCLF 3N4ZA 1W3EX 3FFMA 3CCUF 1QVGF 1W42A 3NVIB 1JJ2F 1PXWA 1NMUB 4BW0B 3LWVC 1KD1H 3HAXD 1Q7YH 1T0KB 3CC4F 3G71F 3GYQA 2QEXF 1NJIH 1VQNF 3HJWC 4X3MA 3CCRF 2BO1A 3AGKA 5GIPC 1YHQF 1M90H 1SDSA 3I55F 3NK6A 2KG4A 5GANK 2HVYD 5IT9M 3WXMB 3OW2F 1X52A 3LWQC 3SIUA 3CMEF 1K73H 3CCSF 5A2QM 1KQSF 3E20B 3G6EF 3CPWF 3G4SF 1YIJF 1YJ9F 1W2BF 5G4UC 3CMAF 2QA4F 1S72F 1VQPF 1VQ4F 4C4WC 1YJWF 3MCAB 1KC8H 3SIVA 1VQ9F 1W40A 3NVKE 3JAMM 3CC2F 1VQ7F 2CZWA 2VGMA 1CN7A 3VMFB 3PLAC 1X7PA 4TZZA 1VQ5F 2KTUA 3CCJF 5GAPK 3N4YA 4NUTA 3J7AR 3VI6A 1H7MA 1Q81H 1CK2A 3CCEF 3J80M 3IR9A 3NK7A 3V7QA 1GZ0A 5GINC 1K8AH 3CCMF 3LFOA 1QVFF 3E1YA 3I56F 1N8RH 2LBWA 1XBIA 1GO0A 1ZWZA 2OTLF 4BY9D 3OBWA
chains in the Genus database with same CATH superfamily
1RLGA 2G9IA 4RQOA 4HNAB 4X20A 3RYFA 4BT5A 3V7EA 3MQWA 3JALB 5HP8A 4X1IB 5CB4A 3NMUC 2DT4A 2EWCA 2YYEA 2HRUA 2RHHA 3JARB 4O4IB 3RYCB 3CC7F 3CCVF 3CXCF 4LCKA 2BTUA 2AIFA 1VQMF 3ESJA 2GZLA 2LBXA 3ELCA 4I4TB 3ERNA 1U40A 5CA0B 3HKCB 3WGLA 4DRXB 5JVDB 4IIJB 4U3JB 3KJKA 1XRGA 2I6DA 3PAFA 1Q82H 5HP7A 5IJ9B 2CWJA 2CW4A 5KX5B 4ZHVA 2RHOA 1GO1A 3JASB 3D00A 3FFMA 4X1KB 1DBFA 3S06A 4BT6A 1QVGF 1W42A 3VCZA 3HKDA 3C9UA 1NMUB 4BW0B 3WGMA 3LWVC 4O4LA 2VAMA 1QD9A 1Q7YH 3T80A 1SZQA 4ZHQB 4R40B 3AGKA 1TVKB 4E6EA 1SDSA 1TUBB 4TV9A 5GANK 3F0GA 3WXMB 3ZOPA 1X52A 1JFFA 4YJ3B 5HY4A 4O2AB 3SIUA 2B33A 5BMVB 5IJ0B 5ITZA 3CCSF 2QTPA 2Z1UA 5CA1B 3FBAA 3E20B 3Q8HA 5LYJA 3G4SF 5G4UC 3K2XA 2DYYA 3VYUC 1VQ4F 2H8CA 1VQVA 2R751 3R0PA 2UYPA 1KC8H 3VYTC 5GONA 4BT3A 3C8LA 4ZHWA 3CC2F 5LOVB 1VQ7F 2VGMA 3VMFB 4TZZA 1JD1A 5GAPK 1H7MA 3KJJA 3L7QA 1W55A 3IR9A 3V7QA 2I6RA 3WPXA 4I55B 3TD3A 4NQ3A 1JY8A 2CHSA 4I50A 3ZP4A 5KMGA 4TV8A 3TD4A 5EZYB 3RYHA 3VIUA 2N48A 1ZWZA 1NQ3A 5MN4A 2OTLF 5LXTB 2LBTA 3OBWA 2VXYA 4C8EA 3S0HA 4FFBA 2KTVA 3MDOA 3ZP7A 3IMPA 2Q1XA 1Q86H 1E7KA 3RYFB 4ZK7A 2ZOVA 1M1KH 2VGNA 1QAHA 4BVSA 4YJ2A 5HY0A 3HKBB 3OBYA 5C8YA 5CB4B 1YJNF 1K9MH 2KGWA 3JATA 3ZO8A 2CSLA 3CCQF 2F9ZC 5EO3A 3DC2A 3WGKA 2RHJA 1YITF 2HS3A 5G4VC 3JCMM 5FLXM 2ZF8A 4B62A 4EB6A 2ZVZA 3K12A 2ZVYA 4EI7A 2HS4A 3N4ZA 4B5CA 3QTYA 4C82A 2H6LA 1KD1H 3HAXD 1T0KB 1NJIH 3F6MA 5GIPC 2UZHA 3HKDB 1YHQF 3WGJA 4O4LB 3IEWA 4BVRA 4B45A 5JH7A 1W581 4TV9B 1K73H 1JFFB 4O2BA 2UYNA 1QU9A 3G6EF 3CPWF 3EORA 2QA4F 5LYJB 3JAKA 3CYPB 1KNKA 1FFXA 2W8BC 2UYKA 4ERHA 4WBNA 1VQ9F 3FD5A 2FGYA 2ZODA 1J7HA 4BT2A 3N4YA 4NUTA 3LMEA 1ONIA 5GONB 1FNJA 5HWEA 2R6R1 4EI9A 1Q8RA 3NK7A 4M8IA 1ODEA 3FD6A 4O4IA 4C8GA 3LFOA 1W5FA 4ZHYB 3E22A 2LBWA 2HP0B 4I50B 5EIBC 2CHTA 5KMGB 5EB1B 3HKCA 4TV8B 3V3TA 1RQ2A 1U3PA 1YQNA 3HKEA 1COMA 3ON1A 1W5AA 5KX5A 1JN1A 3JAWA 3P0ZA 4ZOLB 2FC3A 2QI2A 3RA5A 4LNUA 1VHAA 3UT5A 3B6NA 5EWRA 3C9TA 2OZBA 4X1YA 3K14A 2Q1YA 2IQQA 3O85A 3CD6F 3J81M 5EYPB 3WGNA 2UYJA 3N2KA 1VQ8F 4G4VA 4ZI7A 3LWRC 1SA0A 2JNBA 1TUBA 3C9RA 1DT9A 1YI2F 4EI8A 3RA6A 2RB9A 2WALA 3WPWA 2Z1EA 2HQSC 3JATB 1UI9A 5BMVA 3S0YA 3LDTA 1KNJA 2GLZA 2VAWA 1X25A 1H47A 1T0AA 4TUYA 4X20B 5JQGA 3VO8A 1VQ6F 3CCLF 5FNVA 5J2TA 4EB6B 3CCUF 3NVIB 1PXWA 3CC4F 3G71F 3HJWC 4X3MA 3F0EA 2BO1A 3DDNA 4F6RA 2CVLA 3M84A 1XV2A 1Z5WA 2IG8A 1M90H 3GHZA 3I55F 3NK6A 2KG4A 3S03A 3RE3A 2ZAUA 3HTNA 3VOBA 1W59A 2HP3A 3CMEF 3TD5A 3K0TA 5A2QM 4U39A 5JH7B 4C81A 5IYZA 3MCQA 5EIBD 5LA6A 1YIJF 4O4HA 5LP6A 3D01A 4O4JA 1YJ9F 4G4XA 1W2BF 4O2BB 5HY1A 1PF5A 2UYNB 5EAZA 1S72F 1VQPF 3WJRA 4IHJA 3D54A 1U43A 1W40A 3JAKB 3NVKE 3JAMM 1FFXB 3IEQA 2CZWA 1CN7A 3PLAC 4WBNB 1RLUA 2AMTA 2P6YA 3CCJF 4G4WA 1RQ7A 3VI6A 1Q81H 1CK2A 3N2GA 3CCEF 2Z1FA 3J80M 3HKBA 1IV3A 4BVQA 3IKEA 3FPIA 1K8AH 3CCMF 2BTQB 3P10A 4BT7A 1QVFF 2GVIA 3E1YA 5ITZB 1N8RH 5J2UA 1XBIA 1GO0A 3RYIA 5AVMA 3KIZA 4PWTA 3E22B 2MQEA 4HNAA 2RHLA 3JVHA 3JALA 5B8FA 4X1IA 1IPAA 3HKEB 3LWOC 5DCVA 1CLIA 3JAWB 1VQKF 3CPQA 2ALEA 1VQLF 1FNKA 1YGYA 3JARA 2K1SA 5LP6C 5HY2A 1RA4A 4LNUB 1H48A 3UT5B 2OHWA 3RYCA 2YXZA 4X3LA 4C8IA 4X1YB 3CYQA 5MN6A 4I4TA 1VQOF 2Z01A 3HWUA 3N2KB 3GTZA 3U0OA 3WJPA 5CA0A 1W41A 4ZI7B 4DRXA 3RYHB 5HXUA 1OAPA 1SA0B 5JVDA 4XCQA 1UFYA 3CG6A 4IIJA 4U3JA 2OTJF 3F0FA 3OONA 5IJ9A 1X7OA 3P4EA 3JASA 5GIOC 2PHNA 4B46A 4FFBB 4BT4A 1FSZA 2VAPA 3IKFA 4X1KA 3V4DA 3LWPC 5FJ4C 2LCAA 3VTIC 4TUYB 5JCOA 3QUWA 5JQGB 1W3EX 5HXZA 4ZHQA 1TVKA 1JJ2F 5FNVB 5J2TB 2BTOA 1IV4A 3M1XA 4YJ2B 3GYQA 2QEXF 1VQNF 1GX1A 3CCRF 5C8YB 4YJ3A 2IAFA 2PMPA 2Z1TA 1W5BA 2L26A 4F6RB 3OW2F 4O2AA 2HVYD 5IT9M 5IJ0A 2HX0A 3LYBA 5EB0A 5CA1A 3LWQC 1VH8A 1KQSF 2V9YA 2HP0A 3WJQA 3BYQA 3I7TA 1IV1A 4KWEA 2NMUA 1Z5VA 3CMAF 3I3FA 5IYZB 3CB2A 5LA6B 3MBMA 4C4WC 4O4HB 5LP6B 4O4JB 5LOVA 4BVTA 1YJWF 3MCAB 3SIVA 2H8EA 3C9SA 4ZOLA 1VK3A 4IHJB 3VOAA 3M4SA 5MN5A 1X7PA 1VQ5F 2KTUA 4I55A 3J7AR 2OTMA 3KE1A 5EYPA 2AIZP 3VYSC 4RHAA 4DXDA 3KHNA 1W57A 3QHDA 1XHOA 1GZ0A 3F0DA 3N2GB 5EZYA 5JCOC 5GINC 1W5EA 4G4ZA 4G4YA 1U3LA 5LXTA 3I56F 3S02A 1OFUA 1R1MA 3S0WA 1IV2A 4G88A 2HRYA 2HS0A 4BY9D 5J2UB 3RYIB 4NWOB
chains in the Genus database with same CATH topology
1RLGA 2KTVA 3ON1A 3V7EA 1IPAA 5DCVA 3LWOC 2FC3A 2QI2A 3RA5A 1E7KA 1Q86H 1M1KH 2VGNA 5EWRA 1VQKF 3CPQA 2ALEA 1VQLF 2OZBA 3CD6F 3O85A 4BVSA 3J81M 5HY2A 1RA4A 2OHWA 5HY0A 1VQ8F 4X3LA 3OBYA 3NMUC 1VQOF 3LWRC 3CC7F 1YJNF 1K9MH 3CCVF 3CXCF 4LCKA 2JNBA 2AIFA 1VQMF 1DT9A 1W41A 1YI2F 2LBXA 5HXUA 4EI8A 3RA6A 4XCQA 2WALA 3CG6A 3CCQF 2OTJF 2F9ZC 5EO3A 2GLZA 1X7OA 1YITF 5GIOC 5G4VC 2I6DA 3PAFA 3JCMM 5FLXM 1Q82H 5FJ4C 3LWPC 4EI7A 1GO1A 1VQ6F 3D00A 3CCLF 3N4ZA 1W3EX 5HXZA 3FFMA 3CCUF 1QVGF 1W42A 3NVIB 1JJ2F 1PXWA 1NMUB 4BW0B 3LWVC 1KD1H 3HAXD 1Q7YH 1T0KB 3CC4F 3G71F 3GYQA 2QEXF 1NJIH 1VQNF 3HJWC 4X3MA 3CCRF 2BO1A 3AGKA 5GIPC 1YHQF 1M90H 1SDSA 3I55F 3NK6A 2KG4A 5GANK 2HVYD 5IT9M 3WXMB 3OW2F 4BVRA 1X52A 5HY4A 3LWQC 3SIUA 3CMEF 1K73H 3CCSF 5A2QM 1KQSF 3E20B 3G6EF 3CPWF 3G4SF 1YIJF 1YJ9F 1W2BF 5G4UC 3CMAF 5HY1A 2QA4F 1S72F 1VQPF 1VQ4F 4C4WC 4BVTA 1YJWF 3MCAB 1KC8H 3SIVA 1VQ9F 1W40A 3NVKE 3JAMM 3CC2F 1VQ7F 2CZWA 2VGMA 1CN7A 3VMFB 3PLAC 1X7PA 2FGYA 4TZZA 1VQ5F 2KTUA 3CCJF 5GAPK 3N4YA 4NUTA 3J7AR 3VI6A 1H7MA 1Q81H 1CK2A 5HWEA 4EI9A 3CCEF 3J80M 3IR9A 3NK7A 3V7QA 4BVQA 1GZ0A 5GINC 4NQ3A 1K8AH 3CCMF 3LFOA 1QVFF 3E1YA 3I56F 1N8RH 2LBWA 1XBIA 1GO0A 1ZWZA 2OTLF 3V3TA 4BY9D 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLG A;  2KTV A;  3ON1 A;  3V7E A;  1IPA A;  5DCV A;  3LWO C;  2FC3 A;  2QI2 A;  3RA5 A;  1E7K A;  1Q86 H;  1M1K H;  2VGN A;  5EWR A;  1VQK F;  3CPQ A;  2ALE A;  1VQL F;  2OZB A;  3CD6 F;  3O85 A;  3J81 M;  1RA4 A;  2OHW A;  1VQ8 F;  4X3L A;  3OBY A;  3NMU C;  1VQO F;  3LWR C;  3CC7 F;  1YJN F;  1K9M H;  3CCV F;  3CXC F;  4LCK A;  2JNB A;  2AIF A;  1VQM F;  1DT9 A;  1W41 A;  1YI2 F;  2LBX A;  3RA6 A;  2WAL A;  3CG6 A;  3CCQ F;  2OTJ F;  5EO3 A;  1X7O A;  1YIT F;  5GIO C;  5G4V C;  2I6D A;  3PAF A;  3JCM M;  5FLX M;  1Q82 H;  5FJ4 C;  3LWP C;  1GO1 A;  1VQ6 F;  3CCL F;  3N4Z A;  1W3E X;  3FFM A;  3CCU F;  1QVG F;  1W42 A;  3NVI B;  1JJ2 F;  1PXW A;  1NMU B;  4BW0 B;  3LWV C;  1KD1 H;  3HAX D;  1Q7Y H;  1T0K B;  3CC4 F;  3G71 F;  3GYQ A;  2QEX F;  1NJI H;  1VQN F;  3HJW C;  4X3M A;  3CCR F;  2BO1 A;  3AGK A;  5GIP C;  1YHQ F;  1M90 H;  1SDS A;  3I55 F;  3NK6 A;  2KG4 A;  5GAN K;  2HVY D;  5IT9 M;  3WXM B;  3OW2 F;  1X52 A;  3LWQ C;  3SIU A;  3CME F;  1K73 H;  3CCS F;  5A2Q M;  1KQS F;  3E20 B;  3G6E F;  3CPW F;  3G4S F;  1YIJ F;  1YJ9 F;  1W2B F;  5G4U C;  3CMA F;  2QA4 F;  1S72 F;  1VQP F;  1VQ4 F;  4C4W C;  1YJW F;  3MCA B;  1KC8 H;  3SIV A;  1VQ9 F;  1W40 A;  3NVK E;  3JAM M;  3CC2 F;  1VQ7 F;  2CZW A;  2VGM A;  1CN7 A;  3VMF B;  3PLA C;  1X7P A;  4TZZ A;  1VQ5 F;  2KTU A;  3CCJ F;  5GAP K;  3N4Y A;  4NUT A;  3J7A R;  3VI6 A;  1H7M A;  1Q81 H;  1CK2 A;  3CCE F;  3J80 M;  3IR9 A;  3NK7 A;  3V7Q A;  1GZ0 A;  5GIN C;  1K8A H;  3CCM F;  3LFO A;  1QVF F;  3E1Y A;  3I56 F;  1N8R H;  2LBW A;  1XBI A;  1GO0 A;  1ZWZ A;  2OTL F;  4BY9 D;  3OBW A; 
#chains in the Genus database with same CATH topology
 1RLG A;  2G9I A;  4RQO A;  4HNA B;  4X20 A;  3RYF A;  4BT5 A;  3V7E A;  3MQW A;  3JAL B;  5HP8 A;  4X1I B;  5CB4 A;  3NMU C;  2DT4 A;  2EWC A;  2YYE A;  2HRU A;  2RHH A;  3JAR B;  4O4I B;  3RYC B;  3CC7 F;  3CCV F;  3CXC F;  4LCK A;  2BTU A;  2AIF A;  1VQM F;  3ESJ A;  2GZL A;  2LBX A;  3ELC A;  4I4T B;  3ERN A;  1U40 A;  5CA0 B;  3HKC B;  3WGL A;  4DRX B;  5JVD B;  4IIJ B;  4U3J B;  3KJK A;  1XRG A;  2I6D A;  3PAF A;  1Q82 H;  5HP7 A;  5IJ9 B;  2CWJ A;  2CW4 A;  5KX5 B;  4ZHV A;  2RHO A;  1GO1 A;  3JAS B;  3D00 A;  3FFM A;  4X1K B;  1DBF A;  3S06 A;  4BT6 A;  1QVG F;  1W42 A;  3VCZ A;  3HKD A;  3C9U A;  1NMU B;  4BW0 B;  3WGM A;  3LWV C;  4O4L A;  2VAM A;  1QD9 A;  1Q7Y H;  3T80 A;  1SZQ A;  4ZHQ B;  4R40 B;  3AGK A;  1TVK B;  4E6E A;  1SDS A;  1TUB B;  4TV9 A;  5GAN K;  3F0G A;  3WXM B;  3ZOP A;  1X52 A;  1JFF A;  4YJ3 B;  5HY4 A;  4O2A B;  3SIU A;  2B33 A;  5BMV B;  5IJ0 B;  5ITZ A;  3CCS F;  2QTP A;  2Z1U A;  5CA1 B;  3FBA A;  3E20 B;  3Q8H A;  5LYJ A;  3G4S F;  5G4U C;  3K2X A;  2DYY A;  3VYU C;  1VQ4 F;  2H8C A;  1VQV A;  2R75 1;  3R0P A;  2UYP A;  1KC8 H;  3VYT C;  5GON A;  4BT3 A;  3C8L A;  4ZHW A;  3CC2 F;  5LOV B;  1VQ7 F;  2VGM A;  3VMF B;  4TZZ A;  1JD1 A;  5GAP K;  1H7M A;  3KJJ A;  3L7Q A;  1W55 A;  3IR9 A;  3V7Q A;  2I6R A;  3WPX A;  4I55 B;  3TD3 A;  4NQ3 A;  1JY8 A;  2CHS A;  4I50 A;  3ZP4 A;  5KMG A;  4TV8 A;  3TD4 A;  5EZY B;  3RYH A;  3VIU A;  2N48 A;  1ZWZ A;  1NQ3 A;  5MN4 A;  2OTL F;  5LXT B;  2LBT A;  3OBW A;  2VXY A;  4C8E A;  3S0H A;  4FFB A;  2KTV A;  3MDO A;  3ZP7 A;  3IMP A;  2Q1X A;  1Q86 H;  1E7K A;  3RYF B;  4ZK7 A;  2ZOV A;  1M1K H;  2VGN A;  1QAH A;  4BVS A;  4YJ2 A;  5HY0 A;  3HKB B;  3OBY A;  5C8Y A;  5CB4 B;  1YJN F;  1K9M H;  2KGW A;  3JAT A;  3ZO8 A;  2CSL A;  3CCQ F;  2F9Z C;  5EO3 A;  3DC2 A;  3WGK A;  2RHJ A;  1YIT F;  2HS3 A;  5G4V C;  3JCM M;  5FLX M;  2ZF8 A;  4B62 A;  4EB6 A;  2ZVZ A;  3K12 A;  2ZVY A;  4EI7 A;  2HS4 A;  3N4Z A;  4B5C A;  3QTY A;  4C82 A;  2H6L A;  1KD1 H;  3HAX D;  1T0K B;  1NJI H;  3F6M A;  5GIP C;  2UZH A;  3HKD B;  1YHQ F;  3WGJ A;  4O4L B;  3IEW A;  4BVR A;  4B45 A;  5JH7 A;  1W58 1;  4TV9 B;  1K73 H;  1JFF B;  4O2B A;  2UYN A;  1QU9 A;  3G6E F;  3CPW F;  3EOR A;  2QA4 F;  5LYJ B;  3JAK A;  3CYP B;  1KNK A;  1FFX A;  2W8B C;  2UYK A;  4ERH A;  4WBN A;  1VQ9 F;  3FD5 A;  2FGY A;  2ZOD A;  1J7H A;  4BT2 A;  3N4Y A;  4NUT A;  3LME A;  1ONI A;  5GON B;  1FNJ A;  5HWE A;  2R6R 1;  4EI9 A;  1Q8R A;  3NK7 A;  4M8I A;  1ODE A;  3FD6 A;  4O4I A;  4C8G A;  3LFO A;  1W5F A;  4ZHY B;  3E22 A;  2LBW A;  2HP0 B;  4I50 B;  5EIB C;  2CHT A;  5KMG B;  5EB1 B;  3HKC A;  4TV8 B;  3V3T A;  1RQ2 A;  1U3P A;  1YQN A;  3HKE A;  1COM A;  3ON1 A;  1W5A A;  5KX5 A;  1JN1 A;  3JAW A;  3P0Z A;  4ZOL B;  2FC3 A;  2QI2 A;  3RA5 A;  4LNU A;  1VHA A;  3UT5 A;  3B6N A;  5EWR A;  3C9T A;  2OZB A;  4X1Y A;  3K14 A;  2Q1Y A;  2IQQ A;  3O85 A;  3CD6 F;  3J81 M;  5EYP B;  3WGN A;  2UYJ A;  3N2K A;  1VQ8 F;  4G4V A;  4ZI7 A;  3LWR C;  1SA0 A;  2JNB A;  1TUB A;  3C9R A;  1DT9 A;  1YI2 F;  4EI8 A;  3RA6 A;  2RB9 A;  2WAL A;  3WPW A;  2Z1E A;  2HQS C;  3JAT B;  1UI9 A;  5BMV A;  3S0Y A;  3LDT A;  1KNJ A;  2GLZ A;  2VAW A;  1X25 A;  1H47 A;  1T0A A;  4TUY A;  4X20 B;  5JQG A;  3VO8 A;  1VQ6 F;  3CCL F;  5FNV A;  5J2T A;  4EB6 B;  3CCU F;  3NVI B;  1PXW A;  3CC4 F;  3G71 F;  3HJW C;  4X3M A;  3F0E A;  2BO1 A;  3DDN A;  4F6R A;  2CVL A;  3M84 A;  1XV2 A;  1Z5W A;  2IG8 A;  1M90 H;  3GHZ A;  3I55 F;  3NK6 A;  2KG4 A;  3S03 A;  3RE3 A;  2ZAU A;  3HTN A;  3VOB A;  1W59 A;  2HP3 A;  3CME F;  3TD5 A;  3K0T A;  5A2Q M;  4U39 A;  5JH7 B;  4C81 A;  5IYZ A;  3MCQ A;  5EIB D;  5LA6 A;  1YIJ F;  4O4H A;  5LP6 A;  3D01 A;  4O4J A;  1YJ9 F;  4G4X A;  1W2B F;  4O2B B;  5HY1 A;  1PF5 A;  2UYN B;  5EAZ A;  1S72 F;  1VQP F;  3WJR A;  4IHJ A;  3D54 A;  1U43 A;  1W40 A;  3JAK B;  3NVK E;  3JAM M;  1FFX B;  3IEQ A;  2CZW A;  1CN7 A;  3PLA C;  4WBN B;  1RLU A;  2AMT A;  2P6Y A;  3CCJ F;  4G4W A;  1RQ7 A;  3VI6 A;  1Q81 H;  1CK2 A;  3N2G A;  3CCE F;  2Z1F A;  3J80 M;  3HKB A;  1IV3 A;  4BVQ A;  3IKE A;  3FPI A;  1K8A H;  3CCM F;  2BTQ B;  3P10 A;  4BT7 A;  1QVF F;  2GVI A;  3E1Y A;  5ITZ B;  1N8R H;  5J2U A;  1XBI A;  1GO0 A;  3RYI A;  5AVM A;  3KIZ A;  4PWT A;  3E22 B;  2MQE A;  4HNA A;  2RHL A;  3JVH A;  3JAL A;  5B8F A;  4X1I A;  1IPA A;  3HKE B;  3LWO C;  5DCV A;  1CLI A;  3JAW B;  1VQK F;  3CPQ A;  2ALE A;  1VQL F;  1FNK A;  1YGY A;  3JAR A;  2K1S A;  5LP6 C;  5HY2 A;  1RA4 A;  4LNU B;  1H48 A;  3UT5 B;  2OHW A;  3RYC A;  2YXZ A;  4X3L A;  4C8I A;  4X1Y B;  3CYQ A;  5MN6 A;  4I4T A;  1VQO F;  2Z01 A;  3HWU A;  3N2K B;  3GTZ A;  3U0O A;  3WJP A;  5CA0 A;  1W41 A;  4ZI7 B;  4DRX A;  3RYH B;  5HXU A;  1OAP A;  1SA0 B;  5JVD A;  4XCQ A;  1UFY A;  3CG6 A;  4IIJ A;  4U3J A;  2OTJ F;  3F0F A;  3OON A;  5IJ9 A;  1X7O A;  3P4E A;  3JAS A;  5GIO C;  2PHN A;  4B46 A;  4FFB B;  4BT4 A;  1FSZ A;  2VAP A;  3IKF A;  4X1K A;  3V4D A;  3LWP C;  5FJ4 C;  2LCA A;  3VTI C;  4TUY B;  5JCO A;  3QUW A;  5JQG B;  1W3E X;  5HXZ A;  4ZHQ A;  1TVK A;  1JJ2 F;  5FNV B;  5J2T B;  2BTO A;  1IV4 A;  3M1X A;  4YJ2 B;  3GYQ A;  2QEX F;  1VQN F;  1GX1 A;  3CCR F;  5C8Y B;  4YJ3 A;  2IAF A;  2PMP A;  2Z1T A;  1W5B A;  2L26 A;  4F6R B;  3OW2 F;  4O2A A;  2HVY D;  5IT9 M;  5IJ0 A;  2HX0 A;  3LYB A;  5EB0 A;  5CA1 A;  3LWQ C;  1VH8 A;  1KQS F;  2V9Y A;  2HP0 A;  3WJQ A;  3BYQ A;  3I7T A;  1IV1 A;  4KWE A;  2NMU A;  1Z5V A;  3CMA F;  3I3F A;  5IYZ B;  3CB2 A;  5LA6 B;  3MBM A;  4C4W C;  4O4H B;  5LP6 B;  4O4J B;  5LOV A;  4BVT A;  1YJW F;  3MCA B;  3SIV A;  2H8E A;  3C9S A;  4ZOL A;  1VK3 A;  4IHJ B;  3VOA A;  3M4S A;  5MN5 A;  1X7P A;  1VQ5 F;  2KTU A;  4I55 A;  3J7A R;  2OTM A;  3KE1 A;  5EYP A;  2AIZ P;  3VYS C;  4RHA A;  4DXD A;  3KHN A;  1W57 A;  3QHD A;  1XHO A;  1GZ0 A;  3F0D A;  3N2G B;  5EZY A;  5JCO C;  5GIN C;  1W5E A;  4G4Z A;  4G4Y A;  1U3L A;  5LXT A;  3I56 F;  3S02 A;  1OFU A;  1R1M A;  3S0W A;  1IV2 A;  4G88 A;  2HRY A;  2HS0 A;  4BY9 D;  5J2U B;  3RYI B;  4NWO B; 
#chains in the Genus database with same CATH homology
 1RLG A;  2KTV A;  3ON1 A;  3V7E A;  1IPA A;  5DCV A;  3LWO C;  2FC3 A;  2QI2 A;  3RA5 A;  1E7K A;  1Q86 H;  1M1K H;  2VGN A;  5EWR A;  1VQK F;  3CPQ A;  2ALE A;  1VQL F;  2OZB A;  3CD6 F;  3O85 A;  4BVS A;  3J81 M;  5HY2 A;  1RA4 A;  2OHW A;  5HY0 A;  1VQ8 F;  4X3L A;  3OBY A;  3NMU C;  1VQO F;  3LWR C;  3CC7 F;  1YJN F;  1K9M H;  3CCV F;  3CXC F;  4LCK A;  2JNB A;  2AIF A;  1VQM F;  1DT9 A;  1W41 A;  1YI2 F;  2LBX A;  5HXU A;  4EI8 A;  3RA6 A;  4XCQ A;  2WAL A;  3CG6 A;  3CCQ F;  2OTJ F;  2F9Z C;  5EO3 A;  2GLZ A;  1X7O A;  1YIT F;  5GIO C;  5G4V C;  2I6D A;  3PAF A;  3JCM M;  5FLX M;  1Q82 H;  5FJ4 C;  3LWP C;  4EI7 A;  1GO1 A;  1VQ6 F;  3D00 A;  3CCL F;  3N4Z A;  1W3E X;  5HXZ A;  3FFM A;  3CCU F;  1QVG F;  1W42 A;  3NVI B;  1JJ2 F;  1PXW A;  1NMU B;  4BW0 B;  3LWV C;  1KD1 H;  3HAX D;  1Q7Y H;  1T0K B;  3CC4 F;  3G71 F;  3GYQ A;  2QEX F;  1NJI H;  1VQN F;  3HJW C;  4X3M A;  3CCR F;  2BO1 A;  3AGK A;  5GIP C;  1YHQ F;  1M90 H;  1SDS A;  3I55 F;  3NK6 A;  2KG4 A;  5GAN K;  2HVY D;  5IT9 M;  3WXM B;  3OW2 F;  4BVR A;  1X52 A;  5HY4 A;  3LWQ C;  3SIU A;  3CME F;  1K73 H;  3CCS F;  5A2Q M;  1KQS F;  3E20 B;  3G6E F;  3CPW F;  3G4S F;  1YIJ F;  1YJ9 F;  1W2B F;  5G4U C;  3CMA F;  5HY1 A;  2QA4 F;  1S72 F;  1VQP F;  1VQ4 F;  4C4W C;  4BVT A;  1YJW F;  3MCA B;  1KC8 H;  3SIV A;  1VQ9 F;  1W40 A;  3NVK E;  3JAM M;  3CC2 F;  1VQ7 F;  2CZW A;  2VGM A;  1CN7 A;  3VMF B;  3PLA C;  1X7P A;  2FGY A;  4TZZ A;  1VQ5 F;  2KTU A;  3CCJ F;  5GAP K;  3N4Y A;  4NUT A;  3J7A R;  3VI6 A;  1H7M A;  1Q81 H;  1CK2 A;  5HWE A;  4EI9 A;  3CCE F;  3J80 M;  3IR9 A;  3NK7 A;  3V7Q A;  4BVQ A;  1GZ0 A;  5GIN C;  4NQ3 A;  1K8A H;  3CCM F;  3LFO A;  1QVF F;  3E1Y A;  3I56 F;  1N8R H;  2LBW A;  1XBI A;  1GO0 A;  1ZWZ A;  2OTL F;  3V3T A;  4BY9 D;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...